BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN031H03

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAG10403.1|AF233284_1  mannose-binding lectin                        183   8e-55   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                  179   4e-53   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...    176   7e-52   Calystegia sepium
dbj|BAA14024.1|  ipomoelin                                              140   7e-38   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...    140   8e-38   Ipomoea batatas [batate]
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    1e-18   
gb|EEC68267.1|  hypothetical protein OsI_36302                        94.0    3e-18   Oryza sativa Indica Group [Indian rice]
gb|ABA93998.1|  NB-ARC domain containing protein, expressed           92.8    8e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52195.1|  hypothetical protein OsJ_34074                        91.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  91.3    3e-17   Nicotiana sylvestris
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  91.3    3e-17   Nicotiana sylvestris
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  91.3    3e-17   Nicotiana sylvestris
ref|XP_008444758.1|  PREDICTED: LOW QUALITY PROTEIN: myrosinase-b...  89.7    4e-17   
ref|XP_004152769.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    5e-17   
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          85.1    6e-17   
gb|KGN62634.1|  hypothetical protein Csa_2G362470                     89.0    7e-17   Cucumis sativus [cucumbers]
gb|EMT18893.1|  Disease resistance protein RPM1                       89.4    7e-17   
sp|Q5U9T2.1|LECH_HORVU  RecName: Full=Horcolin; AltName: Full=Agg...  84.0    1e-16   Hordeum vulgare [barley]
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       85.9    2e-16   Nicotiana tomentosiformis
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  88.2    3e-16   Nicotiana sylvestris
gb|EEC68269.1|  hypothetical protein OsI_36304                        87.0    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        83.2    6e-16   
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  87.0    6e-16   Nicotiana tomentosiformis
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  87.0    6e-16   Nicotiana tomentosiformis
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  87.0    6e-16   Nicotiana tomentosiformis
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  87.0    7e-16   Nicotiana sylvestris
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  87.0    7e-16   Nicotiana sylvestris
gb|EEE52196.1|  hypothetical protein OsJ_34075                        86.7    7e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372325.1|  Mannose/glucose-specific lectin family protein   85.1    8e-16   Populus trichocarpa [western balsam poplar]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  86.7    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  86.7    9e-16   Nicotiana sylvestris
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  85.9    1e-15   
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  85.1    2e-15   Oryza brachyantha
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  85.1    2e-15   Oryza brachyantha
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  85.1    2e-15   Nicotiana sylvestris
ref|XP_009588771.1|  PREDICTED: agglutinin-like                       82.0    3e-15   Nicotiana tomentosiformis
ref|XP_011001797.1|  PREDICTED: mannose/glucose-specific lectin-l...  83.2    3e-15   Populus euphratica
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  84.7    4e-15   Nicotiana sylvestris
gb|ACF87628.1|  unknown                                               79.0    4e-15   Zea mays [maize]
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  84.7    4e-15   Nicotiana sylvestris
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  84.7    4e-15   Nicotiana sylvestris
sp|P83304.1|LEC_PARPC  RecName: Full=Mannose/glucose-specific lectin  83.2    4e-15   Parkia platycephala
ref|XP_011015046.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.8    5e-15   Populus euphratica
ref|XP_011001798.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.4    7e-15   Populus euphratica
ref|XP_009338132.1|  PREDICTED: uncharacterized protein LOC103930...  83.6    7e-15   Pyrus x bretschneideri [bai li]
gb|KJB58185.1|  hypothetical protein B456_009G198200                  83.6    8e-15   Gossypium raimondii
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  83.6    8e-15   Nicotiana sylvestris
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         80.1    8e-15   Nicotiana sylvestris
ref|XP_011015045.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.8    9e-15   Populus euphratica
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  80.5    9e-15   Solanum tuberosum [potatoes]
ref|NP_001106057.1|  PL3K2                                            78.6    1e-14   Zea mays [maize]
ref|XP_011001796.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.4    1e-14   Populus euphratica
ref|XP_004960703.1|  PREDICTED: agglutinin-like                       80.5    1e-14   Setaria italica
ref|NP_001066367.1|  Os12g0198700                                     80.1    1e-14   
gb|ACG29554.1|  hypothetical protein                                  78.2    1e-14   Zea mays [maize]
gb|EMT23136.1|  hypothetical protein F775_18655                       77.4    1e-14   
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.0    2e-14   
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           79.7    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC69076.1|  hypothetical protein OsI_37951                        79.0    2e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001066495.1|  Os12g0247700                                     79.3    2e-14   
ref|XP_004291831.1|  PREDICTED: jacalin-related lectin 3              81.6    2e-14   Fragaria vesca subsp. vesca
gb|EAY82651.1|  hypothetical protein OsI_37872                        79.3    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  82.0    3e-14   
ref|XP_011001803.1|  PREDICTED: mannose/glucose-specific lectin-like  80.5    3e-14   Populus euphratica
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     79.0    3e-14   Triticum urartu
ref|XP_008244775.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  79.0    5e-14   
pdb|4MQ0|A  Chain A, Crystal Structure Of Parkia Biglobosa Seed L...  79.7    6e-14   Parkia biglobosa
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  80.9    7e-14   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  80.9    7e-14   
ref|XP_008677998.1|  PREDICTED: mannose/glucose-specific lectin-l...  80.1    7e-14   Zea mays [maize]
ref|XP_008677996.1|  PREDICTED: mannose/glucose-specific lectin-l...  80.1    8e-14   Zea mays [maize]
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  80.1    8e-14   
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  80.1    8e-14   
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  80.1    8e-14   
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  80.5    8e-14   Nicotiana sylvestris
ref|XP_008677994.1|  PREDICTED: mannose/glucose-specific lectin-l...  80.1    8e-14   Zea mays [maize]
ref|XP_007215056.1|  hypothetical protein PRUPE_ppa012210mg           76.3    1e-13   
ref|XP_002449838.1|  hypothetical protein SORBIDRAFT_05g024220        77.0    1e-13   
ref|XP_009760249.1|  PREDICTED: agglutinin-like                       77.8    1e-13   Nicotiana sylvestris
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        77.0    1e-13   
ref|XP_011463712.1|  PREDICTED: jacalin-related lectin 3-like         79.3    1e-13   Fragaria vesca subsp. vesca
gb|EEC72970.1|  hypothetical protein OsI_06866                        80.1    1e-13   Oryza sativa Indica Group [Indian rice]
dbj|BAD23250.1|  putative LZ-NBS-LRR class RGA                        80.1    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804538.1|  PREDICTED: uncharacterized protein LOC103717797  79.3    1e-13   
ref|XP_008244753.1|  PREDICTED: agglutinin-like                       75.9    1e-13   Prunus mume [ume]
gb|ABS82785.1|  jasmonate-induced protein                             77.0    1e-13   Triticum aestivum [Canadian hard winter wheat]
gb|AAR20919.1|  jasmonate-induced protein                             77.0    1e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007216928.1|  hypothetical protein PRUPE_ppa016643mg           77.8    1e-13   
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  75.1    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_002440040.1|  hypothetical protein SORBIDRAFT_09g024950        79.0    2e-13   
gb|EYU45162.1|  hypothetical protein MIMGU_mgv1a025414mg              77.0    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_008348486.1|  PREDICTED: agglutinin alpha chain-like           75.5    2e-13   Malus domestica [apple tree]
ref|NP_001140746.1|  hypothetical protein                             78.6    2e-13   Zea mays [maize]
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        78.6    2e-13   Amborella trichopoda
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  78.2    3e-13   
gb|AFW60405.1|  putative protein kinase superfamily protein           78.2    3e-13   
ref|XP_004982894.1|  PREDICTED: salt stress-induced protein-like      74.3    3e-13   
gb|EMS55842.1|  hypothetical protein TRIUR3_32339                     75.9    3e-13   Triticum urartu
gb|AAA87041.1|  putative 32.6 kDa jasmonate-induced protein           75.9    4e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24046.1|  hypothetical protein F775_25349                       75.9    4e-13   
ref|XP_004961574.1|  PREDICTED: mannose/glucose-specific lectin-like  77.8    4e-13   
gb|KHG26998.1|  Agglutinin                                            77.8    5e-13   Gossypium arboreum [tree cotton]
gb|KJB58186.1|  hypothetical protein B456_009G198200                  78.2    5e-13   Gossypium raimondii
gb|EAY80990.1|  hypothetical protein OsI_36172                        78.2    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_007146775.1|  hypothetical protein PHAVU_006G068800g           77.0    6e-13   Phaseolus vulgaris [French bean]
ref|XP_003573652.1|  PREDICTED: horcolin-like                         72.0    7e-13   Brachypodium distachyon [annual false brome]
ref|NP_001055995.1|  Os05g0508400                                     77.0    7e-13   
ref|XP_010932970.1|  PREDICTED: mannose/glucose-specific lectin-l...  73.9    7e-13   Elaeis guineensis
ref|XP_002300741.2|  hypothetical protein POPTR_0002s03180g           77.0    8e-13   
ref|XP_004980504.1|  PREDICTED: protein GOS9-like                     72.4    8e-13   
gb|EAY98637.1|  hypothetical protein OsI_20561                        77.0    9e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          76.6    9e-13   
gb|EEE64302.1|  hypothetical protein OsJ_19139                        77.0    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EYU45163.1|  hypothetical protein MIMGU_mgv1a020491mg              73.9    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_010932961.1|  PREDICTED: mannose/glucose-specific lectin-l...  74.3    1e-12   Elaeis guineensis
ref|NP_001052399.1|  Os04g0295400                                     72.4    1e-12   
emb|CDP17400.1|  unnamed protein product                              74.3    1e-12   Coffea canephora [robusta coffee]
ref|XP_008348484.1|  PREDICTED: agglutinin-like isoform X2            72.4    2e-12   
ref|XP_008806712.1|  PREDICTED: agglutinin-like isoform X2            72.8    2e-12   Phoenix dactylifera
ref|XP_008806706.1|  PREDICTED: agglutinin-like isoform X1            72.8    2e-12   Phoenix dactylifera
ref|XP_008391447.1|  PREDICTED: uncharacterized protein LOC103453663  74.3    2e-12   
ref|XP_009367509.1|  PREDICTED: agglutinin alpha chain                72.4    2e-12   Pyrus x bretschneideri [bai li]
gb|EMT07650.1|  Horcolin                                              73.9    2e-12   
ref|XP_008348483.1|  PREDICTED: agglutinin-like isoform X1            72.4    3e-12   
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  75.9    3e-12   Nicotiana tomentosiformis
ref|XP_006663456.1|  PREDICTED: disease resistance protein RPM1-like  75.9    3e-12   
gb|ADV38315.1|  mannose/glucose-specific lectin                       71.2    3e-12   Litchi chinensis [litchi]
gb|EMT33809.1|  hypothetical protein F775_16156                       71.6    3e-12   
ref|XP_008677993.1|  PREDICTED: mannose/glucose-specific lectin-l...  75.1    4e-12   
ref|XP_008677995.1|  PREDICTED: mannose/glucose-specific lectin-l...  75.1    4e-12   
ref|XP_004979669.1|  PREDICTED: mannose/glucose-specific lectin-l...  75.1    4e-12   
ref|XP_004979671.1|  PREDICTED: mannose/glucose-specific lectin-l...  75.1    4e-12   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  74.7    4e-12   
ref|XP_004297619.2|  PREDICTED: agglutinin                            74.7    4e-12   Fragaria vesca subsp. vesca
ref|XP_011028924.1|  PREDICTED: uncharacterized protein LOC105128...  75.5    4e-12   Populus euphratica
ref|XP_011028923.1|  PREDICTED: jacalin-related lectin 3-like iso...  74.7    4e-12   Populus euphratica
ref|XP_004979670.1|  PREDICTED: mannose/glucose-specific lectin-l...  75.1    4e-12   Setaria italica
ref|XP_004984089.1|  PREDICTED: protein GOS9-like                     70.9    5e-12   Setaria italica
gb|EMT11070.1|  hypothetical protein F775_02114                       72.8    6e-12   
gb|EYU45843.1|  hypothetical protein MIMGU_mgv1a014002mg              71.2    6e-12   Erythranthe guttata [common monkey flower]
ref|XP_008804539.1|  PREDICTED: mannose/glucose-specific lectin-like  70.5    6e-12   Phoenix dactylifera
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         71.6    6e-12   Brachypodium distachyon [annual false brome]
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           74.7    7e-12   
ref|XP_004164005.1|  PREDICTED: agglutinin-like                       70.9    7e-12   
ref|NP_001044410.1|  Os01g0775500                                     72.8    7e-12   
gb|KDO84683.1|  hypothetical protein CISIN_1g007083mg                 73.9    7e-12   Citrus sinensis [apfelsine]
ref|NP_001148739.1|  LOC100282355                                     71.2    7e-12   
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  74.7    7e-12   
ref|XP_008654965.1|  PREDICTED: LOC100282355 isoform X4               70.9    8e-12   Zea mays [maize]
ref|XP_010935305.1|  PREDICTED: jacalin-related lectin 3-like         73.6    8e-12   
ref|XP_002510454.1|  hypothetical protein RCOM_1595950                73.6    8e-12   
dbj|BAK00987.1|  predicted protein                                    72.0    8e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC71570.1|  hypothetical protein OsI_03937                        73.9    9e-12   Oryza sativa Indica Group [Indian rice]
gb|EEE60695.1|  hypothetical protein OsJ_14181                        68.9    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EMS58273.1|  hypothetical protein TRIUR3_17900                     72.0    9e-12   Triticum urartu
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  74.3    1e-11   Nicotiana tomentosiformis
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  74.3    1e-11   Nicotiana tomentosiformis
dbj|BAJ85606.1|  predicted protein                                    73.6    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO84682.1|  hypothetical protein CISIN_1g007083mg                 73.6    1e-11   Citrus sinensis [apfelsine]
dbj|BAJ88436.1|  predicted protein                                    73.2    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009622527.1|  PREDICTED: agglutinin-like isoform X4            73.2    1e-11   
gb|EAZ01021.1|  hypothetical protein OsI_23055                        73.6    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006662244.1|  PREDICTED: uncharacterized protein LOC102708001  72.0    1e-11   
ref|XP_010924946.1|  PREDICTED: jacalin-related lectin 19-like is...  70.5    1e-11   Elaeis guineensis
ref|XP_002510452.1|  pentatricopeptide repeat-containing protein,...  73.9    1e-11   
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  73.2    1e-11   
gb|EEE55471.1|  hypothetical protein OsJ_03649                        73.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMS65495.1|  hypothetical protein TRIUR3_18396                     72.8    1e-11   Triticum urartu
ref|XP_009391787.1|  PREDICTED: agglutinin-like                       70.9    1e-11   
ref|XP_010924945.1|  PREDICTED: jacalin-related lectin 19-like is...  70.1    1e-11   Elaeis guineensis
ref|XP_009622526.1|  PREDICTED: agglutinin-like isoform X3            73.2    1e-11   
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  73.2    1e-11   
ref|XP_009622525.1|  PREDICTED: agglutinin-like isoform X2            72.8    1e-11   
ref|XP_006301377.1|  hypothetical protein CARUB_v10021789mg           69.7    2e-11   
ref|XP_009622528.1|  PREDICTED: agglutinin-like isoform X5            72.4    2e-11   Nicotiana tomentosiformis
ref|XP_010029744.1|  PREDICTED: jacalin-related lectin 4-like         73.6    2e-11   Eucalyptus grandis [rose gum]
gb|AEQ30064.1|  mannose/glucose-specific lectin                       69.3    2e-11   Litchi chinensis [litchi]
gb|KCW56701.1|  hypothetical protein EUGRSUZ_I02393                   72.4    2e-11   Eucalyptus grandis [rose gum]
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  72.8    2e-11   Malus domestica [apple tree]
ref|XP_009622524.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   Nicotiana tomentosiformis
ref|XP_008221341.1|  PREDICTED: uncharacterized protein LOC103321320  72.8    2e-11   Prunus mume [ume]
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  73.6    2e-11   Nicotiana tomentosiformis
emb|CDM80625.1|  unnamed protein product                              71.2    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006473571.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   Citrus sinensis [apfelsine]
gb|EAY93469.1|  hypothetical protein OsI_15270                        68.9    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006435072.1|  hypothetical protein CICLE_v10000604mg           72.8    2e-11   Citrus clementina [clementine]
ref|XP_006473572.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    2e-11   Citrus sinensis [apfelsine]
gb|KJB63589.1|  hypothetical protein B456_010G007400                  72.4    2e-11   Gossypium raimondii
ref|XP_006654724.1|  PREDICTED: agglutinin-like                       69.7    2e-11   
ref|XP_011030089.1|  PREDICTED: jacalin-related lectin 19             69.7    2e-11   Populus euphratica
ref|XP_010088386.1|  hypothetical protein L484_008121                 69.3    2e-11   Morus notabilis
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              72.4    2e-11   Sesamum indicum [beniseed]
ref|XP_007222058.1|  hypothetical protein PRUPE_ppa003185mg           72.4    3e-11   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  72.8    3e-11   Nicotiana sylvestris
ref|XP_010664949.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    3e-11   
ref|XP_009413293.1|  PREDICTED: protein GOS9-like                     68.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644795.1|  PREDICTED: mannose/glucose-specific lectin-like  72.0    3e-11   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         72.4    3e-11   
emb|CBI19765.3|  unnamed protein product                              72.0    3e-11   Vitis vinifera
gb|EAY96520.1|  hypothetical protein OsI_18424                        68.2    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.0    3e-11   Cicer arietinum [garbanzo]
ref|XP_007142198.1|  hypothetical protein PHAVU_008G260500g           71.6    4e-11   Phaseolus vulgaris [French bean]
ref|XP_007142199.1|  hypothetical protein PHAVU_008G260500g           71.6    4e-11   Phaseolus vulgaris [French bean]
gb|EMS51533.1|  hypothetical protein TRIUR3_05238                     70.1    4e-11   Triticum urartu
ref|NP_001054618.1|  Os05g0143600                                     68.2    4e-11   
ref|XP_006372328.1|  hypothetical protein POPTR_0017s00620g           68.2    4e-11   
ref|XP_002439182.1|  hypothetical protein SORBIDRAFT_09g001880        70.1    4e-11   Sorghum bicolor [broomcorn]
gb|KDP38566.1|  hypothetical protein JCGZ_04491                       71.6    5e-11   Jatropha curcas
gb|EAY90359.1|  hypothetical protein OsI_11939                        68.2    5e-11   Oryza sativa Indica Group [Indian rice]
gb|EAZ25557.1|  hypothetical protein OsJ_09383                        67.4    5e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         71.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    5e-11   
ref|XP_006853909.1|  hypothetical protein AMTR_s00036p00182710        68.6    6e-11   
gb|KHN02073.1|  Agglutinin                                            71.2    6e-11   Glycine soja [wild soybean]
ref|XP_010060992.1|  PREDICTED: jacalin-related lectin 3              71.2    6e-11   Eucalyptus grandis [rose gum]
gb|EMT07330.1|  Disease resistance protein RPM1                       71.6    6e-11   
ref|XP_010477194.1|  PREDICTED: jacalin-related lectin 3-like iso...  71.2    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006602089.1|  PREDICTED: agglutinin-like                       71.2    6e-11   
gb|KHN46147.1|  Agglutinin                                            70.9    7e-11   Glycine soja [wild soybean]
ref|XP_002440568.1|  hypothetical protein SORBIDRAFT_09g003330        67.0    7e-11   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  71.2    8e-11   Nicotiana tomentosiformis
ref|XP_011048833.1|  PREDICTED: jacalin-related lectin 3-like iso...  70.9    9e-11   Populus euphratica
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  68.6    9e-11   
ref|XP_011048832.1|  PREDICTED: jacalin-related lectin 3-like iso...  70.9    9e-11   Populus euphratica
ref|XP_004235622.1|  PREDICTED: jacalin-related lectin 19             67.8    9e-11   Solanum lycopersicum
ref|XP_008654963.1|  PREDICTED: LOC100282355 isoform X3               68.2    9e-11   
ref|XP_008654962.1|  PREDICTED: LOC100282355 isoform X2               68.2    1e-10   Zea mays [maize]
ref|XP_008654961.1|  PREDICTED: LOC100282355 isoform X1               68.2    1e-10   
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        66.6    1e-10   
ref|XP_002515891.1|  hypothetical protein RCOM_1485780                70.1    1e-10   
ref|XP_010471351.1|  PREDICTED: jacalin-related lectin 19             67.4    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009599289.1|  PREDICTED: jacalin-related lectin 3 isoform X2   70.5    1e-10   Nicotiana tomentosiformis
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           70.5    1e-10   Eutrema salsugineum [saltwater cress]
ref|NP_001148448.1|  jasmonate-induced protein                        67.4    1e-10   
ref|XP_006343016.1|  PREDICTED: agglutinin-like                       67.4    1e-10   Solanum tuberosum [potatoes]
ref|XP_009599288.1|  PREDICTED: jacalin-related lectin 3 isoform X1   70.5    1e-10   Nicotiana tomentosiformis
ref|XP_006362248.1|  PREDICTED: myrosinase-binding protein-like A...  70.5    1e-10   Solanum tuberosum [potatoes]
ref|XP_006362247.1|  PREDICTED: myrosinase-binding protein-like A...  70.5    1e-10   Solanum tuberosum [potatoes]
ref|XP_006426466.1|  hypothetical protein CICLE_v10026553mg           67.4    1e-10   Citrus clementina [clementine]
ref|XP_004960459.1|  PREDICTED: salt stress-induced protein-like      66.6    1e-10   Setaria italica
gb|KDO58671.1|  hypothetical protein CISIN_1g037526mg                 67.4    1e-10   Citrus sinensis [apfelsine]
gb|AFW81812.1|  putative protein kinase superfamily protein           70.1    1e-10   
ref|XP_002450764.1|  hypothetical protein SORBIDRAFT_05g017250        70.5    1e-10   
ref|XP_010533571.1|  PREDICTED: jacalin-related lectin 3 isoform X2   70.1    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_009400545.1|  PREDICTED: agglutinin alpha chain                67.4    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  65.9    1e-10   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  70.5    1e-10   
gb|AAQ07258.1|  jacalin-like lectin                                   66.6    1e-10   Ananas comosus
ref|XP_010533565.1|  PREDICTED: jacalin-related lectin 3 isoform X1   70.1    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010690084.1|  PREDICTED: jacalin-related lectin 19             67.0    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          67.0    2e-10   
ref|XP_008656248.1|  PREDICTED: putative receptor-like protein ki...  69.7    2e-10   Zea mays [maize]
ref|XP_010932909.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.2    2e-10   Elaeis guineensis
gb|AFW74546.1|  hypothetical protein ZEAMMB73_667809                  66.2    2e-10   
ref|XP_010537548.1|  PREDICTED: LOW QUALITY PROTEIN: jacalin-rela...  66.6    2e-10   
ref|XP_010932917.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.2    2e-10   
ref|XP_010110011.1|  hypothetical protein L484_021900                 69.7    2e-10   
gb|KDP38565.1|  hypothetical protein JCGZ_04490                       69.7    2e-10   Jatropha curcas
gb|AHW81907.1|  mannose-binding lectin                                66.2    2e-10   Morus alba var. atropurpurea
gb|KFK44089.1|  hypothetical protein AALP_AA1G214700                  69.3    2e-10   Arabis alpina [alpine rockcress]
ref|XP_009398855.1|  PREDICTED: protein GOS9-like                     65.9    2e-10   
ref|XP_006662272.1|  PREDICTED: uncharacterized protein LOC102701759  67.8    2e-10   Oryza brachyantha
ref|XP_010674585.1|  PREDICTED: uncharacterized protein LOC104890703  69.7    3e-10   
emb|CAJ38387.1|  jacalin-domain protein                               66.2    3e-10   Plantago major [cart-track plant]
ref|XP_010237569.1|  PREDICTED: mannose/glucose-specific lectin-l...  69.3    3e-10   
ref|XP_002467724.1|  hypothetical protein SORBIDRAFT_01g033080        65.9    3e-10   
ref|XP_002888904.1|  predicted protein                                65.9    3e-10   
ref|XP_003577374.2|  PREDICTED: mannose/glucose-specific lectin-l...  68.9    3e-10   
ref|XP_010227994.1|  PREDICTED: jacalin-related lectin 3-like         67.8    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           65.9    3e-10   Eutrema salsugineum [saltwater cress]
gb|KJB70346.1|  hypothetical protein B456_011G068300                  65.9    3e-10   Gossypium raimondii
ref|XP_002458378.1|  hypothetical protein SORBIDRAFT_03g032480        66.2    3e-10   
emb|CDX96652.1|  BnaA08g21950D                                        68.9    3e-10   
emb|CAD40628.2|  OSJNBa0016N04.16                                     68.6    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009127966.1|  PREDICTED: agglutinin                            65.9    4e-10   Brassica rapa
gb|AAL10685.1|  mannose-binding lectin                                65.5    4e-10   Morus nigra
emb|CDO97947.1|  unnamed protein product                              67.0    4e-10   Coffea canephora [robusta coffee]
tpg|DAA60181.1|  TPA: hypothetical protein ZEAMMB73_326702            67.4    4e-10   
ref|XP_009110261.1|  PREDICTED: agglutinin-like                       68.6    4e-10   Brassica rapa
ref|XP_010267066.1|  PREDICTED: jacalin-related lectin 19             65.9    4e-10   
ref|XP_009771020.1|  PREDICTED: jacalin-related lectin 3 isoform X2   68.6    4e-10   
ref|XP_009771019.1|  PREDICTED: jacalin-related lectin 3 isoform X1   68.6    4e-10   
gb|AAM46813.1|  hessian fly response gene 1 protein                   67.8    5e-10   
emb|CDY63700.1|  BnaC08g19180D                                        68.6    5e-10   
emb|CDP07465.1|  unnamed protein product                              68.6    5e-10   
ref|NP_001052560.1|  Os04g0369100                                     68.6    5e-10   
gb|EEE60834.1|  hypothetical protein OsJ_14451                        68.6    5e-10   
gb|KHG23822.1|  Agglutinin alpha chain                                65.5    5e-10   
gb|KCW69704.1|  hypothetical protein EUGRSUZ_F03098                   66.2    5e-10   
emb|CAE76026.1|  B1292H11.12                                          65.5    5e-10   
ref|XP_002467725.1|  hypothetical protein SORBIDRAFT_01g033090        65.1    5e-10   
ref|XP_008648490.1|  PREDICTED: salt stress-induced protein-like      64.7    5e-10   
gb|EMS53468.1|  hypothetical protein TRIUR3_21407                     64.7    5e-10   
gb|KDP46660.1|  hypothetical protein JCGZ_10969                       68.2    5e-10   
gb|ABF96452.1|  Jacalin-like lectin domain containing protein, ex...  65.1    6e-10   
gb|ABA94721.1|  Jacalin-like lectin domain containing protein         68.2    6e-10   
ref|XP_010459648.1|  PREDICTED: jacalin-related lectin 3 isoform X1   68.2    6e-10   
ref|XP_004960702.1|  PREDICTED: mannose/glucose-specific lectin-like  67.0    6e-10   
ref|NP_001056189.1|  Os05g0541800                                     64.3    7e-10   
ref|NP_001068257.2|  Os11g0607900                                     63.9    7e-10   
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       65.5    7e-10   
ref|XP_006651478.1|  PREDICTED: horcolin-like                         64.7    7e-10   
gb|AAK55472.1|AC084295_5  putative salt-induced protein               65.1    7e-10   
ref|XP_010092351.1|  hypothetical protein L484_023729                 65.1    7e-10   
ref|XP_002318228.2|  hypothetical protein POPTR_0012s13320g           65.9    7e-10   
ref|XP_010498396.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    8e-10   
ref|NP_001050311.2|  Os03g0399800                                     65.1    8e-10   
ref|XP_004249154.1|  PREDICTED: jacalin-related lectin 3 isoform X2   67.8    8e-10   
ref|XP_010312054.1|  PREDICTED: jacalin-related lectin 3 isoform X1   67.8    8e-10   
ref|XP_010428208.1|  PREDICTED: jacalin-related lectin 19-like is...  64.7    8e-10   
ref|XP_010477195.1|  PREDICTED: jacalin-related lectin 3-like iso...  67.8    8e-10   
pdb|1XXQ|A  Chain A, Structure Of A Mannose-Specific Jacalin-Rela...  64.3    8e-10   
ref|XP_010092355.1|  hypothetical protein L484_023733                 64.7    9e-10   
ref|XP_010477196.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    9e-10   
ref|XP_008466548.1|  PREDICTED: agglutinin-like                       67.4    9e-10   
ref|XP_010932990.1|  PREDICTED: mannose/glucose-specific lectin-like  66.2    9e-10   
ref|XP_003597652.1|  Agglutinin alpha chain                           67.8    1e-09   
gb|AAZ73661.1|  At1g19715                                             64.3    1e-09   
ref|XP_009417114.1|  PREDICTED: horcolin {ECO:0000312|EMBL:AAV395...  63.9    1e-09   
gb|KDP46650.1|  hypothetical protein JCGZ_10959                       67.4    1e-09   
gb|EEC79620.1|  hypothetical protein OsI_20824                        64.7    1e-09   
ref|XP_010062570.1|  PREDICTED: jacalin-related lectin 19             65.9    1e-09   
gb|AAZ73664.1|  At1g19715                                             64.3    1e-09   
ref|XP_008466552.1|  PREDICTED: agglutinin-like                       64.3    1e-09   
gb|AAZ73652.1|  At1g19715                                             64.3    1e-09   
ref|XP_004986922.1|  PREDICTED: horcolin-like                         63.5    1e-09   
gb|AAZ73669.1|  At1g19715-like protein                                64.3    1e-09   
ref|NP_001176790.1|  Os12g0144100                                     62.4    1e-09   
ref|XP_010239309.1|  PREDICTED: LOW QUALITY PROTEIN: protein GOS9...  65.1    2e-09   
ref|XP_009614655.1|  PREDICTED: mannose/glucose-specific lectin-like  63.5    2e-09   
ref|XP_010428207.1|  PREDICTED: jacalin-related lectin 19-like is...  64.3    2e-09   
ref|XP_003575754.1|  PREDICTED: uncharacterized protein LOC100829827  65.9    2e-09   
ref|XP_008651439.1|  PREDICTED: jasmonate-induced protein isoform X1  65.5    2e-09   
ref|XP_004974871.1|  PREDICTED: mannose/glucose-specific lectin-like  64.7    2e-09   
ref|NP_001141303.1|  uncharacterized protein LOC100273394             65.5    2e-09   
ref|XP_010428206.1|  PREDICTED: jacalin-related lectin 19-like is...  64.3    2e-09   
ref|XP_011081586.1|  PREDICTED: jacalin-related lectin 19-like        65.5    2e-09   
gb|EEE60415.1|  hypothetical protein OsJ_13609                        62.4    2e-09   
gb|KHN34265.1|  Agglutinin                                            66.2    2e-09   
gb|EEE52450.1|  hypothetical protein OsJ_34606                        65.9    2e-09   
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        63.5    2e-09   
gb|KDP31690.1|  hypothetical protein JCGZ_15015                       66.2    3e-09   
ref|XP_006591219.1|  PREDICTED: agglutinin-like isoform X2            66.2    3e-09   
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  66.2    3e-09   
ref|XP_009413935.1|  PREDICTED: protein GOS9-like                     62.8    3e-09   
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        65.5    3e-09   
ref|XP_010236764.1|  PREDICTED: jacalin-related lectin 19-like        63.2    3e-09   
gb|EEE68468.1|  hypothetical protein OsJ_26865                        65.9    3e-09   
ref|XP_010030255.1|  PREDICTED: agglutinin-like                       65.5    3e-09   
ref|XP_003539332.1|  PREDICTED: agglutinin-like isoform X1            65.9    3e-09   
ref|XP_002281330.1|  PREDICTED: jacalin-related lectin 19-like        62.8    3e-09   
gb|ABA96465.1|  Protein GOS9, putative                                62.0    3e-09   
gb|KEH34301.1|  mannose-binding lectin superfamily protein            65.9    3e-09   
emb|CBI35989.3|  unnamed protein product                              63.2    4e-09   
ref|NP_001174671.1|  Os06g0226050                                     62.4    4e-09   
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         65.5    4e-09   
gb|EEE59214.1|  hypothetical protein OsJ_11170                        65.1    4e-09   
gb|EMT07336.1|  hypothetical protein F775_29709                       65.1    4e-09   
gb|EYU34206.1|  hypothetical protein MIMGU_mgv1a025615mg              64.7    4e-09   
ref|XP_010100192.1|  hypothetical protein L484_015337                 62.4    5e-09   
gb|EMT29229.1|  B3 domain-containing protein                          65.5    5e-09   
ref|NP_001104964.1|  beta-glucosidase aggregating factor precursor    64.3    5e-09   
gb|ABJ97445.1|  beta-glucosidase aggregating factor 1                 64.3    5e-09   
gb|KCW69706.1|  hypothetical protein EUGRSUZ_F03098                   63.2    5e-09   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         65.1    6e-09   
gb|ADE77248.1|  unknown                                               62.0    6e-09   
emb|CAE76030.1|  B1292H11.16                                          61.6    6e-09   
emb|CDX82115.1|  BnaC02g21750D                                        63.2    6e-09   
ref|XP_002458583.1|  hypothetical protein SORBIDRAFT_03g036175        63.2    6e-09   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                       64.7    7e-09   
ref|XP_009417382.1|  PREDICTED: mannose/glucose-specific lectin-like  65.1    7e-09   
ref|XP_004500273.1|  PREDICTED: agglutinin-like                       64.7    7e-09   
gb|EAY92859.1|  hypothetical protein OsI_14658                        62.8    7e-09   
ref|XP_010026053.1|  PREDICTED: jacalin-related lectin 3-like         63.2    8e-09   
ref|XP_008778289.1|  PREDICTED: mannose/glucose-specific lectin-like  63.5    8e-09   
ref|XP_004147859.1|  PREDICTED: myrosinase-binding protein-like A...  64.3    9e-09   
ref|XP_007024409.1|  Mannose-binding lectin superfamily protein       63.5    9e-09   
ref|XP_011048835.1|  PREDICTED: jacalin-related lectin 3-like iso...  64.3    9e-09   
gb|KFK41744.1|  hypothetical protein AALP_AA2G166700                  61.6    1e-08   
gb|KDP40814.1|  hypothetical protein JCGZ_24813                       62.0    1e-08   
ref|XP_003576339.1|  PREDICTED: jacalin-related lectin 3-like         63.2    1e-08   
gb|AAB72098.1|  32 kDa protein                                        63.2    1e-08   
gb|KDP26963.1|  hypothetical protein JCGZ_22259                       62.8    2e-08   
ref|XP_009420662.1|  PREDICTED: horcolin {ECO:0000312|EMBL:AAV395...  60.5    2e-08   
emb|CDY48032.1|  BnaA02g16250D                                        62.0    2e-08   
ref|XP_010320536.1|  PREDICTED: mannose/glucose-specific lectin-like  60.8    2e-08   
gb|EMS65594.1|  hypothetical protein TRIUR3_06346                     62.8    2e-08   
gb|AAY35064.1|  lectin KM+                                            60.1    2e-08   
ref|XP_010932865.1|  PREDICTED: jacalin-related lectin 3-like iso...  61.2    2e-08   
ref|XP_010030903.1|  PREDICTED: agglutinin alpha chain-like           59.3    2e-08   
ref|XP_002893063.1|  jacalin lectin family protein                    63.2    2e-08   
ref|XP_002893064.1|  hypothetical protein ARALYDRAFT_472198           63.5    2e-08   
ref|NP_001042994.2|  Os01g0355100                                     60.1    2e-08   
ref|NP_001117315.1|  Mannose-binding lectin superfamily protein       63.2    2e-08   
ref|XP_004977415.1|  PREDICTED: uncharacterized protein LOC101784...  62.4    2e-08   
ref|NP_001185041.1|  Mannose-binding lectin superfamily protein       63.2    2e-08   
ref|NP_849691.1|  Mannose-binding lectin superfamily protein          63.2    2e-08   
gb|AFW82809.1|  hypothetical protein ZEAMMB73_630227                  60.8    3e-08   
gb|ACR38528.1|  unknown                                               60.8    3e-08   
gb|EYU36743.1|  hypothetical protein MIMGU_mgv1a007927mg              62.4    3e-08   
ref|XP_008656997.1|  PREDICTED: cysteine-rich receptor-like prote...  62.8    3e-08   
pdb|4AKD|A  Chain A, High Resolution Structure Of Mannose Binding...  59.7    3e-08   
gb|AFW84361.1|  putative protein kinase superfamily protein           62.4    3e-08   
gb|EAY73967.1|  hypothetical protein OsI_01851                        59.7    3e-08   
ref|XP_009602425.1|  PREDICTED: mannose/glucose-specific lectin-like  59.3    3e-08   
gb|EMT04092.1|  hypothetical protein F775_28592                       62.0    3e-08   
ref|XP_006597181.1|  PREDICTED: agglutinin-like isoform X1            62.8    3e-08   
gb|ACF78865.1|  unknown                                               61.2    4e-08   
gb|AAY35063.1|  lectin KM+                                            59.7    4e-08   
gb|AAC49284.1|  unknown                                               62.0    4e-08   
gb|KCW56858.1|  hypothetical protein EUGRSUZ_I02520                   62.8    4e-08   
emb|CDM80828.1|  unnamed protein product                              59.3    4e-08   
ref|XP_010029904.1|  PREDICTED: jacalin-related lectin 4-like         62.8    4e-08   
sp|P82859.1|LECA_CASCR  RecName: Full=Agglutinin; AltName: Full=CCA   62.0    4e-08   
ref|XP_010654564.1|  PREDICTED: jacalin-related lectin 19-like        60.5    4e-08   
gb|EMT33622.1|  Cysteine proteinase RD21a                             62.8    4e-08   
gb|ABC70328.1|  agglutinin isoform                                    61.6    4e-08   
ref|XP_002439535.1|  hypothetical protein SORBIDRAFT_09g010668        59.3    4e-08   
gb|ABI24164.1|  beta-glucosidase aggregating factor                   61.6    4e-08   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  59.3    4e-08   
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  58.9    5e-08   
ref|XP_003578760.1|  PREDICTED: mannose/glucose-specific lectin-like  61.6    5e-08   
ref|XP_002461767.1|  hypothetical protein SORBIDRAFT_02g007750        61.6    5e-08   
gb|EMT07556.1|  hypothetical protein F775_11805                       58.9    5e-08   
ref|NP_001142347.1|  uncharacterized protein LOC100274518             61.6    5e-08   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  59.3    5e-08   
gb|ABS86033.1|  mannose-specific recombinant lectin                   58.9    5e-08   
gb|EMT07446.1|  hypothetical protein F775_10439                       61.2    5e-08   
emb|CDM80401.1|  unnamed protein product                              60.8    6e-08   
ref|XP_004970153.1|  PREDICTED: myrosinase-binding protein-like A...  62.0    6e-08   
ref|XP_006383724.1|  hypothetical protein POPTR_0005s25390g           62.0    6e-08   
emb|CBI35988.3|  unnamed protein product                              60.1    6e-08   
ref|XP_009391798.1|  PREDICTED: agglutinin-like                       59.7    6e-08   
ref|XP_002461766.1|  hypothetical protein SORBIDRAFT_02g007740        61.2    6e-08   
pdb|1J4T|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  58.9    7e-08   
ref|XP_010231090.1|  PREDICTED: jacalin-related lectin 19-like is...  60.1    7e-08   
pdb|1VBP|A  Chain A, Crystal Structure Of Artocarpin-Mannopentose...  58.9    7e-08   
pdb|1VBO|A  Chain A, Crystal Structure Of Artocarpin-Mannotriose ...  58.9    7e-08   
pdb|1J4S|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  58.9    7e-08   
ref|XP_010231089.1|  PREDICTED: jacalin-related lectin 19-like is...  60.1    7e-08   
ref|XP_010231088.1|  PREDICTED: jacalin-related lectin 19-like is...  60.5    8e-08   
ref|XP_008671662.1|  PREDICTED: horcolin-like                         59.3    8e-08   
tpg|DAA39774.1|  TPA: hypothetical protein ZEAMMB73_034611            58.9    8e-08   
dbj|BAE95375.1|  lectin                                               60.8    8e-08   
ref|XP_010110012.1|  hypothetical protein L484_021901                 61.6    8e-08   
ref|XP_008377187.1|  PREDICTED: uncharacterized protein LOC103440289  61.6    8e-08   
gb|AHZ86978.1|  extracellular jacalin-like lectin                     58.5    8e-08   
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  60.5    9e-08   
gb|AAB53810.1|  salT gene product                                     58.5    9e-08   
emb|CDM86052.1|  unnamed protein product                              60.8    9e-08   
gb|KCW67999.1|  hypothetical protein EUGRSUZ_F01690                   61.6    9e-08   
gb|KCW67998.1|  hypothetical protein EUGRSUZ_F01690                   61.6    1e-07   
gb|KEH39537.1|  mannose-binding lectin superfamily protein            58.9    1e-07   
ref|XP_010064569.1|  PREDICTED: jacalin-related lectin 4-like         61.2    1e-07   
gb|EMT09327.1|  hypothetical protein F775_29083                       60.8    1e-07   
ref|XP_010029921.1|  PREDICTED: jacalin-related lectin 4-like iso...  61.2    1e-07   
ref|XP_003561042.1|  PREDICTED: jacalin-related lectin 3-like         60.5    1e-07   
gb|EAY82243.1|  hypothetical protein OsI_37448                        60.5    1e-07   
emb|CDM86063.1|  unnamed protein product                              61.2    1e-07   
ref|NP_001042975.1|  Os01g0348800                                     57.4    1e-07   
gb|KEH39536.1|  mannose-binding lectin superfamily protein            58.9    1e-07   
ref|XP_010029918.1|  PREDICTED: jacalin-related lectin 4-like iso...  61.2    1e-07   
gb|EMS51477.1|  Mannose/glucose-specific lectin                       60.5    1e-07   
ref|XP_009420661.1|  PREDICTED: salt stress-induced protein-like      58.2    1e-07   
ref|XP_010029920.1|  PREDICTED: myrosinase-binding protein 2-like...  61.2    1e-07   
sp|P18670.2|LECA_ARTIN  RecName: Full=Agglutinin alpha chain; Alt...  57.8    1e-07   
ref|XP_006383725.1|  hypothetical protein POPTR_0005s25400g           60.8    1e-07   
gb|EMT31922.1|  hypothetical protein F775_02779                       58.5    1e-07   
pdb|1UGW|A  Chain A, Crystal Structure Of Jacalin- Gal Complex        57.8    1e-07   
gb|KEH39538.1|  mannose-binding lectin superfamily protein            58.9    1e-07   
ref|XP_006342218.1|  PREDICTED: agglutinin-like                       60.5    1e-07   
ref|XP_010029919.1|  PREDICTED: jacalin-related lectin 4-like iso...  60.8    1e-07   
gb|EMS47225.1|  hypothetical protein TRIUR3_25909                     60.5    2e-07   
ref|XP_009614721.1|  PREDICTED: jacalin-related lectin 19             58.9    2e-07   
ref|XP_010501974.1|  PREDICTED: myrosinase-binding protein 1-like     60.1    2e-07   
gb|ACN33395.1|  unknown                                               60.1    2e-07   
gb|EEE54522.1|  hypothetical protein OsJ_01681                        56.6    2e-07   
gb|AFW74848.1|  hypothetical protein ZEAMMB73_609032                  57.4    2e-07   
gb|AAB23126.1|  jacalin minor alpha'-subunit=65 kda lectin minor ...  57.4    2e-07   
pdb|1X1V|A  Chain A, Structure Of Banana Lectin- Methyl-Alpha-Man...  57.4    2e-07   
gb|EMT28373.1|  hypothetical protein F775_25915                       60.1    2e-07   
ref|NP_001042976.1|  Os01g0348900                                     57.4    2e-07   
dbj|BAD52599.1|  putative salT                                        59.3    2e-07   
gb|EMT19890.1|  hypothetical protein F775_11960                       59.7    2e-07   
pdb|4AK4|A  Chain A, High Resolution Structure Of Galactose Bindi...  57.0    2e-07   
ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        57.4    2e-07   
gb|AAA32679.1|  jacalin                                               58.5    2e-07   
emb|CDM85887.1|  unnamed protein product                              59.7    3e-07   
pdb|4AKB|A  Chain A, Structure Of Galactose Binding Lectin From C...  57.0    3e-07   
ref|XP_010099935.1|  hypothetical protein L484_020123                 58.2    3e-07   
dbj|BAA32786.3|  VER2                                                 59.3    3e-07   
gb|KCW75349.1|  hypothetical protein EUGRSUZ_E04097                   59.7    3e-07   
gb|AAY41607.1|  Crs-1                                                 59.3    3e-07   
ref|XP_006473897.1|  PREDICTED: uncharacterized protein LOC102623328  59.7    3e-07   
ref|XP_003567168.1|  PREDICTED: jacalin-related lectin 3-like         59.7    3e-07   
ref|XP_008780478.1|  PREDICTED: mannose/glucose-specific lectin-like  57.0    3e-07   
gb|AAA32678.1|  jacalin                                               58.2    4e-07   
gb|AAA32680.1|  jacalin                                               57.8    4e-07   
emb|CDM83580.1|  unnamed protein product                              58.9    4e-07   
ref|XP_006597184.1|  PREDICTED: agglutinin-like isoform X4            57.4    4e-07   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score =   183 bits (465),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 119/156 (76%), Gaps = 5/156 (3%)
 Frame = +3

Query  27   MSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTL  206
            M++  D   GP G+NGG FWSFRP NKINQIVI++     NNPI +TFSATK DGSKDT+
Sbjct  1    MTVPIDTISGPWGNNGGNFWSFRPINKINQIVITY--SAGNNPIALTFSATKADGSKDTI  58

Query  207  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
            T+GG G ++ +T  DT++I G DEY+T ISGTFG +   +NVLRSIKF TN + +G YGP
Sbjct  59   TVGGAGPDS-ITGTDTVDI-GADEYVTGISGTFGIYLD-NNVLRSIKFITNLKAYGPYGP  115

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            NVGTPF+ +   GN+IVGF GRSGYY+DAIGTYN P
Sbjct  116  NVGTPFSSENVVGNEIVGFLGRSGYYVDAIGTYNTP  151



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score =   179 bits (453),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 117/154 (76%), Gaps = 4/154 (3%)
 Frame = +3

Query  27   MSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTL  206
            M++  D   GP G+NGG FWSFRP NKINQIVIS+GG G NNPI +TFS+TK DGSKDT+
Sbjct  1    MAVPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGG-GGNNPIALTFSSTKADGSKDTI  59

Query  207  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
            T+GGGG ++ +T  + +NI G DEYLT ISGTFG +   +NVLRSI FTTN +  G YG 
Sbjct  60   TVGGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLD-NNVLRSITFTTNLKAHGPYGQ  116

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYN  488
             VGTPF+     GN+IVGF GRSGYY+DAIGTYN
Sbjct  117  KVGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  150



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            +  D   GP G+NGG FWSFRP NKINQIVIS+GG G NNPI +TFS+TK DGSKDT+T+
Sbjct  2    VPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGG-GGNNPIALTFSSTKADGSKDTITV  60

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GGGG ++ +T  + +NI G DEYLT ISGTFG +   +NVLRSI FTTN +  G YG  V
Sbjct  61   GGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLD-NNVLRSITFTTNLKAHGPYGQKV  117

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYN  488
            GTPF+     GN+IVGF GRSGYY+DAIGTYN
Sbjct  118  GTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  149



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 11/155 (7%)
 Frame = +3

Query  27   MSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNN--NPIRITFSATKNDGSKD  200
            ++  +D   GP+G NGG FWSFRP   +N+IV+SF G  +   N I ITFS+   D    
Sbjct  5    LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTD----  60

Query  201  TLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTY  380
             +T+GG G E  +T+ +T+NIDG+   + EISG    +    NV+RSIKFTTN +E+G Y
Sbjct  61   IITVGGVGPEP-LTYTETVNIDGD---IIEISGMIANYKGY-NVIRSIKFTTNKKEYGPY  115

Query  381  GPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            G N GTPFN +  +GNKIVGFFG SG+Y+DAIG Y
Sbjct  116  GANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  150



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 11/155 (7%)
 Frame = +3

Query  27   MSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNN--NPIRITFSATKNDGSKD  200
            ++  +D   GP+G NGG FWSFRP   +N+IV+SF G  +   N I ITFS+   D    
Sbjct  11   LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTD----  66

Query  201  TLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTY  380
             +T+GG G E  +T+ +T+NIDG+   + EISG    +    NV+RSIKFTTN +E+G Y
Sbjct  67   IITVGGVGPEP-LTYTETVNIDGD---IIEISGMIANYKGY-NVIRSIKFTTNKKEYGPY  121

Query  381  GPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            G N GTPFN +  +GNKIVGFFG SG+Y+DAIG Y
Sbjct  122  GANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  156



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 60/148 (41%), Positives = 80/148 (54%), Gaps = 10/148 (7%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G  W     + I Q++I  G     + I+I +    +    D    G GGT+T
Sbjct  857  GPFGGPAGNNWDDGVYSTIRQLIICHGA--GIDSIKIQYDVKGSSIWSDRHG-GNGGTKT  913

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNF  410
                 DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG   GT F+F
Sbjct  914  -----DTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSF  968

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                G KIVGF GRSG Y+DAIG Y  P
Sbjct  969  PTTEG-KIVGFHGRSGLYLDAIGVYLKP  995



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +3

Query  168   FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
             F+ + ++G K T    GG    NV     I + G  E+L E+SGTFG F ++ N++ S+ 
Sbjct  981   FTYSDHNGKKHTAGPWGGYGGNNV---HMIQL-GPSEFLVEVSGTFGRFRAALNIITSLT  1036

Query  348   FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F TNA+ +G YG   GTPF+   Q+   IVGFFGR+G+Y+DAIG Y  P
Sbjct  1037  FVTNAQSYGPYGQREGTPFHIPVQSSGCIVGFFGRAGWYVDAIGIYVKP  1085


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRS  341
             + FS + +DG   T    GG    +  +N TI   G  E LT +SGTFG++ +S +V+ S
Sbjct  1135  LAFSYSDHDGQHHTAGPWGG----DGGNNQTIQF-GPSELLTTVSGTFGSYNTSYDVITS  1189

Query  342   IKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             I   TN   +G +G   G  FNF  Q    IVGFFG +  YIDAIG Y  P
Sbjct  1190  ITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGHAELYIDAIGVYVNP  1240


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 60/112 (54%), Gaps = 6/112 (5%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRS  341
             +TFS   +DG +  L   GGG E N      IN+ G  E++T++ GTFG +     V+ S
Sbjct  1289  LTFSYRSHDGQQYILGPWGGGGENNYK----INL-GPSEFITKVHGTFGPYGEFPIVITS  1343

Query  342   IKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             + F  NA  ++G +G   GTPF+        IVGFFG  G  ++AIG Y  P
Sbjct  1344  LTFINNAGHQYGPFGQGGGTPFHAPISGNGSIVGFFGHQGACLEAIGFYFRP  1395



>gb|ABA93998.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1384

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +3

Query  168   FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
             F+ + ++G K T    GG    NV     I + G  E+L E+SGTFG F ++ +++ S+ 
Sbjct  1009  FTYSDHNGKKHTAGPWGGYGGNNV---HMIQL-GPSEFLVEVSGTFGRFRAALDIITSLT  1064

Query  348   FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F TNA+ +G YG   GTPF+   Q+   IVGFFGR+G+Y+DAIG Y  P
Sbjct  1065  FVTNAQSYGPYGQREGTPFHISVQSRGCIVGFFGRAGWYVDAIGIYVKP  1113


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 51/155 (33%), Positives = 68/155 (44%), Gaps = 9/155 (6%)
 Frame = +3

Query  48    AYGPLGHNGGGFWSFRPKNKINQIVISFGGRGN------NNPIRITFSATKNDGSKDTLT  209
             +YGP G   G    F    +    ++ F GR           ++      K+        
Sbjct  1071  SYGPYGQREGT--PFHISVQSRGCIVGFFGRAGWYVDAIGIYVKPKLQKVKDKAKFGHAK  1128

Query  210   IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
             IG  G      H+  I   G  E LT +SGTFG++ +S +V+ SI   TN   +G +G  
Sbjct  1129  IGPCGGNGGKAHDIMIQF-GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKE  1187

Query  390   VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              G  FNF  Q    IVGFFG +  YIDAIG Y  P
Sbjct  1188  KGISFNFPIQGNGSIVGFFGHAELYIDAIGVYVNP  1222


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 6/83 (7%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRS  341
             +TFS   +DG +  L   GGG E N      IN+ G  E++T++ GTFG F     V+ S
Sbjct  1272  LTFSYRSHDGLQYILGPWGGGGENNY----KINL-GPSEFITKVHGTFGPFGEFPIVITS  1326

Query  342   IKFTTNA-REFGTYGPNVGTPFN  407
             + F  NA  ++G +G   GTPF+
Sbjct  1327  LTFINNAGHQYGPFGQGGGTPFH  1349



>gb|EEE52195.1| hypothetical protein OsJ_34074 [Oryza sativa Japonica Group]
Length=1311

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +3

Query  168   FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
             F+ + ++G K T    GG    NV     I + G  E+L E+SGTFG F ++ +++ S+ 
Sbjct  941   FTYSDHNGKKHTAGPWGGYGGNNV---HMIQL-GPSEFLVEVSGTFGRFRAALDIITSLT  996

Query  348   FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F TNA+ +G YG   GTPF+   Q+   IVGFFGR+G+Y+DAIG Y  P
Sbjct  997   FVTNAQSYGPYGQREGTPFHISVQSRGCIVGFFGRAGWYVDAIGIYVKP  1045


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 51/155 (33%), Positives = 68/155 (44%), Gaps = 9/155 (6%)
 Frame = +3

Query  48    AYGPLGHNGGGFWSFRPKNKINQIVISFGGRGN------NNPIRITFSATKNDGSKDTLT  209
             +YGP G   G    F    +    ++ F GR           ++      K+        
Sbjct  1003  SYGPYGQREGT--PFHISVQSRGCIVGFFGRAGWYVDAIGIYVKPKLQKVKDKAKFGHAK  1060

Query  210   IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
             IG  G      H+  I   G  E LT +SGTFG++ +S +V+ SI   TN   +G +G  
Sbjct  1061  IGPCGGNGGKAHDIMIQF-GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKE  1119

Query  390   VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              G  FNF  Q    IVGFFG +  YIDAIG Y  P
Sbjct  1120  KGISFNFPIQGNGSIVGFFGHAELYIDAIGVYVNP  1154


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 6/112 (5%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRS  341
             +TFS   +DG +  L   GGG E N      IN+ G  E++T++ GTFG F     V+ S
Sbjct  1204  LTFSYRSHDGLQYILGPWGGGGENNYK----INL-GPSEFITKVHGTFGPFGEFPIVITS  1258

Query  342   IKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             + F  NA  ++G +G   GTPF+        IVGFFG  G  ++AIG Y  P
Sbjct  1259  LTFINNAGHQYGPFGQGGGTPFHAPISGNGSIVGFFGHQGACLEAIGFYFRP  1310



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG G   
Sbjct  174  GPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSIMFR---TITEQGTTTDSQKFGGNGGRI  230

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
            N      +      EYLT I GTFG +     V++S+ F TNA  +G +G N G TPF+ 
Sbjct  231  N----KVVIAATPSEYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSL  285

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GRSG+Y+DAIG Y
Sbjct  286  VMKEGVAIVGFHGRSGFYLDAIGVY  310


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            G GG    V   +T       E LT I GT G F +   V++S+ FTTN + +G +G   
Sbjct  19   GNGGQINKVVFEET-----PLERLTGIKGTLGRF-NGHLVVKSLCFTTNVKNYGPFGSEG  72

Query  393  G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            G TPF+   + G  I+GF GR G Y+DAIG Y
Sbjct  73   GGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  104



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG G   
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSIMFR---TITEQGTTTDSQKFGGNGGRI  282

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
            N      +      EYLT I GTFG +     V++S+ F TNA  +G +G N G TPF+ 
Sbjct  283  N----KVVIAATPSEYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSL  337

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GRSG+Y+DAIG Y
Sbjct  338  VMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 14/160 (9%)
 Frame = +3

Query  18   HSTMSISTDVAYGPLGHNGGGF-WSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGS  194
            H++  ++  +  GP G   GG  W+++ KN I +I+I+ G   N+    I F      G+
Sbjct  7    HASYDLADSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAINS----IMFRTITEQGT  62

Query  195  K-DTLTIGGGGTETN-VTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNARE  368
              ++   GG G + N V   +T       E LT I GT G F +   V++S+ FTTN + 
Sbjct  63   TINSQKFGGNGGQINKVVFEET-----PLERLTGIKGTLGRF-NGHLVVKSLCFTTNVKN  116

Query  369  FGTYGPNVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G +G   G TPF+   + G  I+GF GR G Y+DAIG Y
Sbjct  117  YGPFGSEGGGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG G   
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSIMFR---TITEQGTTTDSQKFGGNGGRI  282

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
            N      +      EYLT I GTFG +     V++S+ F TNA  +G +G N G TPF+ 
Sbjct  283  N----KVVIAATPSEYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSL  337

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GRSG+Y+DAIG Y
Sbjct  338  VMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 14/160 (9%)
 Frame = +3

Query  18   HSTMSISTDVAYGPLGHNGGGF-WSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGS  194
            H++  ++  +  GP G   GG  W+++ KN I +I+I+ G   N+    I F      G+
Sbjct  7    HASYDLADSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAINS----IMFRTITEQGT  62

Query  195  K-DTLTIGGGGTETN-VTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNARE  368
              ++   GG G + N V   +T       E LT I GT G F +   V++S+ FTTN + 
Sbjct  63   TINSQKFGGNGGQINKVVFEET-----PLERLTGIKGTLGRF-NGHLVVKSLCFTTNVKN  116

Query  369  FGTYGPNVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G +G   G TPF+   + G  I+GF GR G Y+DAIG Y
Sbjct  117  YGPFGSEGGGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_008444758.1| PREDICTED: LOW QUALITY PROTEIN: myrosinase-binding protein-like 
At3g16470 [Cucumis melo]
Length=598

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 81/151 (54%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G   G  W     + I Q+VI  G     + I+I +    +    D    G GG
Sbjct  12   IMAGPFGGPAGNNWDDGVYSTIRQLVICHGA--GIDSIKIQYDVKGSSIWSDRHG-GNGG  68

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
            T+T     DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG   GT 
Sbjct  69   TKT-----DTVKLDFPDEYLTMIRGYYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTV  123

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+F    G KIVGF GRSG Y+DAIG Y  P
Sbjct  124  FSFPTTEG-KIVGFHGRSGLYLDAIGVYLKP  153


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D +  D   E LT ++G +G       NV++S+ F T   ++G +G   GTPF+   + G
Sbjct  304  DKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLSFHTTKAKYGPFGEAQGTPFSTNVKEG  363

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             KIVGF GR G ++DA+G +
Sbjct  364  -KIVGFHGRKGLFLDALGVH  382


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 6/92 (7%)
 Frame = +3

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPN  389
            GG + TNV     + +D   E LT ISG +G     +    ++S+ F T+  +FG +G  
Sbjct  492  GGNSGTNV---HRVKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEE  548

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            VG+ F      G K+VGF GRS  Y+DAIG +
Sbjct  549  VGSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  579



>ref|XP_004152769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Cucumis sativus]
Length=1463

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 81/151 (54%), Gaps = 10/151 (7%)
 Frame = +3

Query  45    VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
             +  GP G   G  W     + I Q++I  G     + I+I +    +    D    G GG
Sbjct  881   IMAGPFGGPAGNNWDDGVYSTIRQLIICHGA--GIDSIKIQYDVKGSSIWSDRHG-GNGG  937

Query  225   TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             T+T     DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG   GT 
Sbjct  938   TKT-----DTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTI  992

Query  402   FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F+F    G KIVGF GRSG Y+DAIG Y  P
Sbjct  993   FSFPTTEG-KIVGFHGRSGLYLDAIGVYLKP  1022


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = +3

Query  249   DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
             D +  D   E LT ++G +G       NV++S+ F T   ++G +G   GTPF+   + G
Sbjct  1169  DKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG  1228

Query  426   NKIVGFFGRSGYYIDAIGTY  485
              KIVGF GR G ++DA+G +
Sbjct  1229  -KIVGFHGRKGLFLDALGVH  1247


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (51%), Gaps = 5/99 (5%)
 Frame = +3

Query  195   KDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNARE  368
             +   ++  GG      H   + +D   E LT ISG +G     +    ++S+ F T+  +
Sbjct  1349  QSVWSVRHGGNSGTTIHR--VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGK  1406

Query  369   FGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             FG +G  VG+ F      G K+VGF GRS  Y+DAIG +
Sbjct  1407  FGPFGEEVGSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  1444



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 85/155 (55%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI+ G    +N   I+F  T +    D+ T 
Sbjct  26   IEGTISIGPWGGQGGNPWSYMTNQGINQIVINVG----SNIKSISFRDTTD---LDSATF  78

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  79   GGN-NPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGS  136

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GTPF+    N N +VGF GR+G+Y+DAIG +  P+
Sbjct  137  GTPFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPE  170



>gb|KGN62634.1| hypothetical protein Csa_2G362470 [Cucumis sativus]
Length=598

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 81/151 (54%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G   G  W     + I Q++I  G     + I+I +    +    D    G GG
Sbjct  12   IMAGPFGGPAGNNWDDGVYSTIRQLIICHGA--GIDSIKIQYDVKGSSIWSDRHG-GNGG  68

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
            T+T     DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG   GT 
Sbjct  69   TKT-----DTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTI  123

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+F    G KIVGF GRSG Y+DAIG Y  P
Sbjct  124  FSFPTTEG-KIVGFHGRSGLYLDAIGVYLKP  153


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D +  D   E LT ++G +G       NV++S+ F T   ++G +G   GTPF+   + G
Sbjct  304  DKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG  363

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             KIVGF GR G ++DA+G +
Sbjct  364  -KIVGFHGRKGLFLDALGVH  382


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +3

Query  192  SKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAR  365
             +   ++  GG      H   + +D   E LT ISG +G     +    ++S+ F T+  
Sbjct  483  KQSVWSVRHGGNSGTTIHR--VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRG  540

Query  366  EFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +FG +G  VG+ F      G K+VGF GRS  Y+DAIG +
Sbjct  541  KFGPFGEEVGSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  579



>gb|EMT18893.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=809

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 52/149 (35%), Positives = 80/149 (54%), Gaps = 11/149 (7%)
 Frame = +3

Query  54   GPLGHNGGGFWSFR--PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            GP G  GG     +  P+ ++  + I  G    +    + FS   +DG + T    G   
Sbjct  669  GPCGEGGGRACDIKVVPQ-RLESVTIYSGSLVES----LVFSYRDHDGKRHTAGPWGSHP  723

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
              N   ND I+++   E L E+SGT G++ +  NV+ S+   T+AR +G +G   G PF+
Sbjct  724  GEN---NDVIHLE-PSEILKEVSGTVGSYGALTNVITSLTLVTSARTYGPFGKGDGIPFS  779

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +A + + I+GFFGRSG+Y+DAIG Y  P
Sbjct  780  MEAASNSSIIGFFGRSGWYLDAIGVYTRP  808



>sp|Q5U9T2.1|LECH_HORVU RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare]
 sp|P82953.2|LECH_HORVD RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare subsp. vulgare]
 gb|AAK54458.1| horcolin [Hordeum vulgare subsp. vulgare]
 gb|AAV39531.1| horcolin [Hordeum vulgare]
 dbj|BAJ87539.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 81/155 (52%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            +S  V  GP G NGG     +PK  I  + ++       + I  T+  T N      +  
Sbjct  1    MSKPVKIGPWGGNGGSERDVQPK-PIRMVSMTVSSGAIVDAIAFTYVGTDNVQHSSGIKW  59

Query  213  GG-GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
            GG GGTE      DTIN+D  + Y+TEISGT G F + D+++ S+K  T+     TYG  
Sbjct  60   GGTGGTE------DTINLDATN-YVTEISGTVGKFGT-DDIVTSLKIITSKGVTRTYGSG  111

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             G PF     +G KI GFFGR+G ++DAIG Y  P
Sbjct  112  TGIPFRVPVLDGGKIAGFFGRAGAFLDAIGFYITP  146



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 10/144 (7%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETN  236
            P G  GG  W ++ K+ I +I+I+ G    +   R   + T+   + D+   GG G    
Sbjct  44   PWGGTGGSEWYYKLKSPIKEILITHGDCIESIMFR---TVTEQGTTIDSPKFGGDGG---  97

Query  237  VTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQ  413
                D + I+    EYLT I GTFG    S  V++S+ F TNAR +G +G  +GTPF+  
Sbjct  98   --RRDKVVIEAASLEYLTGIKGTFG-HCGSYLVIKSLCFETNARNYGPFGSEIGTPFSLV  154

Query  414  AQNGNKIVGFFGRSGYYIDAIGTY  485
             + G  IVGF GR G Y+DAIG Y
Sbjct  155  MKEGGAIVGFHGRCGAYLDAIGVY  178


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 11/140 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTETNV  239
            G+ GG  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG GG    V
Sbjct  233  GNTGGSEWNYKLKSHIKEILIAHGDVIDSIMFR---TITEQGTTIDSPKFGGNGGRREKV  289

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  416
               +        EYL  I GTF  + S   V+ S+ F TNA+ +G +G   G TPF+F  
Sbjct  290  VIKEP-----PLEYLIGIKGTFRRYGS-HFVINSLCFITNAKNYGPFGSEAGGTPFSFVM  343

Query  417  QNGNKIVGFFGRSGYYIDAI  476
            + G  I GF GR G Y+DAI
Sbjct  344  KEGGAIEGFHGRCGAYLDAI  363



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 78/146 (53%), Gaps = 14/146 (10%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIR-ITFSATKNDGSK-DTLTIGG-GGT  227
            P G  GG  W ++ K+ I +I+I+ G     + I+ I F      G+  D+   GG GG 
Sbjct  39   PWGGAGGSEWYYKLKSPIKEILIAHG-----DCIKSIMFKTVTEQGTTIDSPKFGGDGGR  93

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
               V   +T       EYLT I GTFG +    +V++S+ F TNA+ +G +G   GTPF+
Sbjct  94   RDKVVMEET-----PLEYLTCIKGTFG-YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFS  147

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GR G Y+DAIG Y
Sbjct  148  LVMKEGGAIVGFHGRCGAYLDAIGVY  173


 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 54/146 (37%), Positives = 78/146 (53%), Gaps = 11/146 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTE  230
            GP G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G  
Sbjct  426  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGR  481

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
             N    +   +    EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+
Sbjct  482  INKVVIEATPL----EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFS  536

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF G  G Y+DAIG Y
Sbjct  537  LVMKEGVAIVGFHGLCGAYLDAIGIY  562


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTET  233
            P G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G   
Sbjct  221  PWGGTGGSEWNYKLKSPIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGRI  276

Query  234  N-VTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
            N V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   G TPF+
Sbjct  277  NKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  330

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GR G Y+DAIG Y
Sbjct  331  LVMKEGVAIVGFHGRCGAYLDAIGVY  356



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 62/110 (56%), Gaps = 4/110 (4%)
 Frame = +3

Query  168   FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
             F  +  +G K      GG   +NV     I ++   E L E+SGTFG FA   N++ S+ 
Sbjct  1015  FEYSDRNGQKHVAGPWGGYGGSNV---HMIQLE-SSEVLVEVSGTFGRFAGFQNIITSLT  1070

Query  348   FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             F TN + +G +G   GTPF+   Q G +IVGFFGR+G+  DAIG Y  PD
Sbjct  1071  FVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRAGWCFDAIGIYVNPD  1120


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 11/146 (8%)
 Frame = +3

Query  54    GPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTE  230
             GP G  GG  +  +   +++  I IS     N+    + FS   +D  +  +   G G E
Sbjct  1279  GPFGRRGGNPFDIKVTPHQLESITISSNIVINS----LAFSYISHDKQQHIVGPWGSGGE  1334

Query  231   TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNVGTPFN  407
             +N T    I + G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G   GTPF+
Sbjct  1335  SNYT----IQL-GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGGGTPFH  1389

Query  408   FQAQNGNKIVGFFGRSGYYIDAIGTY  485
                     IVGFFGR G  I+A+G Y
Sbjct  1390  APMSGNGSIVGFFGREGLCIEAVGFY  1415


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +3

Query  282   LTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             +T + GT G++ +  +V+ SI   TNA  +G +G   G PF+F  Q    IVGFFG +  
Sbjct  1192  ITRVYGTSGSYNTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHANL  1251

Query  462   YIDAIGTYNAP  494
             Y+DAIG Y  P
Sbjct  1252  YVDAIGVYVTP  1262



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 80/166 (48%), Gaps = 16/166 (10%)
 Frame = +3

Query  12   NYHSTMSISTDVA-YGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKND  188
             +   M +S  +   GP G  GG  W     + I  I IS+  R           +   +
Sbjct  2    QHQRKMVVSKKLMKVGPWGGTGGHPWDDGGHSGIRSITISYDHR--------CMESISVE  53

Query  189  GSKDTLTIGG---GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTT  356
              +D L + G   GG     +H   I +   DEYLT +SG +   A   + V+RS+ F T
Sbjct  54   YDRDGLAVPGERHGGAAA--SHTTQIKLSCPDEYLTTVSGHYAPIAHGGSPVIRSLAFRT  111

Query  357  NAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            N R +G +G   GTPF+F    G  IVGF+GRSG+ +DA+G Y AP
Sbjct  112  NLRAYGPFGAAEGTPFSFPV-VGGVIVGFYGRSGWQLDAVGLYVAP  156



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 79/150 (53%), Gaps = 13/150 (9%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGG  221
            +   P G  GG  W++  K+ I  I+I+ G   ++    I F +    G+  D+   GG 
Sbjct  32   ILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVIDS----IMFKSITEQGTTIDSPKFGGD  87

Query  222  GTETNVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-  395
            G        D + I+    EYLT I GTFG F    +V++S+ F TNA+ +G +G   G 
Sbjct  88   GGR-----RDKVVIEATPLEYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGG  141

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            TPF+   + G  IVGF GRSG Y+DAIG Y
Sbjct  142  TPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 79/150 (53%), Gaps = 13/150 (9%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGG  221
            +   P G  GG  W++  K+ I  I+I+ G   ++    I F +    G+  D+   GG 
Sbjct  32   ILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVIDS----IMFKSITEQGTTIDSPKFGGD  87

Query  222  GTETNVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-  395
            G        D + I+    EYLT I GTFG F    +V++S+ F TNA+ +G +G   G 
Sbjct  88   GGR-----RDKVVIEATPLEYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGG  141

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            TPF+   + G  IVGF GRSG Y+DAIG Y
Sbjct  142  TPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 79/150 (53%), Gaps = 13/150 (9%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGG  221
            +   P G  GG  W++  K+ I  I+I+ G   ++    I F +    G+  D+   GG 
Sbjct  32   ILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVIDS----IMFKSITEQGTTIDSPKFGGD  87

Query  222  GTETNVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-  395
            G        D + I+    EYLT I GTFG F    +V++S+ F TNA+ +G +G   G 
Sbjct  88   GGR-----RDKVVIEATPLEYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGG  141

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            TPF+   + G  IVGF GRSG Y+DAIG Y
Sbjct  142  TPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 54/146 (37%), Positives = 78/146 (53%), Gaps = 11/146 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTE  230
            GP G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G  
Sbjct  222  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGR  277

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
             N    +   +    EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+
Sbjct  278  INKVVIEATPL----EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFS  332

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF G  G Y+DAIG Y
Sbjct  333  LVMKEGVAIVGFHGLCGAYLDAIGIY  358


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTET  233
            P G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G   
Sbjct  17   PWGGTGGSEWNYKLKSPIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGRI  72

Query  234  N-VTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
            N V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   G TPF+
Sbjct  73   NKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  126

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GR G Y+DAIG Y
Sbjct  127  LVMKEGVAIVGFHGRCGAYLDAIGVY  152



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 54/146 (37%), Positives = 78/146 (53%), Gaps = 11/146 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTE  230
            GP G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G  
Sbjct  356  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGR  411

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
             N    +   +    EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+
Sbjct  412  INKVVIEATPL----EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFS  466

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF G  G Y+DAIG Y
Sbjct  467  LVMKEGVAIVGFHGLCGAYLDAIGIY  492


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTET  233
            P G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G   
Sbjct  151  PWGGTGGSEWNYKLKSPIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGRI  206

Query  234  N-VTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
            N V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   G TPF+
Sbjct  207  NKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  260

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GR G Y+DAIG Y
Sbjct  261  LVMKEGVAIVGFHGRCGAYLDAIGVY  286


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 7/106 (7%)
 Frame = +3

Query  171  SATKNDGSKDTLTIGG-GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
            + T+   + D+   GG GG    V   +T       EYLT I GTFG +    +V++S+ 
Sbjct  4    TVTEQGTTIDSPKFGGDGGRRDKVVMEET-----PLEYLTCIKGTFG-YCGGYSVVKSLC  57

Query  348  FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F TNA+ +G +G   GTPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  58   FITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRCGAYLDAIGVY  103



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 62/110 (56%), Gaps = 4/110 (4%)
 Frame = +3

Query  168   FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
             F  +  +G K      GG   +NV     I ++   E L E+SGTFG FA   N++ S+ 
Sbjct  1015  FEYSDRNGQKHVAGPWGGYGGSNV---HMIQLE-SSEVLVEVSGTFGRFAGFQNIITSLT  1070

Query  348   FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             F TN + +G +G   GTPF+   Q G +IVGFFGR+G+  DAIG Y  PD
Sbjct  1071  FVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRAGWCFDAIGIYVNPD  1120


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 11/146 (8%)
 Frame = +3

Query  54    GPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTE  230
             GP G  GG  +  +   +++  I IS     N+    + FS   +D  +  +   G G E
Sbjct  1291  GPFGRRGGNPFDIKVTPHQLESITISSNIVINS----LAFSYISHDKQQHIVGPWGSGGE  1346

Query  231   TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNVGTPFN  407
             +N T    I + G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G   GTPF+
Sbjct  1347  SNYT----IQL-GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGGGTPFH  1401

Query  408   FQAQNGNKIVGFFGRSGYYIDAIGTY  485
                     IVGFFGR G  I+A+G Y
Sbjct  1402  APMSGNGSIVGFFGREGLCIEAVGFY  1427


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 9/113 (8%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTIGG--GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL  335
             +TFS   ++G      + G  GG+      N TI   G  E++T + GT G++ +  +V+
Sbjct  1169  LTFSYNDHNGDHHLAGLWGSHGGS------NQTIQF-GPSEFITRVYGTIGSYNTPSDVV  1221

Query  336   RSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              SI   TNA  +G +G   G PF+F  Q    IVGFFG +  Y+DAIG Y  P
Sbjct  1222  TSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHANLYVDAIGVYVTP  1274



>ref|XP_006372325.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
 gb|ERP50122.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
Length=446

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 83/155 (54%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI  G    +N   I+F  T      D+ T 
Sbjct  299  IEGTISIGPWGGRGGSPWSYMTNRGINQIVIHVG----SNIKSISFRDTTG---LDSATF  351

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  352  GGE-NPNDIGERKTVLINWPSEHLISISGTYGKF-STLLTITSLSFTTNRATYGPFGTGS  409

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GTPF+    N N +VGF GR+G+Y+DAIG +  P+
Sbjct  410  GTPFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPE  443


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 74/152 (49%), Gaps = 9/152 (6%)
 Frame = +3

Query  42   DVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGG  221
            DV  GP G  GG  W +R  + I  IV+    R   N   I+F  T+   S    T GG 
Sbjct  7    DVKLGPWGGLGGDRWCYRASDGITGIVL----RVEGNIKSISFKDTRGLVSG---TFGGT  59

Query  222  GTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            G + N       I I    EYL  ISGT+G +     V+ S+ FTTN    G +G   G 
Sbjct  60   GNDPNDRGEEKKIAIQWPTEYLKSISGTYGRYKGVLAVITSLSFTTNLTTHGPFGTAPGE  119

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            PF+    +G  +VGF GR GYY+DA+G +  P
Sbjct  120  PFSIPIADG-VVVGFHGRCGYYLDALGVFVTP  150


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 77/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  157  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGQEYGKFGGK  208

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN   +G +G   GT F
Sbjct  209  NANDTGEERRIEIDGLSEHLTSITGTYGDYAGM-VVITSLAFQTNLTTYGPFGNATGTSF  267

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ ++GF GR G+Y+DAIG +  P
Sbjct  268  SIPIE-GSVVIGFHGRGGHYLDAIGIHVKP  296



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 62/110 (56%), Gaps = 4/110 (4%)
 Frame = +3

Query  168   FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
             F  +  +G K      GG   +NV     I ++   E L E+SGTFG FA   N++ S+ 
Sbjct  970   FEYSDRNGQKHVAGPWGGYGGSNV---HMIQLE-SSEVLVEVSGTFGRFAGFQNIITSLT  1025

Query  348   FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             F TN + +G +G   GTPF+   Q G +IVGFFGR+G+  DAIG Y  PD
Sbjct  1026  FVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRAGWCFDAIGIYVNPD  1075


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 11/146 (8%)
 Frame = +3

Query  54    GPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTE  230
             GP G  GG  +  +   +++  I IS     N+    + FS   +D  +  +   G G E
Sbjct  1246  GPFGRRGGNPFDIKVTPHQLESITISSNIVINS----LAFSYISHDKQQHIVGPWGSGGE  1301

Query  231   TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNVGTPFN  407
             +N T    I + G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G   GTPF+
Sbjct  1302  SNYT----IQL-GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGGGTPFH  1356

Query  408   FQAQNGNKIVGFFGRSGYYIDAIGTY  485
                     IVGFFGR G  I+A+G Y
Sbjct  1357  APMSGNGSIVGFFGREGLCIEAVGFY  1382


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 9/113 (8%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTIGG--GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL  335
             +TFS   ++G      + G  GG+      N TI   G  E++T + GT G++ +  +V+
Sbjct  1124  LTFSYNDHNGDHHLAGLWGSHGGS------NQTIQF-GPSEFITRVYGTIGSYNTPSDVV  1176

Query  336   RSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              SI   TNA  +G +G   G PF+F  Q    IVGFFG +  Y+DAIG Y  P
Sbjct  1177  TSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHANLYVDAIGVYVTP  1229



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 54/146 (37%), Positives = 78/146 (53%), Gaps = 11/146 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTE  230
            GP G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G  
Sbjct  358  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGR  413

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
             N    +   +    EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+
Sbjct  414  INKVVIEATPL----EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFS  468

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF G  G Y+DAIG Y
Sbjct  469  LVMKEGVAIVGFHGLCGAYLDAIGIY  494


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTET  233
            P G  GG  W+++ K+ I +I+I+ GG  ++    I F      G+  D+   GG G   
Sbjct  153  PWGGTGGSEWNYKLKSPIKEILIAHGGCIDS----IMFKTITEQGTTIDSPKFGGNGGRI  208

Query  234  N-VTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
            N V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   G TPF+
Sbjct  209  NKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  262

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GR G Y+DAIG Y
Sbjct  263  LVMKEGVAIVGFHGRCGAYLDAIGVY  288


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 55/107 (51%), Gaps = 8/107 (7%)
 Frame = +3

Query  171  SATKNDGSKDTLTIGGGGTETNVTHNDTINIDGE-DEYLTEISGTFGAFASSDNVLRSIK  347
            + T+   + D+   GG G        D + I     EYLT I GTF        V+ S+ 
Sbjct  4    TITEQGTTIDSPMFGGDGGR-----RDKVVIKASPSEYLTGIKGTFRG-CGIHLVINSLC  57

Query  348  FTTNAREFGTYGP-NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F TNA+ +G +G  + GTPF+F  + G  I GF GR G Y+DAIG Y
Sbjct  58   FITNAKNYGPFGSKDGGTPFSFAMKEGGAIEGFQGRCGAYLDAIGVY  104



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 4/109 (4%)
 Frame = +3

Query  168   FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIK  347
             F+ + ++G K      GG    NV   D I +    E+L E+SGTFG F ++ NV+ S+ 
Sbjct  952   FTYSDHNGQKHVAGPWGGYGSGNV---DMIQL-APSEFLLEVSGTFGRFRTALNVMTSLT  1007

Query  348   FTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F TNA  +G YG   GTPF+   Q+   IVGFFGR+G+Y+DAIG Y  P
Sbjct  1008  FVTNAHSYGPYGKIEGTPFHMPVQSNGCIVGFFGRAGWYVDAIGIYVNP  1056


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 72/148 (49%), Gaps = 10/148 (7%)
 Frame = +3

Query  54    GPLGHNGGGFWSFRP-KNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTE  230
             GP G NGG     +   +++  + I      N+    + FS   +DG   T    GG   
Sbjct  1073  GPCGGNGGKAHDIKVFPHRLESVTICSDIVVNS----LGFSYNDHDGEHHTAGPWGGQG-  1127

Query  231   TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNF  410
                 +N  I  D E E++T + GT G++ +S +V+ SI   TN   +G +G   G PF+F
Sbjct  1128  ---GNNQLIQFDPE-EFITSVCGTIGSYNTSFDVITSITLVTNIDCYGPFGQENGIPFHF  1183

Query  411   QAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
               Q    IVGFFG +  Y+DAIG Y  P
Sbjct  1184  PIQGNGSIVGFFGHADIYVDAIGVYVTP  1211


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 69/134 (51%), Gaps = 10/134 (7%)
 Frame = +3

Query  96    PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGED  275
             P +++  + IS     N+    +TFS   +DG +  L   G G E N T    IN+ G  
Sbjct  1243  PPHRLESVTISSKIVINS----LTFSYRSHDGQQHILGPWGSGNENNYT----INL-GPS  1293

Query  276   EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  452
             E+LT++ GTFG F     V+ S+ F +N   ++G +G   GTPF+        IVGFFG 
Sbjct  1294  EFLTKVLGTFGQFDEFPIVITSLTFFSNTGHQYGPFGQGGGTPFHAPISGNGSIVGFFGY  1353

Query  453   SGYYIDAIGTYNAP  494
              G  ++AIG Y  P
Sbjct  1354  QGDCVEAIGFYFRP  1367



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 55/149 (37%), Positives = 75/149 (50%), Gaps = 12/149 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNK-INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGG-GT  227
            GP G NGG     +  +K +  + I  G   +     + FS    DG + T ++ GG G 
Sbjct  821  GPWGGNGGVTCDIKVASKRLESVTICSGIIID----ALAFSYFDKDGERHTTSLWGGLGG  876

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
               +     IN+D E EYL E+ GT G F  S   + S+   TN R +G +G   GTPF 
Sbjct  877  SVQL-----INLD-EREYLVEVIGTVGPFNVSSEAITSLTLVTNVRSYGPFGQPQGTPFR  930

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
               +  + IVGFFGRSG Y+DA+G Y  P
Sbjct  931  TPLKKNSCIVGFFGRSGTYLDAVGVYFHP  959



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 55/149 (37%), Positives = 75/149 (50%), Gaps = 12/149 (8%)
 Frame = +3

Query  54    GPLGHNGGGFWSFRPKNK-INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGG-GT  227
             GP G NGG     +  +K +  + I  G   +     + FS    DG + T ++ GG G 
Sbjct  938   GPWGGNGGVTCDIKVASKRLESVTICSGIIID----ALAFSYFDKDGERHTTSLWGGLGG  993

Query  228   ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
                +     IN+D E EYL E+ GT G F  S   + S+   TN R +G +G   GTPF 
Sbjct  994   SVQL-----INLD-EREYLVEVIGTVGPFNVSSEAITSLTLVTNVRSYGPFGQPQGTPFR  1047

Query  408   FQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                +  + IVGFFGRSG Y+DA+G Y  P
Sbjct  1048  TPLKKNSCIVGFFGRSGTYLDAVGVYFHP  1076



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 54/146 (37%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTET  233
            P G  GG  W++  K+ I +I+I+ G   ++    I F      G+  D+   GG G   
Sbjct  36   PWGGTGGSEWNYMLKSPIKEILIAHGDVIDS----IMFRTITEQGTTIDSPKFGGDGGR-  90

Query  234  NVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNVGTPFN  407
                 D + I+    EYLT I GTFG F    ++++S+ F TNA+ +G +G    GTPF+
Sbjct  91   ----RDKVVIEATPLEYLTGIKGTFGRFYDR-SIIKSLCFITNAKNYGPFGCEAAGTPFS  145

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GRSG ++DAIG Y
Sbjct  146  LVMEEGVAIVGFHGRSGLFLDAIGVY  171



>ref|XP_009588771.1| PREDICTED: agglutinin-like [Nicotiana tomentosiformis]
Length=345

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 78/145 (54%), Gaps = 10/145 (7%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETN  236
            P G  GG  W+++ K+ I +IVI+ G   ++   R   + TK     D+   GG G    
Sbjct  17   PWGGKGGSEWNYKLKSPIKEIVIAHGSIIDSIMFR---TVTKESTIVDSPKFGGNGG---  70

Query  237  VTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
                D +NI+    EYLT I GT G   S   V++S+ F TNA+ +G +G   G TPF+ 
Sbjct  71   -GRRDKVNIEATPLEYLTGIKGTLGHHGSH-LVVKSLSFITNAKNYGPFGTEGGGTPFSL  128

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GRSG Y+DAIG Y
Sbjct  129  VMKEGGAIVGFHGRSGLYLDAIGVY  153


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +3

Query  246  NDTI---NIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNF  410
            NDTI   +IDGE E L  I G +     +   + +R I F TN  ++G YG  +GT F+ 
Sbjct  258  NDTIRKIHIDGESEILVGIEGFYSPVDDNGGLDTIRQIAFYTNKGKYGPYGTEIGTYFSS  317

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
             A  G KIVGF G+SG +++AIG +
Sbjct  318  SAARG-KIVGFHGKSGVFLNAIGVH  341



>ref|XP_011001797.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
Length=445

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 84/155 (54%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI+ G     N   I+F  T +    D+ T 
Sbjct  298  IEGTISIGPWGGQGGNPWSYITNRGINQIVINVG----LNIKSISFRDTTD---LDSATF  350

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  351  GGN-NPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGS  408

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GTPF+    N N +VGF GR+G+Y+DAIG +  P+
Sbjct  409  GTPFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPE  442


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 78/156 (50%), Gaps = 10/156 (6%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            S+   ++ GP G  GG  WS+R    I +IV+   G    N   I+F   K+     + T
Sbjct  3    SLEGIISLGPWGGLGGDHWSYRASGGITEIVLRVVG----NIKSISF---KDASGLVSGT  55

Query  210  IGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
             GG G + N       I I    EYL  ISGT+G++     V+ S+ F TN   +G +G 
Sbjct  56   FGGRGNDPNDRGEQKKIEIQWPSEYLKSISGTYGSYKGLL-VITSLSFITNLTTYGPFGT  114

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G  F+    + + +VGF GR GYY+DA+G +  P
Sbjct  115  ALGETFSIPIAD-SAVVGFHGRCGYYLDALGIFVTP  149


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGQEYGKFGGK  207

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F
Sbjct  208  NANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSF  266

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ ++GF GR G+Y+DAIG +  P
Sbjct  267  SIPIE-GSVVIGFHGRGGHYLDAIGIHVKP  295



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 55/145 (38%), Positives = 78/145 (54%), Gaps = 11/145 (8%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTET  233
            P G  GG  W++  K+ I +I+I+ G   ++   R   + T+   + D+   GG GG   
Sbjct  20   PRGGTGGLQWNYMLKSPIKEILITHGDCIDSIMFR---TVTEQGTTIDSPKFGGDGGRRD  76

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
             V    T+      EYLT I GTFG    S +V++S+ F TNA+ +G +G   G TPF+ 
Sbjct  77   KVVIEATLL-----EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSL  130

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GR G Y+DAIG Y
Sbjct  131  VIREGGAIVGFHGRCGAYLDAIGVY  155



>gb|ACF87628.1| unknown [Zea mays]
Length=122

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  434
            I++   DE LTEISGT G   + DN+++S+KF TN R +G YG + GTPF  +  N   +
Sbjct  42   IDLCRFDESLTEISGTTGPAYNIDNLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHV  101

Query  435  VGFFGRSGYYIDAIGTYNAPD  497
             GFFGRSG  +DAIG Y  P+
Sbjct  102  AGFFGRSGDCLDAIGLYVNPN  122



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 55/145 (38%), Positives = 78/145 (54%), Gaps = 11/145 (8%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTET  233
            P G  GG  W++  K+ I +I+I+ G   ++   R   + T+   + D+   GG GG   
Sbjct  36   PRGGTGGLQWNYMLKSPIKEILITHGDCIDSIMFR---TVTEQGTTIDSPKFGGDGGRRD  92

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
             V    T+      EYLT I GTFG    S +V++S+ F TNA+ +G +G   G TPF+ 
Sbjct  93   KVVIEATLL-----EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSL  146

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GR G Y+DAIG Y
Sbjct  147  VIREGGAIVGFHGRCGAYLDAIGVY  171



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 55/146 (38%), Positives = 77/146 (53%), Gaps = 13/146 (9%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTET  233
            P G  GG  W++  K+ I +I+I  G   ++    I F      G+  D+   GG G   
Sbjct  33   PWGGVGGSKWNYMLKSPIKEILIVHGDVIDS----IMFRTITEQGTTIDSPKFGGDGGR-  87

Query  234  NVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
                 D + ++    EYLT I GTFG F    +V++S+ F TNA+ +G +G   G TPF+
Sbjct  88   ----RDKVVVEATPLEYLTGIKGTFGRFYGH-SVIKSLCFITNAKNYGPFGSEAGGTPFS  142

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GRSG Y+DAIG Y
Sbjct  143  LVMKEGVAIVGFHGRSGLYLDAIGVY  168



>sp|P83304.1|LEC_PARPC RecName: Full=Mannose/glucose-specific lectin, partial [Parkia 
platycephala]
 pdb|1ZGR|A Chain A, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGR|B Chain B, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGS|A Chain A, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
 pdb|1ZGS|B Chain B, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
Length=447

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 82/163 (50%), Gaps = 11/163 (7%)
 Frame = +3

Query  15   YHSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGS  194
            Y     +   ++ GP G +GG  WS+     INQI+I  G         I   A K+   
Sbjct  291  YVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSN-------IKSVAFKDTSG  343

Query  195  KDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNARE  368
             D+ T GG   + +    +T++I+   EYLT ISGT+G +   D    + S+ FTTN   
Sbjct  344  LDSATFGGVNPK-DTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLAT  402

Query  369  FGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            +G +G    T F+    N N +VGF GR+G Y+DAIG +  PD
Sbjct  403  YGPFGKASATSFSIPIHN-NMVVGFHGRAGDYLDAIGIFVKPD  444


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 81/157 (52%), Gaps = 11/157 (7%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            S+   ++ GP G +GG +WSF+  + I +IVI       +N   I+F     D S    T
Sbjct  1    SLKGMISVGPWGGSGGNYWSFKANHAITEIVIHV----KDNIKSISFKDASGDISG---T  53

Query  210  IGGGGTETNVTHND-TINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
             GG     N   ++  I I    EYL  ISG++G + +   V+RS+ F TN   +G +G 
Sbjct  54   FGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDY-NGVLVIRSLSFITNLTTYGPFGS  112

Query  387  NV-GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
               G  F+    + + +VGF GR+GYY+DA+G +  P
Sbjct  113  TSGGESFSIPIAD-SVVVGFHGRAGYYLDALGIFVQP  148


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = +3

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  395
            GG    ++     + IDG  E+L  ISGT+G +   + V+ S+ F TN  + G +G   G
Sbjct  204  GGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFE-VVTSLSFITNVTKHGPFGIASG  262

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            T F+   + G+ + GF G+SGYY+D+IG Y  P
Sbjct  263  TSFSIPIE-GSLVTGFHGKSGYYLDSIGIYVKP  294



>ref|XP_011015046.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
 ref|XP_011015047.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 82/155 (53%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI  G    +N   I+F  T      D+ T 
Sbjct  298  IEGTISIGPWGGRGGSPWSYITNRGINQIVIHVG----SNIKSISFRDTTG---LDSATF  350

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  351  GGE-NPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGS  408

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GTPF+    N N +VGF GR+G+Y+DAIG +  P 
Sbjct  409  GTPFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPQ  442


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGHEYGKFGGK  207

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN   +G +G   GT F
Sbjct  208  NANDTGEERRIEIDGHSEHLTSITGTYGDYAGM-VVITSLAFQTNLTTYGPFGNATGTSF  266

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ + GF GR G+Y+DAIG +  P
Sbjct  267  SIPIE-GSVVTGFHGRGGHYLDAIGIHVKP  295


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 72/151 (48%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G  GG  WS+R    I +IV+    R   N   I+F   K+     + T GG G
Sbjct  8    ISLGPWGGLGGDRWSYRASGGITEIVL----RVEGNIKSISF---KDASGLVSGTFGGTG  60

Query  225  TETNVTHNDT-INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTP  401
             + N    +  I I    E+L  ISGT G       V+ S+ F TN   +G +G      
Sbjct  61   NDPNDRGKEKKIAIQWPSEHLKSISGTCGR-CKGLLVITSLSFITNLTTYGPFGTAARET  119

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+    + + +VGF GR GYY+DA+G +  P
Sbjct  120  FSIPIAD-STVVGFHGRCGYYLDALGIFVTP  149



>ref|XP_011001798.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 83/155 (54%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI+ G     N   I+F  T +    D+ T 
Sbjct  298  IEGTISIGPWGGQGGNPWSYITNRGINQIVINVG----LNIKSISFRDTTD---LDSATF  350

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  351  GGN-NPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGS  408

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GTPF+    N N +VGF GR+G+Y+DAIG +  P 
Sbjct  409  GTPFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPQ  442


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 78/156 (50%), Gaps = 10/156 (6%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            S+   ++ GP G  GG  WS+R    I +IV+    R   N   I+F   K+     + T
Sbjct  3    SLEGIISLGPWGGLGGDHWSYRASGGITEIVL----RVEGNIKSISF---KDASGLVSGT  55

Query  210  IGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
             GG G + N       I I    EYL  ISGT+G++     V+ S+ F TN   +G +G 
Sbjct  56   FGGRGNDPNDRGEQKKIEIQWPSEYLKSISGTYGSYKGLL-VITSLSFITNLTTYGPFGT  114

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G  F+    + + +VGF GR GYY+DA+G +  P
Sbjct  115  ALGETFSIPIAD-SAVVGFHGRCGYYLDALGIFVTP  149


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGQEYGNFGGN  207

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F
Sbjct  208  NANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSF  266

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ ++GF GR G+Y+DAIG +  P
Sbjct  267  SIPIE-GSVVIGFHGRGGHYLDAIGIHVKP  295



>ref|XP_009338132.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338133.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
Length=764

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 54/149 (36%), Positives = 77/149 (52%), Gaps = 12/149 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTE  230
            GP G NGG  W     N + +I + +G   ++    IT    KN         GG GGT+
Sbjct  599  GPWGGNGGTPWDDGIYNGVREITVDYGHCIDS----ITVVYDKNGKPVKADAHGGRGGTQ  654

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
            T       I ++  DEYL  ++G +   A     ++RS+KF +N R FG +G   GT F 
Sbjct  655  TA-----EIKLEYPDEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIQEGTTFT  709

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +  + G KIVG  GR+G+YIDAIG + +P
Sbjct  710  YNVEGG-KIVGLKGRNGWYIDAIGFHVSP  737



>gb|KJB58185.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1244

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 82/159 (52%), Gaps = 12/159 (8%)
 Frame = +3

Query  21    STMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
             ST      V+ GP G  GG  W       I Q+VI+ G     + ++I +  TK +    
Sbjct  914   STEDDKKPVSVGPWGGQGGTSWDDGVYCTIRQLVIAHGS--GIDSVQIEYD-TKGNSLWS  970

Query  201   TLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGT  377
                 G GG++T     D + +D  DE+LT I G +G+      ++ RS+ F +N + +G 
Sbjct  971   RKHGGNGGSKT-----DKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGP  1025

Query  378   YGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G   GT F   + N  KIVGF GRSG+Y+DAIG Y+ P
Sbjct  1026  FGIEQGTSF---SMNKGKIVGFRGRSGWYLDAIGVYSKP  1061



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 58/158 (37%), Positives = 83/158 (53%), Gaps = 11/158 (7%)
 Frame = +3

Query  18   HSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNP-IRITFSATKNDGS  194
            H + + +  +   P G  GG  W++  K+ I +I+I+ G   ++   I +T   T  D  
Sbjct  15   HVSYAQADSIFLKPWGGFGGSKWNYMLKSPIKEILIAHGDCIDSIMFITVTEQGTTIDSP  74

Query  195  KDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFG  374
            K     GGGG    V    T       EYLT I+GTFG +  S  V++S+ F TNA+ +G
Sbjct  75   KFG---GGGGRRAKVVFEAT-----PLEYLTGINGTFG-YGGSHLVIKSLCFITNAKSYG  125

Query  375  TYGP-NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             +G  + GTPF+   + G  IVGF G SG Y+DAIG Y
Sbjct  126  PFGSKDGGTPFSLVMKEGVAIVGFHGCSGLYLDAIGVY  163



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 79/152 (52%), Gaps = 18/152 (12%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIR-ITFSATKNDGSKDTLTIGGGGTET  233
            P G  GG  W++  K+ I +I+I+ G   ++   R +T   T  D  K     GGGG   
Sbjct  59   PWGGFGGSKWNYMLKSPIKEILIAHGDCIDSIMFRTVTEQGTTIDSPKFG---GGGGRRA  115

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG------  395
             V    T       EYLT I+GTFG    SD V++S+ F TNA+ +G +G + G      
Sbjct  116  KVVFEAT-----PLEYLTGINGTFG-HDGSDLVIKSLCFITNAKSYGPFGSSYGPFGSMV  169

Query  396  --TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              TPF+   + G  IVGF GRSG Y+DAIG Y
Sbjct  170  GGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  201



>ref|XP_011015045.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 82/155 (53%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI  G    +N   I+F  T      D+ T 
Sbjct  444  IEGTISIGPWGGRGGSPWSYITNRGINQIVIHVG----SNIKSISFRDTTG---LDSATF  496

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  497  GGE-NPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGS  554

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GTPF+    N N +VGF GR+G+Y+DAIG +  P 
Sbjct  555  GTPFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPQ  588


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGHEYGKFGGK  207

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN   +G +G   GT F
Sbjct  208  NANDTGEERRIEIDGHSEHLTSITGTYGDYAGM-VVITSLAFQTNLTTYGPFGNATGTSF  266

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ + GF GR GYY+DA+G +  P
Sbjct  267  SIPIE-GSVVTGFHGRGGYYLDALGIFVTP  295


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  302  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGHEYGKFGGK  353

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN   +G +G   GT F
Sbjct  354  NANDTGEERRIEIDGHSEHLTSITGTYGDYAGM-VVITSLAFQTNLTTYGPFGNATGTSF  412

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ + GF GR G+Y+DAIG +  P
Sbjct  413  SIPIE-GSVVTGFHGRGGHYLDAIGIHVKP  441


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 72/151 (48%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G  GG  WS+R    I +IV+    R   N   I+F   K+     + T GG G
Sbjct  8    ISLGPWGGLGGDRWSYRASGGITEIVL----RVEGNIKSISF---KDASGLVSGTFGGTG  60

Query  225  TETNVTHNDT-INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTP  401
             + N    +  I I    E+L  ISGT G       V+ S+ F TN   +G +G      
Sbjct  61   NDPNDRGKEKKIAIQWPSEHLKSISGTCGR-CKGLLVITSLSFITNLTTYGPFGTAARET  119

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+    + + +VGF GR GYY+DA+G +  P
Sbjct  120  FSIPIAD-STVVGFHGRCGYYLDALGIFVTP  149



>ref|XP_006354454.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Solanum tuberosum]
Length=303

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 76/145 (52%), Gaps = 10/145 (7%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVT  242
            G +GG  W++RPK  + QIV+  G   ++    I F +++ +G  ++ T GG G      
Sbjct  161  GGSGGSHWNYRPKGVVKQIVVKHGLIIDS----IMFKSSEENGVMESKTFGGSGGHLTT-  215

Query  243  HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQ-AQ  419
                INID   EYLT +SGT+G +     +++SIK  TN    G  G  + T  NF    
Sbjct  216  ---EINIDSPSEYLTGLSGTYGLYGPY-LIIKSIKLHTNLSHHGPMGSVIETDTNFSFIM  271

Query  420  NGNKIVGFFGRSGYYIDAIGTYNAP  494
             G  +VGF G SG ++DA+G Y  P
Sbjct  272  QGGVVVGFHGFSGLFLDAVGLYVMP  296



>ref|NP_001106057.1| PL3K2 [Zea mays]
 gb|ABR68026.1| PL3K2 [Zea mays]
 gb|ACF80462.1| unknown [Zea mays]
 gb|ACG30569.1| hypothetical protein [Zea mays]
Length=151

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  434
            I++   DE LTEISGT G   + DN+++S+KF TN R +G YG + GTPF  +  N   +
Sbjct  71   IDLCRFDESLTEISGTTGPAYNIDNLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHV  130

Query  435  VGFFGRSGYYIDAIGTYNAPD  497
             GFFGRSG  +DAIG Y  P+
Sbjct  131  AGFFGRSGDCLDAIGLYVNPN  151



>ref|XP_011001796.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 83/155 (54%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI+ G     N   I+F  T +    D+ T 
Sbjct  444  IEGTISIGPWGGQGGNPWSYITNRGINQIVINVG----LNIKSISFRDTTD---LDSATF  496

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  497  GGN-NPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGS  554

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GTPF+    N N +VGF GR+G+Y+DAIG +  P 
Sbjct  555  GTPFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPQ  588


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 78/156 (50%), Gaps = 10/156 (6%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            S+   ++ GP G  GG  WS+R    I +IV+   G    N   I+F   K+     + T
Sbjct  3    SLEGIISLGPWGGLGGDHWSYRASGGITEIVLRVVG----NIKSISF---KDASGLVSGT  55

Query  210  IGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
             GG G + N       I I    EYL  ISGT+G++     V+ S+ F TN   +G +G 
Sbjct  56   FGGRGNDPNDRGEQKKIEIQWPSEYLKSISGTYGSYKGLL-VITSLSFITNLTTYGPFGT  114

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G  F+    + + +VGF GR GYY+DA+G +  P
Sbjct  115  ALGETFSIPIAD-SAVVGFHGRCGYYLDALGIFVTP  149


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGQEYGKFGGK  207

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F
Sbjct  208  NANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSF  266

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ ++GF GR GYY+DA+G +  P
Sbjct  267  SIPIE-GSVVIGFHGRGGYYLDALGIFVTP  295


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  302  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGQEYGNFGGN  353

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F
Sbjct  354  NANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSF  412

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ ++GF GR G+Y+DAIG +  P
Sbjct  413  SIPIE-GSVVIGFHGRGGHYLDAIGIHVKP  441



>ref|XP_004960703.1| PREDICTED: agglutinin-like [Setaria italica]
Length=321

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 77/151 (51%), Gaps = 17/151 (11%)
 Frame = +3

Query  54   GPLGHNGGGFWSFR---PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTL--TIGG  218
            GP G NGG  W         ++  I IS+GG  +     I FS     G + T     G 
Sbjct  176  GPCGGNGGVVWDIPGTPSPTRLESITISYGGVIDG----IEFSYINQSGQRCTTGRWCGK  231

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-  395
            GGT T +     IN+ G  E++ E+SGT GA+   +N++R++   TN R +G +G  +  
Sbjct  232  GGTRTQL-----INL-GPSEFVKEVSGTIGAYRHYNNIIRTLAIVTNVRTYGPFGNQLNG  285

Query  396  -TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              PF+   QN + IVGFF R   ++DAIG Y
Sbjct  286  TAPFSIPVQNNSSIVGFFARGQQFLDAIGVY  316



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+L E+SGTFG +     V+RSIKF TN + +G +G   GTPF+   QN + IVGFF
Sbjct  232  GSSEFLKEVSGTFGPYEGW-KVIRSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGFF  290

Query  447  GRSGYYIDAIGTYNAP  494
            GRSG Y+D +G Y  P
Sbjct  291  GRSGKYLDTVGIYVHP  306



>gb|ACG29554.1| hypothetical protein [Zea mays]
 gb|ACG44268.1| hypothetical protein [Zea mays]
Length=151

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  434
            I++   DE LTEISGT G   + DN+++S+KF TN R +G YG + GTPF  +  N   +
Sbjct  71   IDLCRFDESLTEISGTTGPAYNIDNLVKSLKFVTNKRTYGPYGRDEGTPFRVKVMNNGHV  130

Query  435  VGFFGRSGYYIDAIGTYNAPD  497
             GFFGRSG  +DAIG Y  P+
Sbjct  131  AGFFGRSGDCLDAIGLYVNPN  151



>gb|EMT23136.1| hypothetical protein F775_18655 [Aegilops tauschii]
Length=118

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 8/94 (9%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            G GGTE      DTIN+D  + Y+TEISGT G F + D+++ S+K  T+     TYG   
Sbjct  33   GTGGTE------DTINLDATN-YVTEISGTVGKFGT-DDIVTSLKIVTSKGVTKTYGSGT  84

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            GTPF     +G KIVGFFGR+G ++DAIG Y +P
Sbjct  85   GTPFRVPVLDGGKIVGFFGRAGAFLDAIGFYISP  118



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 79/150 (53%), Gaps = 11/150 (7%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            +GP G +GG     R     ++ + IS G   ++    I FS T + G   T    GG  
Sbjct  259  FGPWGGDGGKTRDIRMTPCHLHSVTISSGTIIDS----IGFSFTDHYGQHHTTGPWGGKE  314

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
             TN      I + G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+
Sbjct  315  GTN-----KIEL-GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFH  368

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             Q QN  +IVGFFGRSG Y+ AIG Y   D
Sbjct  369  IQTQNNGRIVGFFGRSGQYLYAIGVYTNQD  398


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  517  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  576

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  577  GRYLNAIGVYTAP  589



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  261  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  437
            + G  E++ E+SGTFG +     N++ S+KF TN + +G +G   GTPF   AQ  + IV
Sbjct  225  VLGASEFMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIPAQKNSSIV  284

Query  438  GFFGRSGYYIDAIGTYNAP  494
            GFFGRSG Y+DA+G Y  P
Sbjct  285  GFFGRSGIYLDALGVYVRP  303



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+L E+S TFG +  S  V+RSI F TN + +G +G   GTPF+  AQN + +VGFF
Sbjct  175  GSSEFLKEVSRTFGPYEGS-TVIRSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGFF  233

Query  447  GRSGYYIDAIGTYNAP  494
            GRSG YI+A+G Y  P
Sbjct  234  GRSGKYINAVGVYVQP  249



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+L E+SGTFG +  S  V+ SI F TN + +G +G   GTPF+  AQN + IVGFF
Sbjct  231  GSSEFLKEVSGTFGPYEGS-TVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFF  289

Query  447  GRSGYYIDAIGTYNAP  494
            GRSG YI+A+G Y  P
Sbjct  290  GRSGKYINAVGVYVQP  305



>ref|XP_004291831.1| PREDICTED: jacalin-related lectin 3 [Fragaria vesca subsp. vesca]
Length=642

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 78/151 (52%), Gaps = 9/151 (6%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            VA GP G   G  W     + + Q+VI+ G     + I++ + +  +    D    G GG
Sbjct  12   VAVGPWGSQNGLMWDDGVYSTVRQLVIAHGS--GIDSIQVEYDSKGSSFWSDKHG-GNGG  68

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +      DT+ +D  +E+LT   G +G  +    V LRSI F +N R +G +G   GT 
Sbjct  69   WKI-----DTVQLDYPEEFLTSFHGYYGKISEWGTVSLRSITFKSNKRSYGPFGMEQGTY  123

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+     GNKIVGF G+SG+Y+DAIG +  P
Sbjct  124  FSLPVTTGNKIVGFHGKSGWYVDAIGAHLKP  154


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D  +E LT I+GTFG       NV++S+ F T  ++ G YG   GT F+ Q + 
Sbjct  308  SDRIIFDYPNEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHGPYGEEQGTQFSTQLRE  367

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KIVG  GR+G ++DAIG +
Sbjct  368  G-KIVGIHGRTGLFLDAIGVH  387


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  428
            I ++   E L+ ISG +   + ++   +++S+ F T+  ++G +G  VGT F      G 
Sbjct  545  IKLEYPHEVLSCISGYYSCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  603

Query  429  KIVGFFGRSGYYIDAIGTY  485
            K+VGF GRS  Y+DAIG +
Sbjct  604  KVVGFHGRSSLYLDAIGVH  622



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  273  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  452
             E+L E+SGTFG +  S NV+ SIKF TN + +G +G   GTPF+   QN + +VGFFGR
Sbjct  231  SEFLKEVSGTFGTYYGS-NVITSIKFVTNVKTYGPFGKQNGTPFSIPVQNNSSVVGFFGR  289

Query  453  SGYYIDAIGTYNAP  494
             G Y+DA+G Y  P
Sbjct  290  GGKYLDAVGVYVHP  303



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  276   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
             E L E+SGTFG F    N++ S+ F TN R +G YG   GTPF+   Q    IVGFFGR+
Sbjct  980   EILVEVSGTFGRFIGFQNIITSLTFVTNTRSYGPYGQRKGTPFDIPVQGSGCIVGFFGRA  1039

Query  456   GYYIDAIGTYNAPD  497
             G+ +DAIG Y  PD
Sbjct  1040  GWCVDAIGIYVNPD  1053


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 9/113 (8%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTIGGG--GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL  335
             +TFS   +DG   T+ + G   GT   +         G  E++T +SGT G++ +  +V+
Sbjct  1102  LTFSYNDHDGEHHTVCLKGSLVGTCQKIQF-------GSSEFITRVSGTIGSYNTPSDVV  1154

Query  336   RSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              SI   TN   +G +G   G PFNF  Q   +IVGFFG +  Y+DAIG Y  P
Sbjct  1155  TSITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGFFGHADLYVDAIGVYVNP  1207


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query  267   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGF  443
             G  E+L ++ GTFG F    NV+ S+ F TN    +G +G   GTPF         IVGF
Sbjct  1289  GPLEFLVKVLGTFGPFGEFPNVITSLTFVTNTDHHYGPFGQGGGTPFYGPMSGHGSIVGF  1348

Query  444   FGRSGYYIDAIGTY  485
             FGR G  I+AIG Y
Sbjct  1349  FGRKGPCIEAIGFY  1362



>ref|XP_011001803.1| PREDICTED: mannose/glucose-specific lectin-like [Populus euphratica]
Length=446

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 81/155 (52%), Gaps = 10/155 (6%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I   ++ GP G  GG  WS+     INQIVI  G    +N   I+F  T      D+ T 
Sbjct  299  IEGTISIGPWGGRGGSPWSYMTNRGINQIVIHVG----SNIKSISFRDTTG---LDSATF  351

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  392
            GG     ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   
Sbjct  352  GGE-NPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGS  409

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            GT F+    N N +VGF GR+G+Y+DAIG +  P 
Sbjct  410  GTAFSIPINN-NTVVGFHGRAGHYLDAIGIFVKPQ  443


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 73/152 (48%), Gaps = 11/152 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G  GG  WS+R    I +IV+    R   N   I+F   K+     + T GG G
Sbjct  8    ISLGPWGGLGGDRWSYRASGGITEIVL----RVEGNIKSISF---KDASGLVSGTFGGTG  60

Query  225  TETNVTHNDT-INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREF-GTYGPNVGT  398
             + N    +  I I    E+L  ISGT+G       V+ S+ F TN   + G +G     
Sbjct  61   NDPNDRGKEKKIAIQWPSEHLKSISGTYGR-CKGLLVITSLSFITNLTTYYGPFGTAARE  119

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F+    + + +VGF GR GYY+DA+G +  P
Sbjct  120  TFSIPIAD-STVVGFHGRCGYYLDALGIFVTP  150


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 72/150 (48%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ G  G  GG  +SFR  + I +I++  G     N   ++F     DG+       GG 
Sbjct  157  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----KDGNGQEYGNFGGN  208

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
               +      I IDG  E+L  I+GT+G +A    V+ S+ F TN   +G +G   GT F
Sbjct  209  NANDTGEERRIEIDGHSEHLASITGTYGDYAGMV-VITSLAFQTNRTTYGPFGNATGTSF  267

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +   + G+ + G  G  G+Y+ AIG +  P
Sbjct  268  SIPIE-GSVVTGLHGSGGHYLGAIGIHVKP  296



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 62/113 (55%), Gaps = 8/113 (7%)
 Frame = +3

Query  162  ITFSATKNDGSKDTL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVL  335
            I FS     G K T    GG G   N        + G  E++ E+SGT+G + A   N++
Sbjct  200  IKFSYVDQAGQKHTSGPWGGSGGNQNTI------VLGASEFVKEVSGTYGIYDADQHNII  253

Query  336  RSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             S+KF TN + +G +G   GTPF    +N + IVGFFGRSG Y+DA+G Y  P
Sbjct  254  MSLKFITNVKAYGPFGEANGTPFTIPVENNSSIVGFFGRSGIYLDALGVYVRP  306



>ref|XP_008244775.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like [Prunus mume]
Length=343

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 81/160 (51%), Gaps = 13/160 (8%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDT  203
            + SI   +   P G NGG  W     + + +I I++    ++    IT    +N      
Sbjct  170  SQSIQKTIVIEPWGGNGGADWDDGIYHGVREIKIAYCLCIDS----ITVVYDRNRKPVKA  225

Query  204  LTIGG-GGTETNVTHNDTINIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFG  374
             T GG GG +T     D I +   DE+L  +SG +    F     ++RS+KF +N R FG
Sbjct  226  ETHGGRGGNQT-----DEIKLQYPDEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFG  280

Query  375  TYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             YG   GTPF F   +G KIVG  GRSG+Y+DAIG + +P
Sbjct  281  PYGIEEGTPFTFTV-DGGKIVGLKGRSGWYLDAIGFHVSP  319


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 71/152 (47%), Gaps = 11/152 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP   NGG  W     N + +I I++    ++    IT    +N       T G  G
Sbjct  21   IVIGPWXGNGGADWDDGIYNGVREIKIAYCLCIDS----ITVVYDRNGKRVKAETHGNRG  76

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVGT  398
                      I +   DEYL   SG +    F     ++RS+KF +N R FG YG   GT
Sbjct  77   DHETAE----IKLQYPDEYLVGASGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGT  132

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            PF F   +G +IVG  GR G+Y++AIG + +P
Sbjct  133  PFTFTV-DGGQIVGLKGRDGWYLNAIGFHVSP  163



>pdb|4MQ0|A Chain A, Crystal Structure Of Parkia Biglobosa Seed Lectin (pbl) 
In Complex With Methyl Alpha D-mannopyranoside
Length=446

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 82/163 (50%), Gaps = 11/163 (7%)
 Frame = +3

Query  15   YHSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGS  194
            Y     +   ++ GP G +GG  WS+     INQI+I  G    +N   I F   K+   
Sbjct  290  YVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAG----SNIKSIAF---KDTSG  342

Query  195  KDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNARE  368
             D+ T GG   + +    +T++I    EYLT I GT+G +   D    + S+ FTTN   
Sbjct  343  LDSATFGGVNPK-DTGEKNTVSIKWPSEYLTSIDGTYGQYKFKDVFTTVTSLSFTTNLAT  401

Query  369  FGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
            +G +G    T F+    N N +VGF GR+G Y+DAIG +  PD
Sbjct  402  YGPFGKASLTSFSIPIHN-NMVVGFHGRAGDYLDAIGIFVKPD  443


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 80/157 (51%), Gaps = 11/157 (7%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            S+   ++ GP G +GG  WSF+  + I +I+I       +N   I+F   K+ G   + T
Sbjct  1    SLKGMISVGPWGGSGGDHWSFKANHAITEILIHV----KDNIKSISF---KDAGGDISGT  53

Query  210  IGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
             GG     N       I I    EYL  ISG++G + +   V+RS+ F TN   +G +G 
Sbjct  54   FGGKDPRENKKGEEKKIGIRWPTEYLKSISGSYGDY-NGILVIRSLSFITNLTTYGPFGS  112

Query  387  NVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              G   F+    + + +VGF GR+GYY+DA+G +  P
Sbjct  113  TSGGESFSIPIAD-SVVVGFHGRAGYYLDALGIFVQP  148


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = +3

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  395
            GG    ++   + + IDG  E+LT ISGT+G +   + VL S+ F TN  + G +G   G
Sbjct  203  GGQDPNDIGVEEKVEIDGNLEHLTSISGTYGNYKGFE-VLTSLSFITNVTKHGPFGIASG  261

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            T F+ +   G+ + GF G+ GYY+D+IG Y  P
Sbjct  262  TSFS-RPIEGSLVTGFHGKGGYYLDSIGIYVKP  293



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 53/145 (37%), Positives = 75/145 (52%), Gaps = 12/145 (8%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETN  236
            P G  GG  W++  K  I +I+I+ G   ++   R   + T+   + D+   G  G    
Sbjct  20   PWGGTGGSEWNYMLKCPIKEILIAHGDCIDSIMFR---TVTEQGTTIDSPKFGADGCR--  74

Query  237  VTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
                D + I+    EYLT I GTFG    S  V++S+ F TNA+ +G +G   G TPF+ 
Sbjct  75   ----DKVVIEANPLEYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSL  129

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GR G Y+DAIG Y
Sbjct  130  VMREGGAIVGFHGRCGAYLDAIGVY  154



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 53/145 (37%), Positives = 75/145 (52%), Gaps = 12/145 (8%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETN  236
            P G  GG  W++  K  I +I+I+ G   ++   R   + T+   + D+   G  G    
Sbjct  36   PWGGTGGSEWNYMLKCPIKEILIAHGDCIDSIMFR---TVTEQGTTIDSPKFGADGCR--  90

Query  237  VTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
                D + I+    EYLT I GTFG    S  V++S+ F TNA+ +G +G   G TPF+ 
Sbjct  91   ----DKVVIEANPLEYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSL  145

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GR G Y+DAIG Y
Sbjct  146  VMREGGAIVGFHGRCGAYLDAIGVY  170



>ref|XP_008677998.1| PREDICTED: mannose/glucose-specific lectin-like isoform X9 [Zea 
mays]
Length=616

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  178  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  237

Query  447  GRSGYYIDAIGTYNAPD  497
            GRSG Y+ AIG Y   D
Sbjct  238  GRSGQYLYAIGVYTNQD  254


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  373  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  432

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  433  GRYLNAIGVYTAP  445



>ref|XP_008677996.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
 ref|XP_008677997.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
Length=652

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  214  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  273

Query  447  GRSGYYIDAIGTYNAPD  497
            GRSG Y+ AIG Y   D
Sbjct  274  GRSGQYLYAIGVYTNQD  290


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  409  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  468

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  469  GRYLNAIGVYTAP  481



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  345  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  404

Query  447  GRSGYYIDAIGTYNAPD  497
            GRSG Y+ AIG Y   D
Sbjct  405  GRSGQYLYAIGVYTNQD  421


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  540  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  599

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  600  GRYLNAIGVYTAP  612



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  343  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  402

Query  447  GRSGYYIDAIGTYNAPD  497
            GRSG Y+ AIG Y   D
Sbjct  403  GRSGQYLYAIGVYTNQD  419


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  538  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  597

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  598  GRYLNAIGVYTAP  610



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  345  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  404

Query  447  GRSGYYIDAIGTYNAPD  497
            GRSG Y+ AIG Y   D
Sbjct  405  GRSGQYLYAIGVYTNQD  421


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  540  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  599

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  600  GRYLNAIGVYTAP  612



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 77/144 (53%), Gaps = 9/144 (6%)
 Frame = +3

Query  57   PLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETN  236
            P G  GG  W+++ KN I +I+I+ G   ++   R   + TK   +  +   GG G + +
Sbjct  12   PWGGTGGSKWNYKLKNPIKEILIAHGDIIDSIMFR---TVTKKGITIGSPKFGGNGGQIS  68

Query  237  VTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQ  413
                +   +    EYLT I GTFG +    +V++S+ F TN + +G +G   G TPF+  
Sbjct  69   KVVIEATPL----EYLTGIKGTFGHYCGL-SVIKSLCFITNVKNYGPFGCEAGGTPFSLV  123

Query  414  AQNGNKIVGFFGRSGYYIDAIGTY  485
             + G  IVGF GR G ++DAIG Y
Sbjct  124  MKEGVAIVGFHGRCGAFLDAIGVY  147



>ref|XP_008677994.1| PREDICTED: mannose/glucose-specific lectin-like isoform X6 [Zea 
mays]
Length=684

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  246  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  305

Query  447  GRSGYYIDAIGTYNAPD  497
            GRSG Y+ AIG Y   D
Sbjct  306  GRSGQYLYAIGVYTNQD  322


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  441  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  500

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  501  GRYLNAIGVYTAP  513



>ref|XP_007215056.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
 gb|EMJ16255.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
Length=179

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G NGG  W     N + +I +++G   ++    IT    +N       T GG G
Sbjct  14   IEVGPWGGNGGADWDDGIYNGVREITLAYGLCIDS----ITVVYDRNGKPVKAETHGGRG  69

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
             +        I +   DE+L  +SG +         ++RS+KF +N R FG YG   GTP
Sbjct  70   GDQTAE----IKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTP  125

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F F   +G KIVG  GR+G+Y+DAIG + +P
Sbjct  126  FTFSV-DGGKIVGLKGRNGWYLDAIGFHVSP  155



>ref|XP_002449838.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
 gb|EES08826.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
Length=281

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 75/156 (48%), Gaps = 10/156 (6%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSF-RPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTL  206
            SI      G  G NGG       P  ++  I IS G   ++    I FS     G K T 
Sbjct  134  SIVVATKIGAWGGNGGSAQDITEPPKRLESITISSGSVVDS----IAFSYVDQAGQKHT-  188

Query  207  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
                G       +  TI +  + E++ E+SGTFG +A   NV+ SIK  TN + +G +G 
Sbjct  189  ---AGPWGGPGGNPKTIELS-DSEFVKEVSGTFGMYAKVVNVINSIKLVTNVKTYGPFGQ  244

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              G+ F+   Q  + + GFFGRSG ++DAIG Y  P
Sbjct  245  ENGSSFSVPVQGNSGVAGFFGRSGKFLDAIGVYVHP  280



>ref|XP_009760249.1| PREDICTED: agglutinin-like [Nicotiana sylvestris]
Length=345

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 84/160 (53%), Gaps = 14/160 (9%)
 Frame = +3

Query  12   NYHSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDG  191
            +Y  T SI  +    P G  GG  W+++ K+ I +IVI+ G   ++   R   + TK   
Sbjct  6    SYDETDSILVE----PWGGKGGLEWNYKLKSPIKEIVIAHGSIIDSIMFR---TITKEGT  58

Query  192  SKDTLTIGGGGTETNVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNARE  368
              D+   GG G        D +NI+    EYLT I GT G + S + V++S+ F TN + 
Sbjct  59   IVDSPKFGGNGG----GRRDKVNIEATPLEYLTGIKGTLGHYGS-NLVVKSLSFITNGKN  113

Query  369  FGTYGPNVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G +G   G T F+   + G  IVGF GRSG Y+DAIG Y
Sbjct  114  YGPFGTEAGGTLFSLVMKEGGAIVGFHGRSGLYLDAIGVY  153


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +3

Query  246  NDT---INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNF  410
            NDT   IN+DGE+E L  I G +     +   + +R I F TN  ++G YG  +GT F+ 
Sbjct  258  NDTVRKINVDGENELLIGIEGFYSPVDDNGGLDAIRQIAFYTNKGKYGPYGTEIGTYFSS  317

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
             A  G KIVGF G+SG +++AIG +
Sbjct  318  SAARG-KIVGFHGKSGVFLNAIGVH  341



>ref|XP_010232948.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=266

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 78/165 (47%), Gaps = 23/165 (14%)
 Frame = +3

Query  27   MSISTDVAYGPLGHNGGGFWS--FRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
            + +S+ VA GP G  GG  W        ++ ++V+  G     + I       + DG ++
Sbjct  117  VRVSSVVAMGPCGGIGGAPWEMDLHGVGRVLKLVVRHG-----SAIDAMSVCYERDGREE  171

Query  201  TLTI--GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL--RSIKFTTNARE  368
              T   G GG  + +           DEYL  + G  G +   DN L  RS+ F TNAR 
Sbjct  172  QSTRWGGPGGRRSEICLQP-------DEYLAGVKGHVGHY---DNCLVVRSLTFVTNARR  221

Query  369  -FGTYGPNVGTPFNFQAQ-NGNKIVGFFGRSGYYIDAIGTYNAPD  497
             FG YG   G PF   A   G +I+GFFG SG Y+DAIGTY   D
Sbjct  222  SFGPYGKEEGVPFALPAAVAGGRIIGFFGSSGLYLDAIGTYVQMD  266



>ref|XP_011463712.1| PREDICTED: jacalin-related lectin 3-like [Fragaria vesca subsp. 
vesca]
Length=599

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +3

Query  222  GTETNVTHNDT-INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPN  389
            G++ N   +D  I +D  DE+L  +SG +        +  VLRS+KF TN R FG +G  
Sbjct  315  GSDLNKPLSDAEIKLDYPDEFLVSVSGYYCGVTWIVGAPVVLRSLKFETNKRTFGPFGVE  374

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  479
            VGTPF F+ ++G KIVGF GR+G+Y+DAIG
Sbjct  375  VGTPFTFRVKDGVKIVGFKGRNGWYLDAIG  404


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 75/154 (49%), Gaps = 14/154 (9%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            +  GP G NGG  W     N + +I + +G   ++    I     KN     +   GG G
Sbjct  15   IILGPWGGNGGNDWDDGLYNGVREITLVYGHCIDS----IVVVYDKNGKPATSEKHGGLG  70

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGT  398
            G  T       I +   DE+L  +SG +         V+RS+KF +N R FG +G   GT
Sbjct  71   GNRTA-----EIKLQYPDEFLVSVSGHYCPVVYGGSPVIRSLKFESNRRTFGPFGVEEGT  125

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIG--TYNAP  494
            PF F   +G KIVG  GR G+Y+DAIG   Y+AP
Sbjct  126  PFTFTV-DGGKIVGLKGRGGWYLDAIGFHVYHAP  158


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            I ++  +E++  ++G +G       +  VL S++F +N R FG +G  VGTPF F+ ++G
Sbjct  479  IKLEYPNEFIVSVTGHYGGVTWIVGAPVVLLSLRFESNRRTFGPFGVQVGTPFTFRVKDG  538

Query  426  NKIVGFFGRSGYYIDAIG--TYNAPD  497
            ++IVG  GR+G+Y+DAIG  T  AP+
Sbjct  539  DQIVGLKGRNGWYLDAIGFHTSRAPE  564



>gb|EEC72970.1| hypothetical protein OsI_06866 [Oryza sativa Indica Group]
Length=1072

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 75/150 (50%), Gaps = 14/150 (9%)
 Frame = +3

Query  54    GPLGHNGGGFWSFR--PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGG-G  224
             GP G NGG     +  PK ++  I I  G   +     + FS    DG + T ++ GG G
Sbjct  933   GPWGGNGGVTCDIKVAPK-RLESITICSGIIID----ALAFSYLDKDGERHTTSLWGGLG  987

Query  225   TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
                 +     I++D E E+L E+ GT G F      + S+   TN R +G +G   GTPF
Sbjct  988   GSVQL-----IDLD-EREFLMEVIGTVGPFNVLSEAITSLTLVTNVRSYGPFGQPQGTPF  1041

Query  405   NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                 +  + IVGFFGRSG Y+DA+G Y  P
Sbjct  1042  RTPRKKNSCIVGFFGRSGTYLDAVGVYFHP  1071



>dbj|BAD23250.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 dbj|BAD23344.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 gb|EAZ22703.1| hypothetical protein OsJ_06375 [Oryza sativa Japonica Group]
Length=1072

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 75/150 (50%), Gaps = 14/150 (9%)
 Frame = +3

Query  54    GPLGHNGGGFWSFR--PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGG-G  224
             GP G NGG     +  PK ++  I I  G   +     + FS    DG + T ++ GG G
Sbjct  933   GPWGGNGGVTCDIKVAPK-RLESITICSGIIID----ALAFSYLDKDGERHTTSLWGGLG  987

Query  225   TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
                 +     I++D E E+L E+ GT G F      + S+   TN R +G +G   GTPF
Sbjct  988   GSVQL-----IDLD-EREFLMEVIGTVGPFNVLSEAITSLTLVTNVRSYGPFGQPQGTPF  1041

Query  405   NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                 +  + IVGFFGRSG Y+DA+G Y  P
Sbjct  1042  RTPRKKNSCIVGFFGRSGTYLDAVGVYFHP  1071



>ref|XP_008804538.1| PREDICTED: uncharacterized protein LOC103717797 [Phoenix dactylifera]
Length=602

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 78/149 (52%), Gaps = 9/149 (6%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W       I Q+V+  G   ++  IRI +   K          G 
Sbjct  10   SPILVGPWGGEGGSPWDDGVYTTIRQVVVVHGAAIDS--IRIEYDK-KGSSVWSEKHGGN  66

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GGT+T     D + +D   E LT +SG FG+ +S   ++RS+ F +N  ++G +G   G 
Sbjct  67   GGTKT-----DKVKLDHPHEILTSVSGYFGSLSSGSPLIRSLTFESNQAKYGPFGFEQGM  121

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+F   +G KIVGF GRSG+Y+D+IG Y
Sbjct  122  RFSF-PMSGGKIVGFHGRSGWYLDSIGFY  149


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 63/128 (49%), Gaps = 12/128 (9%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I Q+ I++G   N+  I+I +  +   G     T  GG  ET  TH   I  D   E L 
Sbjct  464  IKQLYITWGEVINS--IQIEYDRS---GQSVWSTRHGGSGET--THR--IKFDYPHEVLN  514

Query  288  EISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             +SG +      +   V++S+ F T   ++G +G  VGT F      G K+VGF GRS  
Sbjct  515  CVSGYYATINRDERPTVIKSLTFCTTRGKYGPFGEEVGTHFTSATTKG-KVVGFHGRSAL  573

Query  462  YIDAIGTY  485
            Y+DAIG +
Sbjct  574  YLDAIGVH  581


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 69/149 (46%), Gaps = 12/149 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            ++YGP G +GG  +       + QI IS     N     I     KN  S      GG G
Sbjct  247  ISYGPWGGSGGTIFDDGIHTGVRQINISR----NAGITSIKVLYDKNGRSVWGNKHGGSG  302

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            G  T     D I  D   E LT I+G FG A       ++S+ F T  R++G +G   G 
Sbjct  303  GIRT-----DKIVFDFPFEILTYITGYFGTAMFMGPTAIKSLTFHTTKRKYGPFGDEQGM  357

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+    +   +VGF GRSG+YID+IG +
Sbjct  358  FFSSGLADA-MVVGFHGRSGWYIDSIGVH  385



>ref|XP_008244753.1| PREDICTED: agglutinin-like [Prunus mume]
Length=179

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            +  GP G NGG  W     N + +I + +G   ++    IT    +N       T GG G
Sbjct  14   IVVGPWGGNGGADWDDGVYNGVREITLVYGHCIDS----ITVVYDRNGKPVKAETHGGRG  69

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGT  398
            G +T       I +   DE+L  +SG +         ++RS+KF +N R FG YG   GT
Sbjct  70   GNQTA-----EIKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGT  124

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            PF F   +G KIVG  GR+G+Y+DAIG + +P
Sbjct  125  PFTFTV-DGGKIVGLKGRNGWYLDAIGFHVSP  155



>gb|ABS82785.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 81/160 (51%), Gaps = 15/160 (9%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSF-RPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
            + S+ T V  GP G NGG          ++  I +S G   ++    I FS     G K 
Sbjct  156  SQSLRTKV--GPWGGNGGSDKDIVEAPRRLESITVSSGTIIDS----IKFSYVDQAGQKR  209

Query  201  TL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFG  374
            T+   GG G + N        + G  E++ E+SGTFG +   + N++ S+KF TN + +G
Sbjct  210  TVGPWGGSGGKQNTF------VLGTSEFVREVSGTFGLYGRDNHNIITSLKFVTNVKTYG  263

Query  375  TYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G   GT F    Q  + IVGFFGRSG Y+DA+G Y  P
Sbjct  264  PFGQAKGTTFTIPVQKNSSIVGFFGRSGIYLDALGVYVHP  303



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 81/160 (51%), Gaps = 15/160 (9%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSF-RPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
            + S+ T V  GP G NGG          ++  I +S G   ++    I FS     G K 
Sbjct  156  SQSLRTKV--GPWGGNGGSDKDIVEAPRRLESITVSSGTIIDS----IKFSYVDQAGQKR  209

Query  201  TL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFG  374
            T+   GG G + N        + G  E++ E+SGTFG +   + N++ S+KF TN + +G
Sbjct  210  TVGPWGGSGGKQNTF------VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYG  263

Query  375  TYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G   GT F    Q  + IVGFFGRSG Y+DA+G Y  P
Sbjct  264  PFGQAKGTTFTIPVQKNSSIVGFFGRSGIYLDALGVYVHP  303



>ref|XP_007216928.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
 gb|EMJ18127.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
Length=351

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 80/160 (50%), Gaps = 13/160 (8%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDT  203
            + SI   +   P G NGG  W     N + +I I++    ++    IT    +ND     
Sbjct  178  SQSIQKTIVIEPWGGNGGADWDDGIYNGVREIKIAYCLCIDS----ITAVYDRNDKPVKA  233

Query  204  LTIGG-GGTETNVTHNDTINIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFG  374
             T GG GG +T       I +   DE+L  +SG +    F     ++RS+KF +N R FG
Sbjct  234  ETHGGRGGNQTA-----EIKLQYPDEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFG  288

Query  375  TYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             YG   GTPF F   +G KIVG  GR G+Y+DAIG + +P
Sbjct  289  PYGIEEGTPFTFTV-DGGKIVGLKGRDGWYLDAIGFHVSP  327


 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 77/153 (50%), Gaps = 13/153 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            +  GP G NGG  W     N + +I I++    ++    IT    +N       T GG G
Sbjct  30   IVIGPWGGNGGADWDDGIYNGVREIKIAYCLCIDS----ITVVYDRNGKPVKAETHGGRG  85

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVG  395
            G +T       I +   DE+L  +SG +    F     ++RS+KF +N R FG YG   G
Sbjct  86   GNQTA-----EIKLQYPDEHLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEG  140

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            TPF F   +G +IVG  GR G+Y+DAIG + +P
Sbjct  141  TPFTFTV-DGGQIVGLKGRDGWYLDAIGFHVSP  172



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYGPNVGTPFNFQAQ  419
            D I I   DEYLT ISGTFG    + N   V+RSI+F TNAR +G YG   GT F+   +
Sbjct  64   DQIQIAWPDEYLTSISGTFGRRWKNQNGHVVVRSIQFNTNARSYGPYGSTDGTAFSLPVK  123

Query  420  NGNKIVGFFGRSGYYIDAIGTY  485
             G KIVGF GR G  +D+IG Y
Sbjct  124  QG-KIVGFHGRCGADLDSIGVY  144



>ref|XP_002440040.1| hypothetical protein SORBIDRAFT_09g024950 [Sorghum bicolor]
 gb|EES18470.1| hypothetical protein SORBIDRAFT_09g024950 [Sorghum bicolor]
Length=594

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + I QIVI  G   ++  IRI +         +T     
Sbjct  10   SPIVVGPWGGTGGYPWDDGVYSTIRQIVIGHGAAIDS--IRIEYDLKGRSVWSETRGGTD  67

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N+  +G +G   GT
Sbjct  68   GGSET-----DKVKLDFPDEVLVSVSGHYGSVCGTPVIIRSLTFQSNSSTYGPFGTEDGT  122

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +  A      V+RS+ F TN R +G YG   GT F+    NG
Sbjct  306  DKIIFDFPSEVLTHITGFYDSAIIMGPTVVRSLTFHTNKRTYGPYGDEYGTYFSTSFTNG  365

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  366  -RIVGFHGREGWYIDGIGVH  384



>gb|EYU45162.1| hypothetical protein MIMGU_mgv1a025414mg, partial [Erythranthe 
guttata]
Length=333

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 81/158 (51%), Gaps = 8/158 (5%)
 Frame = +3

Query  21   STMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
            S M    +++ GP G  GG  +S++ K+ I QIV+       NN   I F       S+ 
Sbjct  2    SEMVCDGEISIGPFGGPGGTAFSYKAKHAIKQIVVVC---SKNNVESIMFKGDSGSTSEY  58

Query  201  TLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTY  380
            + T   GG   +    D INID   ++LT +SGT+G  +     ++S+KF T   E+G +
Sbjct  59   SKTF--GGAFNSGIRTDKINIDFPLDFLTGVSGTYG--SPGQMYMQSLKFHTKLTEYGPF  114

Query  381  GPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            G   GT F+F+   G+ I GF GR+G  ID IG Y  P
Sbjct  115  GNTTGTSFSFRPI-GSLITGFHGRAGGCIDCIGFYFKP  151


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 47/88 (53%), Gaps = 4/88 (5%)
 Frame = +3

Query  234  NVTHNDTINIDGEDEYLTEISGTFG---AFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
            ++     I++DG  EYL  I G  G         +V+RSI F TN  ++G  G  +GT F
Sbjct  244  DIVKKIEIDVDG-GEYLVGIEGFHGPIEGITGGVSVMRSITFHTNKFKYGPSGNEIGTFF  302

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYN  488
                    KIVGFFG+SG Y+ AIG +N
Sbjct  303  TSSKGCDGKIVGFFGKSGAYLSAIGVHN  330



>ref|XP_008348486.1| PREDICTED: agglutinin alpha chain-like [Malus domestica]
Length=189

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 80/152 (53%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            +  GP G NGG  W     N + +I + +G   ++    IT    KN       T GG G
Sbjct  21   MEVGPWGGNGGTPWDDGIYNGVREITVVYGHCIDS----ITVVYDKNGKPFIAETRGGRG  76

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GT+T       I +   DEY+  ++G +G        ++RS+KF +N R FG +G + GT
Sbjct  77   GTQTA-----EIKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGT  131

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            PF +   +G KIVG  GR+G+YIDAIG + +P
Sbjct  132  PFTYTL-DGGKIVGLKGRNGWYIDAIGFHVSP  162



>ref|NP_001140746.1| hypothetical protein [Zea mays]
 gb|ACF84532.1| unknown [Zea mays]
 gb|AFW78609.1| hypothetical protein ZEAMMB73_243066 [Zea mays]
Length=596

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + I QIVI  G   ++  IRI +         +T     
Sbjct  10   SPIVVGPWGGTGGYPWDDGVYSTIRQIVIGHGAAIDS--IRIEYDLKGRSVWSETHGGTD  67

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N+  +G +G   GT
Sbjct  68   GGSET-----DKVKLDFPDEVLVSVSGHYGSVCGTPVIIRSLTFQSNSSTYGPFGTEDGT  122

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +  A      V+RS+ F TN R +G YG   GT F+    NG
Sbjct  308  DKIIFDFPSEVLTHITGFYDSAIIMGPTVVRSLTFHTNKRTYGPYGDEYGTYFSTSFTNG  367

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  368  -RIVGFHGREGWYIDGIGVH  386



>ref|XP_006838705.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
 gb|ERN01274.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
Length=610

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 82/152 (54%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            V+ GP G  GG  W       + QIVI  GG  ++    + F   K   S  +   GG G
Sbjct  12   VSVGPWGGQGGSPWDDGVHTGVKQIVIVHGGAIDS----LRFEYDKKGQSVWSEKHGGNG  67

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGT  398
            G +T     D + ++  +E LT +SG +G  +S    ++RS+ F TN +++G +G   GT
Sbjct  68   GCKT-----DKVKLEYPEEVLTWLSGHYGPMSSGCPTIIRSLTFQTNLKKYGPFGVQQGT  122

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F+F   +G K+VGF GRSG+++D+IG +  P
Sbjct  123  HFSF-TMSGGKVVGFHGRSGWHLDSIGLHLKP  153


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D +  D   E LT I+G +GA F     V++S+ F T   ++G YG   G  F+ Q+  
Sbjct  311  SDKVVFDYPFEILTYITGNYGAAFLMGPMVIKSLTFHTTKGQYGPYGDQQGMSFSSQSVA  370

Query  423  GNKIVGFFGRSGYYIDAIGTYNAP  494
            G +IVGF GRSG+Y+DAIG +  P
Sbjct  371  G-RIVGFHGRSGWYLDAIGVHVFP  393


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 65/128 (51%), Gaps = 11/128 (9%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QIV+  G         I     +N  S  +   GG G ET  TH   I  +  +E LT
Sbjct  470  IKQIVLIRG----EAVCSIQIEYDRNGQSVWSARHGGRGGET--THR--IKFEYPNEVLT  521

Query  288  EISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             I+G +GA A  D   V++S+ F T+  ++G YG  +GT F      G K+VGF GRSG 
Sbjct  522  CITGYYGAVARDDRLEVIKSLTFCTSRGKYGPYGEELGTYFTSNRTEG-KVVGFHGRSGS  580

Query  462  YIDAIGTY  485
            Y+ AIG +
Sbjct  581  YLYAIGVH  588



>ref|XP_006654618.1| PREDICTED: myrosinase-binding protein-like At1g52040-like [Oryza 
brachyantha]
Length=605

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 84/158 (53%), Gaps = 13/158 (8%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTL-TIG  215
            + +  GP G  GG  W     + I Q++I+ G   ++  IRI +    N    +T  +  
Sbjct  10   SPIVVGPWGGTGGYPWDDGVYSNIRQVIITHGAAIDS--IRIEYDLKGNSVWSETHGSTD  67

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  395
            GGG+ET     D + +   DE+L  +SG +G+   +  ++RS+ F +N   +G +G   G
Sbjct  68   GGGSET-----DKVKLVFPDEFLVSVSGYYGSVCGTPVIIRSLTFQSNRSMYGPFGTEDG  122

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY----NAPD  497
            TPF+    +G KI+GF GRSG Y+++IG Y    + PD
Sbjct  123  TPFSLPVSSG-KIIGFHGRSGSYLNSIGFYLKQVHVPD  159


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +GA       V+RS+ F TN R +G YG   GT F+    +G
Sbjct  319  DKIVFDFPSEILTHITGYYGATMIMGPTVIRSLTFHTNKRRYGPYGDECGTYFSTSFTDG  378

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  379  -RIVGFHGREGWYIDGIGVH  397


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = +3

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GT  ++TH   I +D   E LT + G +          LRSI F +N  ++G +G   G 
Sbjct  499  GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRALRSITFISNRGKYGPFGEEFGA  556

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+  A+   K+VGF GRSG ++DAIG +
Sbjct  557  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  584



>gb|AFW60405.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 77/144 (53%), Gaps = 11/144 (8%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            +GP G +GG     R     ++ + IS G   ++    I FS T + G   T    GG  
Sbjct  160  FGPWGGDGGKTRDIRMTPCHLHSVTISSGTIIDS----IGFSFTDHYGQHHTTGPWGGKE  215

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
             TN      I + G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+
Sbjct  216  GTN-----KIEL-GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFH  269

Query  408  FQAQNGNKIVGFFGRSGYYIDAIG  479
             Q QN  +IVGFFGRSG Y+ AIG
Sbjct  270  IQTQNNGRIVGFFGRSGQYLYAIG  293


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  391  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  450

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  451  GRYLNAIGVYTAP  463



>ref|XP_004982894.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=151

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 69/133 (52%), Gaps = 12/133 (9%)
 Frame = +3

Query  102  NKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI--GGGGTETNVTHNDTINIDGED  275
            +++  +VI    R       I+F+    DG+   +    G GG E  V H     + G  
Sbjct  29   HRLQSVVI----RCQGAVDAISFTYAGVDGAPRMVGPWGGSGGQEHKVRH-----MFGAG  79

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E++ EISGT+G F     V+RS+ F TN  + G +G    TPF+   Q+G  +VGFFGRS
Sbjct  80   EFVKEISGTYGPFGG-HTVVRSLTFVTNIGKHGPFGTPWQTPFSVPVQDGAHVVGFFGRS  138

Query  456  GYYIDAIGTYNAP  494
            G  +DA+G Y  P
Sbjct  139  GSLLDAVGVYVHP  151



>gb|EMS55842.1| hypothetical protein TRIUR3_32339 [Triticum urartu]
Length=288

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 80/160 (50%), Gaps = 15/160 (9%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSF-RPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
            + S+ T V  GP G NGG           I  I +S G   ++    I FS     G K 
Sbjct  140  SQSLPTKV--GPWGGNGGSDKDIVEAPRCIESITVSSGTIIDS----IKFSYVDQAGQKR  193

Query  201  TL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFG  374
            T+   GG G + N        + G  E++ E+SGTFG +   + N++ S+KF TN + +G
Sbjct  194  TVGPWGGCGGKQNTF------VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNMKTYG  247

Query  375  TYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G   GT F    Q  + IVGFFGRSG Y+DA+G Y  P
Sbjct  248  PFGQAKGTTFTIPVQKNSSIVGFFGRSGIYLDALGVYVHP  287



>gb|AAA87041.1| putative 32.6 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72096.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +3

Query  261  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  437
            + G  E++ E+SGTFG +     N++ S+KF TN + +G +G   GTPF    Q  + IV
Sbjct  225  VLGASEFVKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIV  284

Query  438  GFFGRSGYYIDAIGTYNAP  494
            GFF RSG Y+DA+G Y  P
Sbjct  285  GFFARSGIYLDALGVYVRP  303



>gb|EMT24046.1| hypothetical protein F775_25349 [Aegilops tauschii]
Length=304

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 80/160 (50%), Gaps = 15/160 (9%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSF-RPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
            + S+ T V  GP G NGG           +  I +S G   ++    I FS     G K 
Sbjct  156  SQSLPTKV--GPWGGNGGSDKDIVEAPRHLESITVSSGTIIDS----IKFSYVDQAGQKC  209

Query  201  TL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFG  374
            T+   GG G + N        + G  E++ E+SGTFG +   + N++ S+KF TN + +G
Sbjct  210  TVGPWGGSGGKQNTF------VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYG  263

Query  375  TYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G   GT F    Q  + IVGFFGRSG Y+DA+G Y  P
Sbjct  264  PFGQAKGTTFTIPVQKNSSIVGFFGRSGIYLDALGVYVHP  303



>ref|XP_004961574.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=595

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 81/149 (54%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + I QIVI+ G   ++  IRI +         +T     
Sbjct  10   SPIVVGPWGGTGGYPWDDGVYSTIRQIVITHGAAIDS--IRIEYDLKGRSVWSETH----  63

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GGT+ + +  D + +D  DE L  +SG +G+   +  ++RS+ F +N+ ++G +G   GT
Sbjct  64   GGTDGS-SQADKVKLDFPDEALVSVSGHYGSVCGTPVIIRSLTFQSNSSKYGPFGTEDGT  122

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G    A      V+RS+ F TN R +G YG   GT F+    NG
Sbjct  307  DKIVFDFPSEVLTHITGFLDSAIIMGPTVVRSLTFHTNKRTYGPYGDESGTYFSTSFTNG  366

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  367  -RIVGFHGREGWYIDGIGVH  385


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = +3

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            G   ++TH   + +D   E LT + G +  +      VLRS+ F TN  ++G +G   G 
Sbjct  489  GNSGHITHR--VKLDYPHEVLTCVYGYYNTSREDGPRVLRSLTFVTNRGKYGPFGDEFGA  546

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+  A    K+VGF GRSG ++DAIG +
Sbjct  547  YFS-SAMTEGKVVGFHGRSGQHLDAIGVH  574



>gb|KHG26998.1| Agglutinin [Gossypium arboreum]
Length=600

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 82/159 (52%), Gaps = 12/159 (8%)
 Frame = +3

Query  21   STMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKD  200
            ST      V+ GP G  GG  W       I Q+VI+ G     + ++I +  TK +    
Sbjct  2    STEDDKKPVSVGPWGGQGGTSWDDGVYCTIRQLVIAHGS--GIDSVQIEYD-TKGNSLWS  58

Query  201  TLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGT  377
                G GG++T     D + +D  DE+LT I G +G+      ++ RS+ F +N + +G 
Sbjct  59   RKHGGNGGSKT-----DKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGP  113

Query  378  YGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +G   GT F+    N  KIVGF GRSG+Y+DAIG Y+ P
Sbjct  114  FGIEQGTSFSM---NKGKIVGFRGRSGWYLDAIGVYSKP  149


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 66/148 (45%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            + YGP G  GG  +       I QIV+S       N   ++     +   +       GG
Sbjct  245  LTYGPWGGQGGTKFDDGTYTGIRQIVLS------RNVGIVSLKVCYDREGQAVWGSKHGG  298

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
            T    T  + I  D   E LT I+GTF        NV+RS+ F TN  + G YG   G  
Sbjct  299  TGGFKT--ERIMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPS  356

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F  +   G KIVGF GR G ++DA+G +
Sbjct  357  FTNKMNEG-KIVGFLGREGLFLDAVGVH  383


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  428
            + +D   E L  ISG +G+    +   V+RS+ F T+  ++G +G  VGT F      G 
Sbjct  503  VKLDYPHEVLICISGYYGSINDEEKFKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQG-  561

Query  429  KIVGFFGRSGYYIDAIGTY  485
            K+VGF GR   Y+DAIG +
Sbjct  562  KVVGFHGRCSSYLDAIGVH  580



>gb|KJB58186.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1512

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 86/163 (53%), Gaps = 17/163 (10%)
 Frame = +3

Query  24    TMSISTD-----VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKND  188
             T+ +ST+     V+ GP G  GG  W       I Q+VI+ G     + ++I +  TK +
Sbjct  910   TLLLSTEDDKKPVSVGPWGGQGGTSWDDGVYCTIRQLVIAHGS--GIDSVQIEYD-TKGN  966

Query  189   GSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAR  365
                     G GG++T     D + +D  DE+LT I G +G+       ++RS+ F +N +
Sbjct  967   SLWSRKHGGNGGSKT-----DKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRK  1021

Query  366   EFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              +G +G   GT F+    N  KIVGF GRSG+Y+DAIG Y+ P
Sbjct  1022  AYGPFGIEQGTSFSM---NKGKIVGFRGRSGWYLDAIGVYSKP  1061


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 67/148 (45%), Gaps = 10/148 (7%)
 Frame = +3

Query  45    VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
             + YGP G  GG  +       I QIV+S      +  +          GSK     G GG
Sbjct  1157  LTYGPWGGQGGTKFDDGTYTGIRQIVLSRNVGIVSMKVCYDREGQAVWGSKHG---GTGG  1213

Query  225   TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
              +T     + I  D   E LT I+GTF        NV+RS+ F TN  + G YG   G  
Sbjct  1214  FKT-----ERIMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPS  1268

Query  402   FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F  +   G KIVGF GR G ++DA+G +
Sbjct  1269  FTNKMNEG-KIVGFLGREGLFLDAVGVH  1295


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +3

Query  255   INIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  428
             + +D   E L  ISG +G+    +   V+RS+ F T+  ++G +G  VGT F      G 
Sbjct  1415  VKLDYPHEVLICISGYYGSINEEEKSKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQG-  1473

Query  429   KIVGFFGRSGYYIDAIGTY  485
             K+VGF GR   Y+DAIG +
Sbjct  1474  KVVGFHGRCSSYLDAIGVH  1492



>gb|EAY80990.1| hypothetical protein OsI_36172 [Oryza sativa Indica Group]
Length=1081

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 69/148 (47%), Gaps = 27/148 (18%)
 Frame = +3

Query  114   QIVISFGGRGNNN------PIR--------------ITFSATKNDGSKDTLTIGGG-GTE  230
             Q V  +GG GN N      P R              I FS    +G + T  + GG G  
Sbjct  940   QRVGPWGGEGNRNHDIVVAPWRMECVKVSWGQVVDGIGFSYLDKNGKQHTTPLWGGVGGS  999

Query  231   TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNF  410
               + H D        E +TE+SGT G F+   +V+ S++  TN R +G +G   GT F  
Sbjct  1000  VRMIHLDP------SEIVTEVSGTCGPFSQFPSVVTSLQLVTNLRSYGPFGQAKGTKFRT  1053

Query  411   QAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             + +    IVGFFGRS  Y+DAIG Y  P
Sbjct  1054  RVKQNGSIVGFFGRSTIYLDAIGVYVRP  1081



>ref|XP_007146775.1| hypothetical protein PHAVU_006G068800g [Phaseolus vulgaris]
 gb|ESW18769.1| hypothetical protein PHAVU_006G068800g [Phaseolus vulgaris]
Length=589

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 78/147 (53%), Gaps = 10/147 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V+ GP G  GG  W     + + Q+VIS G     + I+I +   KN+ S  +L  GG G
Sbjct  8    VSVGPWGGRGGYLWDDGVYSTVRQLVISHGE--GIDSIQIEYD--KNERSIWSLKYGGSG  63

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                    D I +D  DE+LT I G FG+   S  + +RS+ F +N + +G +G   GT 
Sbjct  64   G----YKIDKIKLDYPDEFLTSIDGYFGSLTQSGPIYIRSLSFESNRKIYGPFGVEQGTY  119

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGT  482
            F+     G KIVGF GR G+++DAIG 
Sbjct  120  FSL-PMTGGKIVGFHGRYGWHVDAIGV  145


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 65/128 (51%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QI +     G  + I+I +   K    +   ++  GG   N  H   I ++  +E +T
Sbjct  450  IKQIYLKKAPEGICS-IQIEYDRYK----QSVWSVKHGGNGGNTMHR--IKLEYPNEVVT  502

Query  288  EISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             ISG +G+  +++   +++S+ F T+  ++G +G  VG  F      G K+VG  GRS  
Sbjct  503  CISGYYGSITANEQPTIIKSLTFHTSRGQYGPFGDEVGKYFTSTKTEG-KVVGLHGRSSM  561

Query  462  YIDAIGTY  485
            Y+DAIG +
Sbjct  562  YLDAIGVH  569


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            ++ I  D   E LT +SGT G+       V+RS+ F T  + +G +G   GT F    + 
Sbjct  294  HEKIIFDFPYEVLTHVSGTCGSLMYMGPAVIRSLTFHTTKKLYGPFGDAHGTRFTTNLRE  353

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G K+VGF GRSG ++D++G +
Sbjct  354  G-KVVGFHGRSGLFLDSLGVH  373



>ref|XP_003573652.1| PREDICTED: horcolin-like [Brachypodium distachyon]
Length=102

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFG--TYGP  386
            G GG E NV     I +D  D Y+T ISGTFG    +D V+ S+K +T   + G  TYG 
Sbjct  12   GPGGDEQNVQ----ITLDPTD-YVTGISGTFGTAFDNDRVVTSLKISTFKEKDGSKTYGK  66

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              GTPF+   ++G ++VGFFGRSG  +DAIG Y AP
Sbjct  67   PNGTPFHIPVRDGGRVVGFFGRSGDMLDAIGVYFAP  102



>ref|NP_001055995.1| Os05g0508400 [Oryza sativa Japonica Group]
 gb|AAT44259.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17909.1| Os05g0508400 [Oryza sativa Japonica Group]
Length=604

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 79/149 (53%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + + Q++I+ G   ++  IRI +    +    +T     
Sbjct  10   SPIVVGPWGGTGGYPWDDGVYSTVRQVIITHGAAIDS--IRIEYDLKGSSVWSETHGSTD  67

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N   +G +G   GT
Sbjct  68   GGSET-----DKVKLDFPDEILVSVSGYYGSVCGTPVIIRSLTFQSNRSIYGPFGTEDGT  122

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +G        V+RS+ F TN R +G YG   GT F+    +G
Sbjct  318  DKIVFDFPSEVLTHITGYYGTTMIMGPTVVRSLTFHTNKRRYGPYGDECGTYFSTSFSDG  377

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  378  -RIVGFHGREGWYIDGIGVH  396


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = +3

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GT  ++TH   I +D   E LT + G +         VLRSI F +N  ++G +G   G 
Sbjct  498  GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRVLRSITFISNRGKYGPFGEEFGA  555

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+  A+   K+VGF GRSG ++DAIG +
Sbjct  556  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  583



>ref|XP_010932970.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Elaeis 
guineensis]
Length=200

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 80/157 (51%), Gaps = 18/157 (11%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I + VA GP G +GG  WSF     I +I IS G   ++    ITF     + ++ +   
Sbjct  56   IQSPVAVGPWGGSGGTAWSFETAWTITKIKISVGDVVDS----ITFQYMDGETTRWSSRY  111

Query  213  GGGG---TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  383
            GG G   TE ++  N+          L  ISG +G +     V++S+ F T    +G YG
Sbjct  112  GGAGGKPTEIDLGTNNN---------LEAISGHYGNYYG-KTVIKSLTFVTTTGTYGPYG  161

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            P  GT F+   + G K+VGFFGR+G ++DA+G Y  P
Sbjct  162  PEEGTTFSLPVKAG-KVVGFFGRAGQWLDALGFYLKP  197



>ref|XP_002300741.2| hypothetical protein POPTR_0002s03180g [Populus trichocarpa]
 gb|EEE80014.2| hypothetical protein POPTR_0002s03180g [Populus trichocarpa]
Length=587

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 79/151 (52%), Gaps = 11/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            VA GP G   G  W     + + Q+VI+ G     + I++ +   K       +  G GG
Sbjct  11   VAVGPWGGQEGFLWDDGVHSTVKQLVIAHGA--GIDSIQVEYD-RKGTSVWSQIHGGNGG  67

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T      T+ +D  DE+LT + G +G+      V +RS+ F +N + +G +G   GT 
Sbjct  68   MKT------TVKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVEQGTY  121

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+F   +G KIVGF G+SG+Y+DAIG Y  P
Sbjct  122  FSF-PMSGGKIVGFHGKSGWYLDAIGIYLKP  151


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D   E LT ++GT+G       N++RS+ F TN  + G +G   G  F  +   
Sbjct  289  SDKIIFDYPYEILTRVTGTYGPLMYMGPNIIRSLTFYTNKGKHGPFGEEQGPTFTNKIDE  348

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KI+GF GR G+ +DAIG +
Sbjct  349  G-KIIGFHGREGFLLDAIGVH  368


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 6/100 (6%)
 Frame = +3

Query  195  KDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS---SDNVLRSIKFTTNAR  365
            +   +I  GG     TH   + +    E L  +SG +G   S   S  V++S+ F T+  
Sbjct  470  QSVWSIKHGGNGGTATHR--VKLQCPHEVLVCLSGYYGPIGSDGNSPKVIKSLTFHTSRG  527

Query  366  EFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             +G +G  +GT F      G K+VGF GRS  Y+DAIG +
Sbjct  528  NYGPFGEEIGTFFTSTTTEG-KVVGFHGRSSAYMDAIGVH  566



>ref|XP_004980504.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=128

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  434
            IN+ G  E++ E+SGT+G F+   NV+ S    TN   +G +G   GTPF+ +      I
Sbjct  47   INL-GPSEFVKEVSGTYGRFSHLPNVITSFTLVTNLCSYGPFGQPSGTPFHTRVDRTGSI  105

Query  435  VGFFGRSGYYIDAIGTYNAP  494
            VGFFGRSG Y+DAIG Y  P
Sbjct  106  VGFFGRSGKYLDAIGVYVRP  125



>gb|EAY98637.1| hypothetical protein OsI_20561 [Oryza sativa Indica Group]
Length=724

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 79/149 (53%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + + Q++I+ G   ++  IRI +    +    +T     
Sbjct  130  SPIVVGPWGGTGGYPWDDGVYSTVRQVIITHGAAIDS--IRIEYDLKGSSVWSETHGSTD  187

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N   +G +G   GT
Sbjct  188  GGSET-----DKVKLDFPDEILVSVSGYYGSVCGTPVIIRSLTFQSNRSIYGPFGTEDGT  242

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  243  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  270


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +G        V+RS+ F TN R +G YG   GT F+    +G
Sbjct  438  DKIVFDFPSEVLTHITGYYGTTMIMGPTVVRSLTFHTNKRRYGPYGDECGTYFSTSFSDG  497

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  498  -RIVGFHGREGWYIDGIGVH  516


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = +3

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GT  ++TH   I +D   E LT + G +         VLRSI F +N  ++G +G   G 
Sbjct  618  GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRVLRSITFISNRGKYGPFGEEFGA  675

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+  A+   K+VGF GRSG ++DAIG +
Sbjct  676  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  703



>ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula]
 gb|AES98655.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=604

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 84/163 (52%), Gaps = 11/163 (7%)
 Frame = +3

Query  3    LLFNYHSTM-SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSAT  179
            ++F   S++ SI    + GP G NGG  W     + + Q+V+  G     + I+I +   
Sbjct  1    MMFCMQSSVDSIKKPASVGPWGGNGGSRWDDGIYSGVRQLVVVHGT--GIDSIQIEY---  55

Query  180  KNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTT  356
             +       +   GGT  N T  D + +D  DE+LT + G +G+      N++RS+ F +
Sbjct  56   -DKKGSSIWSEKHGGTGGNKT--DKVKLDYPDEFLTSVHGYYGSLNQWGHNLVRSLSFES  112

Query  357  NAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            N + +G +G   GT F+     G KIVGF GR G+Y+DAIG Y
Sbjct  113  NKKTYGPFGVEQGTYFSV-PMTGAKIVGFHGRCGWYLDAIGVY  154


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QI ++   + ++    I     +N  S  ++  GG G +T       I ++   E LT
Sbjct  466  IKQIYLT---KVSDGICSIQIEYDRNRQSVWSIKHGGNGGDTM----HRIQLEFPHEVLT  518

Query  288  EISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             ISG +G+    +   V++S+ F T+  ++G YG  VG  F      G K+VGF GRS  
Sbjct  519  CISGYYGSITKDEKHTVIKSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-KVVGFHGRSSL  577

Query  462  YIDAIGTY  485
            Y+DAIG +
Sbjct  578  YLDAIGIH  585


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D   E LT ISG  G        V+RS+ F T  R++G +G   GT F  + + 
Sbjct  308  SDKIVFDFPYEVLTYISGYHGPLMYMGPAVIRSLTFHTTKRKYGPFGEEQGTYFTTKVKE  367

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KIVG  GR G ++DA G +
Sbjct  368  G-KIVGIHGRKGLFLDAFGVH  387



>gb|EEE64302.1| hypothetical protein OsJ_19139 [Oryza sativa Japonica Group]
Length=1105

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 79/149 (53%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + + Q++I+ G   ++  IRI +    +    +T     
Sbjct  511  SPIVVGPWGGTGGYPWDDGVYSTVRQVIITHGAAIDS--IRIEYDLKGSSVWSETHGSTD  568

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N   +G +G   GT
Sbjct  569  GGSET-----DKVKLDFPDEILVSVSGYYGSVCGTPVIIRSLTFQSNRSIYGPFGTEDGT  623

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  624  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  651


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +G        V+RS+ F TN R +G YG   GT F+    +G
Sbjct  819  DKIVFDFPSEVLTHITGYYGTTMIMGPTVVRSLTFHTNKRRYGPYGDECGTYFSTSFSDG  878

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  879  -RIVGFHGREGWYIDGIGVH  897


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = +3

Query  222   GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  398
             GT  ++TH   I +D   E LT + G +         VLRSI F +N  ++G +G   G 
Sbjct  999   GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRVLRSITFISNRGKYGPFGEEFGA  1056

Query  399   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              F+  A+   K+VGF GRSG ++DAIG +
Sbjct  1057  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  1084



>gb|EYU45163.1| hypothetical protein MIMGU_mgv1a020491mg, partial [Erythranthe 
guttata]
Length=269

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 91/176 (52%), Gaps = 27/176 (15%)
 Frame = +3

Query  18   HSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPI-RITF------SA  176
             S M    +++ GP G  GG  +S++ K+ I QIVI      NNN I  I F      SA
Sbjct  1    ESEMVCDGEISIGPFGGPGGTAFSYKAKHAIKQIVI----ISNNNYIDSILFKGDAADSA  56

Query  177  TKNDGSKDTLTIGGG---GTETNVTHNDT-------INIDGEDEYLTEISGTFGAFASSD  326
            T +D SK   T GGG   GT T+    D        I+ID   ++LT +SGT+G  +   
Sbjct  57   TTSDYSK---TFGGGFKTGTRTDKISIDFPSDFLTGIDIDFPSDFLTGVSGTYG--SPGQ  111

Query  327  NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
              ++S+KF T   E+G +G   GT F+F  + G+ I GF GR+   ID+IG Y  P
Sbjct  112  FYIKSLKFYTKLTEYGPFGYATGTSFSFHPK-GSLITGFHGRADGCIDSIGFYFKP  166


 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 69/159 (43%), Gaps = 29/159 (18%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFRPKNKINQIVISFGGRGNN---------NPIRITFSATKNDGSKDT  203
            YGP G+  G  +SF PK     ++  F GR +           P+   F       S + 
Sbjct  126  YGPFGYATGTSFSFHPKG---SLITGFHGRADGCIDSIGFYFKPLSSVFVPIPKKESSEL  182

Query  204  LTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFG---AFASSDNVLRSIKFTTNAREFG  374
            +TI              I++DG  EYL  I G  G         +V+RSI F TN  ++G
Sbjct  183  ITI-------------EIDVDG-GEYLVGIEGFHGPIEGITGDISVMRSITFHTNKFKYG  228

Query  375  TYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNA  491
              G  +G  F        KIVGFFG+SG Y+ AIG +N 
Sbjct  229  PLGSEIGKFFTSSKGCDGKIVGFFGKSGAYLSAIGVHNV  267



>ref|XP_010932961.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Elaeis 
guineensis]
Length=292

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 80/157 (51%), Gaps = 18/157 (11%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            I + VA GP G +GG  WSF     I +I IS G   ++    ITF     + ++ +   
Sbjct  148  IQSPVAVGPWGGSGGTAWSFETAWTITKIKISVGDVVDS----ITFQYMDGETTRWSSRY  203

Query  213  GGGG---TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  383
            GG G   TE ++  N+          L  ISG +G +     V++S+ F T    +G YG
Sbjct  204  GGAGGKPTEIDLGTNNN---------LEAISGHYGNYYG-KTVIKSLTFVTTTGTYGPYG  253

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            P  GT F+   + G K+VGFFGR+G ++DA+G Y  P
Sbjct  254  PEEGTTFSLPVKAG-KVVGFFGRAGQWLDALGFYLKP  289


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 69/145 (48%), Gaps = 14/145 (10%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTE  230
            GP G +GG  WSF     I +I IS G   ++    +TF       ++ +   GG GG  
Sbjct  12   GPWGGSGGSAWSFENALAITKIKISVGDVIDS----LTFQYMDGTTARWSPRYGGTGGQP  67

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNF  410
            T +         G  E++  I G +G +     ++ S+ F T  RE+G YG   GT F F
Sbjct  68   TEIEL-------GPAEFIISIKGYYGPYVR-KTMIYSLTFVTTIREYGPYGQEKGTQF-F  118

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              +    I GFFGRSG  +DAIG Y
Sbjct  119  VPKGTGLISGFFGRSGDQLDAIGVY  143



>ref|NP_001052399.1| Os04g0295400 [Oryza sativa Japonica Group]
 emb|CAD40444.2| OSJNBa0041M21.2 [Oryza sativa Japonica Group]
 dbj|BAF14313.1| Os04g0295400 [Oryza sativa Japonica Group]
Length=150

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 10/147 (7%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTE  230
            +GP G  GG    +R        ++    R  +    I+F+   NDG      +G  G++
Sbjct  8    FGPWGGPGG---DYRDVQVAPYRLVRLTIRSGDTVDGISFTYIGNDGL--VYHMGHWGSD  62

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYG-PNVGTPF  404
              V H   +   G  +++ EISGT G + S   NVLRS+K TT  R +G YG P  G PF
Sbjct  63   GGVPHEIHL---GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPF  119

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +F     ++I GFF R+G+  DAIG Y
Sbjct  120  SFSVDGSDRITGFFVRAGFITDAIGVY  146



>emb|CDP17400.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 75/150 (50%), Gaps = 10/150 (7%)
 Frame = +3

Query  48   AYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            + GP G   G  WS+ P + I +I++  G     N   I+F+    D +       GG  
Sbjct  175  SLGPWGGPVGNPWSYIPTDGIKEIIMDVG----RNIRAISFA----DANGFISGKFGGKD  226

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNVGTPF  404
              N+   + I I    EYLT I GTFG F + D V+ S+ F TN + +G +G  N G  F
Sbjct  227  PNNIGKEEKITIQWPSEYLTSIKGTFGNF-NGDVVIYSLSFITNNKTYGPFGSANSGQAF  285

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                  GN +VGF G SG++IDA+G Y  P
Sbjct  286  TASPPAGNVVVGFHGMSGWFIDALGIYVRP  315


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNV  392
            GG    N+   + I I    EYLT I+GT+G F +   V+ S+ F TN + +G +G P+ 
Sbjct  79   GGNNPNNIGKEEKITIQWPSEYLTSITGTYGDF-NGLLVIYSLSFVTNQKAYGPFGSPSS  137

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            G  F+    +GN IVGF GRSG+YIDAIG Y  P
Sbjct  138  GQAFS-SPPDGNVIVGFHGRSGWYIDAIGIYVQP  170



>ref|XP_008348484.1| PREDICTED: agglutinin-like isoform X2 [Malus domestica]
Length=174

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 77/151 (51%), Gaps = 14/151 (9%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGS-KDTLTIGGGGTE  230
            GP G NGG  W     N + +I + +G   ++    IT    KN    K  +  G GGT+
Sbjct  4    GPWGGNGGTPWDDGIYNGVREITLVYGECIDS----ITVVYDKNGKPFKAEMHGGHGGTQ  59

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFASS---DNVLRSIKFTTNAREFGTYGPNVGTP  401
            T       I +   DEY+  ++G +     +     ++RS+KF +N R FG +G + GTP
Sbjct  60   TA-----EIKLLYPDEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQGTP  114

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F +   +G KIVG  GR G YIDAIG + +P
Sbjct  115  FTYTL-DGGKIVGLKGRDGLYIDAIGFHVSP  144



>ref|XP_008806712.1| PREDICTED: agglutinin-like isoform X2 [Phoenix dactylifera]
Length=197

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 77/154 (50%), Gaps = 10/154 (6%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIG  215
            S  V  GP G +GG  W     + + +I + +      + IR+ +    +   K  L   
Sbjct  8    SKTVKVGPWGGHGGSPWDDGSYSGVREIYLVY--DRCIDSIRVLY----DKNGKPVLAEK  61

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNV  392
             GG   N+T    + +   +E+LT +SG +       + V+RS+ F +N R FG +G   
Sbjct  62   HGGVGGNLTVQ--VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEE  119

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            GTPF F   +G  IVGF GRSG+Y+DAIG   +P
Sbjct  120  GTPFTF-PMDGGMIVGFSGRSGWYLDAIGLCVSP  152



>ref|XP_008806706.1| PREDICTED: agglutinin-like isoform X1 [Phoenix dactylifera]
Length=200

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 77/154 (50%), Gaps = 10/154 (6%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIG  215
            S  V  GP G +GG  W     + + +I + +      + IR+ +    +   K  L   
Sbjct  11   SKTVKVGPWGGHGGSPWDDGSYSGVREIYLVY--DRCIDSIRVLY----DKNGKPVLAEK  64

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNV  392
             GG   N+T    + +   +E+LT +SG +       + V+RS+ F +N R FG +G   
Sbjct  65   HGGVGGNLTVQ--VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEE  122

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            GTPF F   +G  IVGF GRSG+Y+DAIG   +P
Sbjct  123  GTPFTF-PMDGGMIVGFSGRSGWYLDAIGLCVSP  155



>ref|XP_008391447.1| PREDICTED: uncharacterized protein LOC103453663 [Malus domestica]
Length=353

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 78/149 (52%), Gaps = 12/149 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTE  230
            GP G NGG  W     N + +I + +G   ++    IT    KN       T GG GGT+
Sbjct  181  GPWGGNGGIPWDDGIYNGVREITVVYGHCIDS----ITLVYDKNGKPVKANTHGGRGGTQ  236

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
            T       I ++  DEYL  ++G +   A     ++RS+KF +N R FG +G   GT F 
Sbjct  237  TA-----EIKLEYPDEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIEEGTTFT  291

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +  + G KIVG  GR+G+YIDAIG + +P
Sbjct  292  YNVEGG-KIVGLKGRNGWYIDAIGFHVSP  319



>ref|XP_009367509.1| PREDICTED: agglutinin alpha chain [Pyrus x bretschneideri]
Length=189

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 78/152 (51%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            +  GP G NGG  W     N + +I + +G   ++    IT    KN       T GG G
Sbjct  21   MEVGPWGGNGGTPWDDGIYNGVREITLVYGHCIDS----ITVVYDKNGKPFKAETRGGRG  76

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGT  398
            G +T       I +   DEY+  ++G +G        ++RS+KF +N R FG +G + GT
Sbjct  77   GNQTA-----EIKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGT  131

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            PF +     +KIVG  GR+G+YIDAIG + +P
Sbjct  132  PFTYTLDR-SKIVGLKGRNGWYIDAIGFHVSP  162



>gb|EMT07650.1| Horcolin [Aegilops tauschii]
Length=320

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +3

Query  270  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  449
            +DEYLT + G +G F  +  V+RS+   +N R +G+YG   G PF   A  G KI+GF  
Sbjct  244  QDEYLTSVHGHYGQFKDT-VVIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGFHA  302

Query  450  RSGYYIDAIGTY  485
            RSG ++DAIGTY
Sbjct  303  RSGQFLDAIGTY  314



>ref|XP_008348483.1| PREDICTED: agglutinin-like isoform X1 [Malus domestica]
Length=194

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 78/154 (51%), Gaps = 14/154 (9%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGS-KDTLTIGGG  221
            +  GP G NGG  W     N + +I + +G   ++    IT    KN    K  +  G G
Sbjct  21   MEVGPWGGNGGTPWDDGIYNGVREITLVYGECIDS----ITVVYDKNGKPFKAEMHGGHG  76

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASS---DNVLRSIKFTTNAREFGTYGPNV  392
            GT+T       I +   DEY+  ++G +     +     ++RS+KF +N R FG +G + 
Sbjct  77   GTQTA-----EIKLLYPDEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQ  131

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            GTPF +   +G KIVG  GR G YIDAIG + +P
Sbjct  132  GTPFTYTL-DGGKIVGLKGRDGLYIDAIGFHVSP  164



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 51/132 (39%), Positives = 71/132 (54%), Gaps = 13/132 (10%)
 Frame = +3

Query  99   KNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTETNVTHNDTINIDGED  275
            K+ I  I+I+ G   ++    I F +    G+  D+   GG G        D + I+   
Sbjct  3    KSPIKDILIAHGDVIDS----IMFKSITEQGTTIDSPKFGGDGGR-----RDKVVIEATP  53

Query  276  -EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFG  449
             EYLT I GTFG F    +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF G
Sbjct  54   LEYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  112

Query  450  RSGYYIDAIGTY  485
            RSG Y+DAIG Y
Sbjct  113  RSGLYLDAIGVY  124



>ref|XP_006663456.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=1102

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 42/112 (38%), Positives = 57/112 (51%), Gaps = 7/112 (6%)
 Frame = +3

Query  162   ITFSATKNDGSKDTLTI-GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLR  338
             I FS     G + T  + GG G    + H          E++ E+SGT+G F S  +V+ 
Sbjct  997   IGFSYLDKSGKQHTTPLWGGAGGTVRMVHL------APSEFVKEVSGTYGPFFSFPSVIT  1050

Query  339   SIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             S++  TN R +G +G   GT F  + +    IVGFFG S  YIDAIG Y  P
Sbjct  1051  SLQLRTNIRSYGPFGEPKGTTFRTRVKQNGSIVGFFGHSTVYIDAIGVYIHP  1102



>gb|ADV38315.1| mannose/glucose-specific lectin [Litchi chinensis]
Length=155

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 78/158 (49%), Gaps = 14/158 (9%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPK-NKINQIVISF-GGRGNNNPIRITFSATKNDGSKDTLT  209
            S  +  GP G NGG  WS+ P  + I  + + F  GR     I I F +T       T +
Sbjct  3    SNSIKLGPWGGNGGSSWSYNPSGSVITGVFVRFSAGR----LISIYFKSTNVSSGTSTYS  58

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
               GG ++N      + +D  +EY T ISGT    A + N L +++  T     GT  PN
Sbjct  59   DKFGGYDSNTADYTEVLVDWPEEYFTSISGT----AVTSNGLETVQSLTFHTTKGTRSPN  114

Query  390  ---VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                GTPF+   + G +IVGFFGR+G Y+DAIG    P
Sbjct  115  GNTNGTPFSIPME-GAQIVGFFGRAGEYVDAIGINVVP  151



>gb|EMT33809.1| hypothetical protein F775_16156 [Aegilops tauschii]
Length=177

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 11/155 (7%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKN--KINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            T V YGP G NGG     R  +  ++  + I +G   ++    +TFS + + G    +  
Sbjct  12   TFVTYGPWGGNGGTAHDIRAASSLRLKSVTIPYGDIIDS----LTFSYSDHSGHVHRVGP  67

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPN  389
             GG   T   +  TIN+D  D ++ EISG FG +  S  NV+ S+K  T+   +G +G  
Sbjct  68   WGG---TGGANKYTINLDPTD-FVKEISGKFGPYPLSRSNVITSLKLVTHEDTYGPFGFV  123

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             GTPF    ++G  IVGFF R+  Y+  IG Y  P
Sbjct  124  EGTPFCATLESGWAIVGFFARAERYVHKIGVYARP  158



>ref|XP_008677993.1| PREDICTED: mannose/glucose-specific lectin-like isoform X5 [Zea 
mays]
Length=703

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  460  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  519

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  520  GRYLNAIGVYTAP  532



>ref|XP_008677995.1| PREDICTED: mannose/glucose-specific lectin-like isoform X7 [Zea 
mays]
Length=680

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  437  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  496

Query  456  GYYIDAIGTYNAP  494
            G Y++AIG Y AP
Sbjct  497  GRYLNAIGVYTAP  509



>ref|XP_004979669.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Setaria 
italica]
Length=844

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 80/156 (51%), Gaps = 22/156 (14%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFRPKN------KINQIVISFGGRGNNNPIRITFSATKNDGSKDTL-T  209
            +GP G  GG     +P++      +++ + IS G   ++    I FS T +DG   T+  
Sbjct  335  FGPWGGAGG-----KPRDVKIAPYRLDSVTISSGVVIDS----IQFSYTDHDGQYHTIGP  385

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
             GG G  TN  H       G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G  
Sbjct  386  WGGFGGNTNSFHL------GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRA  439

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             G PF+ Q Q+   IVGFFG S  Y++AIG Y   D
Sbjct  440  RGRPFHIQVQSHGCIVGFFGHSRRYLEAIGFYTDQD  475


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 81/146 (55%), Gaps = 10/146 (7%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            +GP G +GG     + P  +++ I IS G   ++    I FS T +DG   T    GG  
Sbjct  549  FGPWGGDGGESKDIKIPPYRLDSITISSGVIIDS----IDFSYTDHDGLYHTTGPWGG--  602

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
              +  +N+T  + G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G   G  F+
Sbjct  603  --HGGNNNTFKL-GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFH  659

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               ++   IVGFFGR+G Y+DAIG Y
Sbjct  660  IPMESNGCIVGFFGRAGRYLDAIGVY  685


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  452
            E++ ++SGTF A+    NVL S+   TN  R +G YG   GT F+   Q+ ++IVGFF  
Sbjct  770  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  829

Query  453  SGYYIDAIGTY  485
               YI+AIG Y
Sbjct  830  GEDYIEAIGAY  840



>ref|XP_004979671.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Setaria 
italica]
Length=793

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 80/156 (51%), Gaps = 22/156 (14%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFRPKN------KINQIVISFGGRGNNNPIRITFSATKNDGSKDTL-T  209
            +GP G  GG     +P++      +++ + IS G   ++    I FS T +DG   T+  
Sbjct  284  FGPWGGAGG-----KPRDVKIAPYRLDSVTISSGVVIDS----IQFSYTDHDGQYHTIGP  334

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
             GG G  TN  H       G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G  
Sbjct  335  WGGFGGNTNSFHL------GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRA  388

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             G PF+ Q Q+   IVGFFG S  Y++AIG Y   D
Sbjct  389  RGRPFHIQVQSHGCIVGFFGHSRRYLEAIGFYTDQD  424


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 81/146 (55%), Gaps = 10/146 (7%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            +GP G +GG     + P  +++ I IS G   ++    I FS T +DG   T    GG  
Sbjct  498  FGPWGGDGGESKDIKIPPYRLDSITISSGVIIDS----IDFSYTDHDGLYHTTGPWGG--  551

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
              +  +N+T  + G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G   G  F+
Sbjct  552  --HGGNNNTFKL-GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFH  608

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               ++   IVGFFGR+G Y+DAIG Y
Sbjct  609  IPMESNGCIVGFFGRAGRYLDAIGVY  634


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  452
            E++ ++SGTF A+    NVL S+   TN  R +G YG   GT F+   Q+ ++IVGFF  
Sbjct  719  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  778

Query  453  SGYYIDAIGTY  485
               YI+AIG Y
Sbjct  779  GEDYIEAIGAY  789



>ref|XP_009336846.1| PREDICTED: uncharacterized protein LOC103929382 [Pyrus x bretschneideri]
Length=558

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 79/152 (52%), Gaps = 10/152 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G + G  W  R ++ + Q+VI+ G   ++  I+I +    +    D    G GG
Sbjct  11   ISVGPWGGHNGLIWDDRVRSTVKQLVIAHGAAIDS--IQIEYDERGSSVWSDKHG-GNGG  67

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T     D + +   +E+LT I G +G  +    + +RS+ F +N R +G +G   GT 
Sbjct  68   WKT-----DKVKLASPEEFLTSIEGYYGKISEWGPITVRSLTFKSNKRTYGPFGVEQGTY  122

Query  402  FNFQAQNGN-KIVGFFGRSGYYIDAIGTYNAP  494
            F+ Q    N KIVGF G SG Y+D+IG Y  P
Sbjct  123  FSLQETASNIKIVGFHGMSGRYLDSIGAYVKP  154


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D  +E LT I+GTF       N V++S+ F T  ++ G YG   G  F  + + 
Sbjct  310  SDKIVFDYPNEILTHITGTFAPTKVMGNSVIKSLTFHTTKKQHGPYGEEQGACFTTKLKE  369

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G  IVG  GRSG ++DA+G +
Sbjct  370  G-IIVGIHGRSGLFLDALGVH  389



>ref|XP_004297619.2| PREDICTED: agglutinin [Fragaria vesca subsp. vesca]
Length=525

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            I ++  DE+L  ISG +        +  VLRS+KF +N R FG +G   GTPF F+ ++ 
Sbjct  295  IKLECPDEFLVSISGYYCGVTWIVGAPVVLRSLKFESNKRTFGPFGNQFGTPFTFKVKDS  354

Query  426  NKIVGFFGRSGYYIDAIGTYNAP  494
            ++IVGF GR G Y+DAIG ++ P
Sbjct  355  DRIVGFKGRKGRYLDAIGFHSKP  377


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 13/153 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V YG  G  GG  W     + I +I + +G       I         DG        GG 
Sbjct  379  VLYG--GMTGGRPWDDGIFDGIREITLVYG-----QCIDSMCVVYDKDGLPAISERHGGA  431

Query  225  TETNVTHN--DTINIDGE--DEYLTEISG--TFGAFASSDNVLRSIKFTTNAREFGTYGP  386
                  H   DT+ +  E  +E++  +SG  ++  + S   V+RS+KF +N R +G +G 
Sbjct  432  ERGRDLHKPLDTVQVKLEYPNEFMVTVSGHISWVPWMSGTRVVRSLKFDSNRRTYGPFGV  491

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             VGTPF+F+ ++G++IVG  GRSG+Y+ AIG Y
Sbjct  492  QVGTPFSFRVKDGDQIVGLRGRSGWYLYAIGFY  524



>ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128794 isoform X2 [Populus 
euphratica]
Length=1277

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 78/151 (52%), Gaps = 11/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            VA GP G   G  W     + + Q+VI+ G     + I++ +   K       +  G GG
Sbjct  645  VAVGPWGGQEGFLWDDGVHSTVKQLVIAHGA--GIDSIQVEYD-RKGTSVWSQIHGGNGG  701

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T      T+ +D  DE+LT + G +G+      V +RS+ F +N + +G +G   GT 
Sbjct  702  MKT------TVKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVEQGTY  755

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+    +G KIVGF G+SG+Y+DAIG Y  P
Sbjct  756  FSL-PMSGGKIVGFHGKSGWYLDAIGIYLKP  785


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +3

Query  213   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYG  383
             G GGT T+      + +    E L  +SG +G   S  N   V++S+ F T    +G +G
Sbjct  1169  GNGGTATH-----RVKLQCPHEVLVCLSGYYGPIGSDGNGPKVIKSLTFHTTRGNYGPFG  1223

Query  384   PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
               +GT F   A  G K+VGF GRS  Y+DAIG +
Sbjct  1224  EEIGTFFTSTATEG-KVVGFHGRSSAYMDAIGVH  1256


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246   NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
             +D I  D   E LT ++GT+G       N+++S+ F TN  + G +G   G  F  +   
Sbjct  979   SDKIIFDYPYEILTRVTGTYGPLMYMGPNIIKSLTFYTNKGKHGPFGEEQGPTFTNKIDE  1038

Query  423   GNKIVGFFGRSGYYIDAIGTY  485
             G KI+GF GR G+ +DAIG +
Sbjct  1039  G-KIIGFHGREGFLLDAIGLH  1058



>ref|XP_011028923.1| PREDICTED: jacalin-related lectin 3-like isoform X1 [Populus 
euphratica]
Length=643

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 78/151 (52%), Gaps = 11/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            VA GP G   G  W     + + Q+VI+ G     + I++ +   K       +  G GG
Sbjct  11   VAVGPWGGQEGFLWDDGVHSTVKQLVIAHGA--GIDSIQVEYD-RKGTSVWSQIHGGNGG  67

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T      T+ +D  DE+LT + G +G+      V +RS+ F +N + +G +G   GT 
Sbjct  68   MKT------TVKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVEQGTY  121

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+    +G KIVGF G+SG+Y+DAIG Y  P
Sbjct  122  FSL-PMSGGKIVGFHGKSGWYLDAIGIYLKP  151


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYG  383
            G GGT T+      + +    E L  +SG +G   S  N   V++S+ F T    +G +G
Sbjct  535  GNGGTATH-----RVKLQCPHEVLVCLSGYYGPIGSDGNGPKVIKSLTFHTTRGNYGPFG  589

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              +GT F   A  G K+VGF GRS  Y+DAIG +
Sbjct  590  EEIGTFFTSTATEG-KVVGFHGRSSAYMDAIGVH  622


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D   E LT ++GT+G       N+++S+ F TN  + G +G   G  F  +   
Sbjct  345  SDKIIFDYPYEILTRVTGTYGPLMYMGPNIIKSLTFYTNKGKHGPFGEEQGPTFTNKIDE  404

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KI+GF GR G+ +DAIG +
Sbjct  405  G-KIIGFHGREGFLLDAIGLH  424



>ref|XP_004979670.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Setaria 
italica]
Length=823

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 80/156 (51%), Gaps = 22/156 (14%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFRPKN------KINQIVISFGGRGNNNPIRITFSATKNDGSKDTL-T  209
            +GP G  GG     +P++      +++ + IS G   ++    I FS T +DG   T+  
Sbjct  335  FGPWGGAGG-----KPRDVKIAPYRLDSVTISSGVVIDS----IQFSYTDHDGQYHTIGP  385

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
             GG G  TN  H       G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G  
Sbjct  386  WGGFGGNTNSFHL------GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRA  439

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             G PF+ Q Q+   IVGFFG S  Y++AIG Y   D
Sbjct  440  RGRPFHIQVQSHGCIVGFFGHSRRYLEAIGFYTDQD  475


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 81/146 (55%), Gaps = 10/146 (7%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            +GP G +GG     + P  +++ I IS G   ++    I FS T +DG   T    GG  
Sbjct  528  FGPWGGDGGESKDIKIPPYRLDSITISSGVIIDS----IDFSYTDHDGLYHTTGPWGG--  581

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
              +  +N+T  + G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G   G  F+
Sbjct  582  --HGGNNNTFKL-GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFH  638

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               ++   IVGFFGR+G Y+DAIG Y
Sbjct  639  IPMESNGCIVGFFGRAGRYLDAIGVY  664


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  452
            E++ ++SGTF A+    NVL S+   TN  R +G YG   GT F+   Q+ ++IVGFF  
Sbjct  749  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  808

Query  453  SGYYIDAIGTY  485
               YI+AIG Y
Sbjct  809  GEDYIEAIGAY  819



>ref|XP_004984089.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=151

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = +3

Query  162  ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRS  341
            I+F+    DG+  T    GG  +     ++ I +D   EY+TE++GT G    + + + S
Sbjct  42   ISFTYRDGDGNLHTAGPWGGAAKGQGEGDENITLDAS-EYVTEVAGTIGPIGDAPHTISS  100

Query  342  IKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +KF TN   +G +G   GTPFN    N + +V  F R+G Y+DAIG Y  P
Sbjct  101  LKFVTNRATYGPFGRGAGTPFNVPLDNAS-VVAMFARAGDYLDAIGFYVLP  150



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +3

Query  270  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  449
            +DEYLT + G +G F     V+RS+ F +N R +G YG   G PF   A  G KI+GF  
Sbjct  256  QDEYLTSVHGHYGQFKDF-VVIRSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGFHA  314

Query  450  RSGYYIDAIGTYNAPD  497
            RSG ++DAIGTY   D
Sbjct  315  RSGQFLDAIGTYVKMD  330



>gb|EYU45843.1| hypothetical protein MIMGU_mgv1a014002mg [Erythranthe guttata]
Length=204

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 74/146 (51%), Gaps = 10/146 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G NGG  W     N + +I + +G   ++  IRI +   KND        GG G
Sbjct  16   IVVGPWGGNGGTNWDDGSYNGVREITVMYGRCIDS--IRIVYD--KNDKPVSGDKHGGAG  71

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTP  401
                 T    I +   DE LT ++G +       + V+RS+ F TN R FG +G   GTP
Sbjct  72   G----TKIAEIKLQFPDEILTTVTGYYSPVVHGGSPVIRSLTFKTNRRTFGPFGVEEGTP  127

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIG  479
            F+   + G +IVGF GR G+Y+DAIG
Sbjct  128  FSLPMEGG-QIVGFKGRGGWYLDAIG  152



>ref|XP_008804539.1| PREDICTED: mannose/glucose-specific lectin-like [Phoenix dactylifera]
Length=149

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 77/151 (51%), Gaps = 14/151 (9%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            +A GP G +GG  WSF+    I +I IS G   ++    ITF     +  + + T GG G
Sbjct  9    IALGPWGGSGGTAWSFQNARAITKIKISSGDVVDS----ITFQYIDGELVRWSPTYGGTG  64

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTP  401
            G  T +         G D YLT ISG +G +     V++S+ F +    +G +G   GT 
Sbjct  65   GKSTEIDL-------GTDSYLTAISGHYGNY-DDIVVIKSLTFVSTKGTYGPFGTKEGTA  116

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+     GN  VGFFGR+G ++DA+G Y  P
Sbjct  117  FSVPVNGGN-FVGFFGRAGEWLDALGFYLKP  146



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 10/128 (8%)
 Frame = +3

Query  102  NKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEY  281
            N+I ++V+    R  +    I+    ++DG ++   + G            I +D +DEY
Sbjct  125  NRIIKVVV----RHEDAVNSISALCLRDDGHEEQTKVWGAA----FGKRSEICLD-KDEY  175

Query  282  LTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
            LT + G +G F    +V+R++ F +N R  G YG + G  F   A  G KIVGF GRSG 
Sbjct  176  LTGVKGRYGQF-DGWSVIRALTFVSNRRTIGPYGTDEGMEFELPAAGGGKIVGFHGRSGG  234

Query  462  YIDAIGTY  485
             +DAIGTY
Sbjct  235  LVDAIGTY  242



>ref|XP_006306414.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
 gb|EOA39312.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
Length=1361

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 77/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  48   AYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            + GP G   G  W       + QI+I+ G   ++    I     KN  S  +   GG G 
Sbjct  776  SVGPWGGQSGHAWDDGMHTTVRQIIIAHGSSIDS----IQVEYDKNGSSVWSERRGGKGG  831

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPF  404
              +    D + +D   EYL  +SGT+G+F +  N+ +RS+   +N R++G +G   GT F
Sbjct  832  RKS----DKVKLDYPHEYLISVSGTYGSFDAWGNICVRSLTLESNHRKYGPFGVESGTFF  887

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                ++G KI+GF G++G+Y DAIG +  P
Sbjct  888  AL-PKSGTKIIGFHGKAGWYTDAIGVHIQP  916


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246   NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
             +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  1061  HDKIVFDYPSEVLTHVTGTYGPLIYMGPNVIKSLTFRTNKGKHGPFGEEQGPSFTHKMDE  1120

Query  423   GNKIVGFFGRSGYYIDAIGTY  485
             G ++VGF GR G ++D+IG +
Sbjct  1121  G-RVVGFLGREGLFLDSIGVH  1140


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 10/128 (8%)
 Frame = +3

Query  108   INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
             I QI ++   RGN++   I     +N  S    +   GG     TH   I ++  +E LT
Sbjct  1221  IKQIFVT---RGNDSISSIQVEYDRNGQS--VWSTKHGGNNGVATHR--IKLEYPNETLT  1273

Query  288   EISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
              ISG +G   +SD  NV++S+ F T+  ++G YG   GT F+     G K++GF GRS  
Sbjct  1274  CISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEENGTFFSSTTTQG-KVLGFHGRSSC  1332

Query  462   YIDAIGTY  485
              +DAIG +
Sbjct  1333  NLDAIGVH  1340



>ref|XP_004164005.1| PREDICTED: agglutinin-like [Cucumis sativus]
 gb|KGN59969.1| hypothetical protein Csa_3G857590 [Cucumis sativus]
Length=169

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 72/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +++ P G +GG  W       I  + I FGGR  +    I F      G+  T    GG 
Sbjct  17   LSFKPKGSSGGNDWDDGVYCDIKMLEIQFGGRCID---AIRFQYEDKYGNSITPQKHGGN  73

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFG----AFASSDNVLRSIKFTTNAREFGTYGPNV  392
                +     I ++  DEYL  + G  G     F +  +V+RS+ F TN +  G YG   
Sbjct  74   EGKRIIQ---IGLNCPDEYLISVHGYHGNIYDQFGNPTHVIRSLTFETNKQSLGPYGIEE  130

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            G  F+F      KIVGF GRSG+++DAIG +  P
Sbjct  131  GIKFSFPTTGLIKIVGFHGRSGWFLDAIGFHFLP  164



>ref|NP_001044410.1| Os01g0775500 [Oryza sativa Japonica Group]
 dbj|BAF06324.1| Os01g0775500, partial [Oryza sativa Japonica Group]
Length=349

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G  GG  W     + + Q+VI+ G   ++  I            K     G GG
Sbjct  11   ILVGPWGGLGGTLWDDGVHSTVRQVVITHGAAIDSIKIEYDLKGKSVWSEKHG---GDGG  67

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
            T+T     D + +D   E LT +SG +G+      V+RS+ F +N  ++G +G   GTPF
Sbjct  68   TKT-----DQVKLDYPQEILTSVSGYYGSLGGC-IVVRSLTFRSNLSKYGPFGSEEGTPF  121

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +       K++GF G+SG+++D+IG +
Sbjct  122  SLPVAVTGKVIGFHGKSGWFLDSIGCH  148



>gb|KDO84683.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=528

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +A GP G   G  W       + Q+VI+ G     + I+I +      GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGA--GIDSIQIEYD--NKGGSCWSEKHGGNG  66

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                 T  D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT 
Sbjct  67   G----TKFDQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 68/148 (46%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            + YGP G  GG  ++      I QI +S      N  I         DG     +  GG 
Sbjct  264  ITYGPWGGTGGSMFNDGTYTGIRQINLS-----RNVGIVSMKVCYDQDGKAVWGSKHGG-  317

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
              T    +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  
Sbjct  318  --TGGFRHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQS  375

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+ +   G KIVGF GR G ++DAIG Y
Sbjct  376  FSNKIGEG-KIVGFHGRDGLFLDAIGVY  402



>ref|NP_001148739.1| LOC100282355 [Zea mays]
 gb|ACG32703.1| agglutinin [Zea mays]
Length=207

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
            +H   I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G   GTPF F  
Sbjct  73   SHTTQIKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV  132

Query  417  QNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G  IVGF GRSG+ +DA+G Y AP
Sbjct  133  -DGGVIVGFCGRSGWQLDAVGLYVAP  157



>ref|XP_009608047.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104102120 
[Nicotiana tomentosiformis]
Length=1799

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 47/136 (35%), Positives = 75/136 (55%), Gaps = 11/136 (8%)
 Frame = +3

Query  84   WSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINI  263
            W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG G        D + I
Sbjct  10   WNYKLKSPIKEILIAHGDIIDSIMFR---TVTEQGTTIDSAKFGGDGGR-----RDKVVI  61

Query  264  DGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIV  437
            +    EYL  I+GTFG +    +V++S+ F TNA+ +G +G   G TPF+   + G  IV
Sbjct  62   EATSLEYLKGINGTFGCYYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIV  120

Query  438  GFFGRSGYYIDAIGTY  485
            GF GRS  Y++AIG Y
Sbjct  121  GFHGRSELYLNAIGVY  136



>ref|XP_008654965.1| PREDICTED: LOC100282355 isoform X4 [Zea mays]
Length=211

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
            +H   I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G   GTPF F  
Sbjct  79   SHTTQIKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV  138

Query  417  QNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +G  IVGF GRSG+ +DA+G Y AP
Sbjct  139  -DGGVIVGFCGRSGWQLDAVGLYVAP  163



>ref|XP_010935305.1| PREDICTED: jacalin-related lectin 3-like [Elaeis guineensis]
Length=499

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W       I Q+V+  G   ++  I+I +   K          G 
Sbjct  10   SPILVGPWGGEGGSPWDDGVYTTIRQVVVVHGAAIDS--IQIEYDK-KGSSVWSEKHGGN  66

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVG  395
            GGT+T     D I +D   E LT +SG +G+ +S S  ++RS+ F +N  ++G +G   G
Sbjct  67   GGTKT-----DKIKLDHPLESLTSVSGYYGSLSSGSPAIIRSLTFESNQAKYGPFGYEQG  121

Query  396  TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              F+F   +G KIVGF GRSG+Y+D+IG Y
Sbjct  122  MRFSF-PMSGGKIVGFHGRSGWYLDSIGFY  150



>ref|XP_002510454.1| hypothetical protein RCOM_1595950 [Ricinus communis]
 gb|EEF52641.1| hypothetical protein RCOM_1595950 [Ricinus communis]
Length=540

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 11/152 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G   G  W     N + Q++I  G   ++    I F   K   S  +   GG  
Sbjct  15   ISVGPWGGQNGVRWDDGISNSVRQVIICHGAAVDS----IQFEYDKKGTSVWSEKHGG--  68

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFAS--SDNVLRSIKFTTNAREFGTYGPNVGT  398
              T     + +  D  DEYL  +SG +G+        ++RS+ F TN R++G +G   GT
Sbjct  69   --TGCIKINKVKFDYPDEYLVSVSGHYGSVVEYYGPVLVRSLMFQTNRRKYGPFGIQQGT  126

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F+F    G ++VGF GRS +Y+D+IG Y  P
Sbjct  127  QFSFPL-TGGQVVGFHGRSSWYLDSIGVYLKP  157


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 11/154 (7%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
             + +  A GP G NGG  W     + I +I ++ G         I     +N  S  ++ 
Sbjct  373  ELVSSWASGPWGGNGGKPWDDGVFSGIKKIFLAKG----EAIYCIQIEYDRNGQSAWSVR  428

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYG  383
             GGG   ++      I ++   E LT I G +G+F   D+  V++S+ F TN  ++G +G
Sbjct  429  HGGGSEGSS----HLIKLEYPHETLTSICGYYGSFTGEDSNSVIKSLTFYTNKGKYGPFG  484

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              VGT F      G KIVGF GRSG Y++AIG +
Sbjct  485  EEVGTFFTSSNTEG-KIVGFHGRSGCYLNAIGVH  517


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 73/150 (49%), Gaps = 10/150 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V+YGP G NGG  +       + +I I+  G   +  +    S     G+K+    G GG
Sbjct  208  VSYGPWGGNGGMIFDDGVYTGVREIHITRYGGVLSLRVCYDLSGQAIWGNKNG---GSGG  264

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTP  401
                    D I  D   E LT ++G +G+       V++S+ F TN R++G +G   G  
Sbjct  265  IRL-----DKIAFDYPSEILTHVTGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGIS  319

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNA  491
            F+    NG  +VGF GR G++ID+IG + A
Sbjct  320  FSSGPNNG-IVVGFHGRKGWFIDSIGVHVA  348



>dbj|BAK00987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 79/157 (50%), Gaps = 14/157 (9%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSF-RPKNKINQIVISFGGRGNNNPIRITFS-ATKNDGSKDT  203
            S S     GP G +GG   +  +   ++  I IS G   ++    I FS   + D +  T
Sbjct  159  SWSLPAKIGPWGGDGGTAQNMIKASRRLESITISSGDVVDS----IAFSYIDEADQNCTT  214

Query  204  LTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  383
              +GG G  ++     TI +    E+LTE+SGT     S   V+ SI+F TN + +G +G
Sbjct  215  DRLGGPGGSSS-----TIQL-APSEFLTEVSGTISD--SRCEVVESIQFVTNIQTYGPFG  266

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
               GTPF F      K+VGFFGR G ++DAIG Y  P
Sbjct  267  TQDGTPFTFSVPRYKKVVGFFGRGGLFLDAIGIYLQP  303



>gb|EEC71570.1| hypothetical protein OsI_03937 [Oryza sativa Indica Group]
Length=833

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G  GG  W     + + QIVI+ G   ++  I            K     G GG
Sbjct  251  ILVGPWGGLGGTLWDDGVHSTVRQIVITHGAAIDSIKIEYDLKGKSVWSEKHG---GDGG  307

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
            T+T     D + +D   E LT +SG +G+      V+RS+ F +N  ++G +G   GTPF
Sbjct  308  TKT-----DQVKLDYPQEILTSVSGYYGSLGGC-IVVRSLTFRSNLSKYGPFGSEEGTPF  361

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +       K++GF G+SG+++D+IG +
Sbjct  362  SLPVAVTGKVIGFHGKSGWFLDSIGCH  388


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 73/156 (47%), Gaps = 12/156 (8%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDT  203
            TM+IST V +GP G NGG  +       + QI ++ G         +  S+ K    ++ 
Sbjct  476  TMTISTPVRFGPWGGNGGTIFDDGIYTGVRQINLTRG---------LGISSMKVLYDRNG  526

Query  204  LTIGGGGT-ETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGT  377
              I G     +     + +  D   E LT I+G F +       V++S+ F T  +  G 
Sbjct  527  QAIWGDKRGSSGAARAEKVVFDFPSEILTHITGYFSSTMIMGSTVIKSLTFHTTKKSHGP  586

Query  378  YGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G   GT F+     G +IVGF GR G+YID+IG +
Sbjct  587  FGDETGTFFSSCLTEG-RIVGFHGRDGWYIDSIGVH  621


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 45/85 (53%), Gaps = 4/85 (5%)
 Frame = +3

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNF  410
             +TH   I +D   E L  I G +         VLRSI   +N  ++G +G  VGT F+ 
Sbjct  726  QITHR--IKLDYPHEVLNCIYGYYNTCQDEGPRVLRSITLVSNRGKYGPFGEEVGTYFSS  783

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
                G K+VGF GRSG Y+DAIG +
Sbjct  784  ATTEG-KVVGFHGRSGLYLDAIGVH  807



>gb|EEE60695.1| hypothetical protein OsJ_14181 [Oryza sativa Japonica Group]
Length=95

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = +3

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYG-  383
            +G  G++  V H   +   G  +++ EISGT G + S   NVLRS+K TT  R +G YG 
Sbjct  1    MGHWGSDGGVPHEIHL---GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGN  57

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            P  G PF+F     ++I GFF R+G+  DAIG Y
Sbjct  58   PKAGIPFSFSVDGSDRITGFFVRAGFITDAIGVY  91



>gb|EMS58273.1| hypothetical protein TRIUR3_17900 [Triticum urartu]
Length=304

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 75/158 (47%), Gaps = 13/158 (8%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSF-RPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTL  206
            S S     GP G NGG           I  I +S G   ++    I FS     G K T+
Sbjct  156  SRSLPTKVGPWGGNGGSDKDIVEAPRCIESITVSSGTIIDS----IKFSYVDQAGQKRTV  211

Query  207  -TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTY  380
               GG G + N        + G  E++ E SGTF  +   + N++ S+KF TN + +G +
Sbjct  212  GPWGGSGGKQNTF------VLGTSEFVKEFSGTFSLYGRDNHNIITSLKFVTNMKTYGPF  265

Query  381  GPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            G   GT F    Q  + IVGFFGRSG Y+DA+G Y  P
Sbjct  266  GQAKGTTFTIPVQKNSNIVGFFGRSGIYLDALGVYVHP  303



>ref|XP_009588746.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009588747.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=1341

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/160 (32%), Positives = 81/160 (51%), Gaps = 12/160 (8%)
 Frame = +3

Query  15   YHSTMSISTDVAYGPLGHNGG-GFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDG  191
            Y  +   +  +   P G N G   W+++ K+ I +I+I+ G   ++   R   + T+   
Sbjct  22   YQVSYDQADSILVEPWGGNAGESEWNYKLKSPIKEILIAHGDIIDSIMFR---TVTEQGT  78

Query  192  SKDTLTIGGGGTETNVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNARE  368
            + D+   GG G        D + I+    EYL  I GTFG +    +V++S+ F TNA+ 
Sbjct  79   TIDSTKFGGDGGRI-----DKVVIEATSLEYLKGIKGTFGYYYGH-SVIKSLCFITNAKN  132

Query  369  FGTYGPNVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G +G   G  PF+   + G  IVGF GRS  Y++AIG Y
Sbjct  133  YGPFGCEAGGIPFSLVMKEGVAIVGFHGRSRLYLNAIGVY  172



>ref|XP_009588743.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588744.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588745.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=1363

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/160 (32%), Positives = 81/160 (51%), Gaps = 12/160 (8%)
 Frame = +3

Query  15   YHSTMSISTDVAYGPLGHNGG-GFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDG  191
            Y  +   +  +   P G N G   W+++ K+ I +I+I+ G   ++   R   + T+   
Sbjct  44   YQVSYDQADSILVEPWGGNAGESEWNYKLKSPIKEILIAHGDIIDSIMFR---TVTEQGT  100

Query  192  SKDTLTIGGGGTETNVTHNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNARE  368
            + D+   GG G        D + I+    EYL  I GTFG +    +V++S+ F TNA+ 
Sbjct  101  TIDSTKFGGDGGRI-----DKVVIEATSLEYLKGIKGTFGYYYGH-SVIKSLCFITNAKN  154

Query  369  FGTYGPNVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G +G   G  PF+   + G  IVGF GRS  Y++AIG Y
Sbjct  155  YGPFGCEAGGIPFSLVMKEGVAIVGFHGRSRLYLNAIGVY  194



>dbj|BAJ85606.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + + QI+I+ G   ++  IRI +    +     T     
Sbjct  10   SPIVVGPWGGTGGYPWDDGVYSTVCQIMITHGAAVDS--IRIQYDLKGHSVWSQTHGSTE  67

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
             G+ET     D + +D   E L  +SG +G+   S  ++RS+ F +N  ++G +G   GT
Sbjct  68   DGSET-----DKVKLDVPGEILLSVSGYYGSVCGSPVIIRSLTFQSNRSKYGPFGTEDGT  122

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +3

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GT  ++TH   + +D   E LT + G + A  A     LRSI F +N   +G +G  VGT
Sbjct  479  GTSGHITHR--VKLDAPHEVLTCVRGYYNADPAEGPRALRSITFVSNRGRYGPFGDEVGT  536

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+  A  G K+VGF GRSG ++DAIG +
Sbjct  537  YFSSPATAGGKVVGFHGRSGQHLDAIGVH  565


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +G         +RS+ F TN R +G YG   GT F+    +G
Sbjct  305  DKIAFDFPSEVLTHITGYYGPTIIMGPTAVRSLTFHTNRRRYGPYGDEYGTYFSTSFADG  364

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             ++VGF GR G+YID IG +
Sbjct  365  -RVVGFHGREGWYIDGIGVH  383



>gb|KDO84682.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=619

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +A GP G   G  W       + Q+VI+ G     + I+I +      GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGA--GIDSIQIEYD--NKGGSCWSEKHGGNG  66

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                 T  D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT 
Sbjct  67   G----TKFDQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +3

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQ  413
            T+   I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  VGT F   
Sbjct  517  TYTHRIKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTST  576

Query  414  AQNGNKIVGFFGRSGYYIDAIGTY  485
               G K+VGF GRS +Y+DAIG +
Sbjct  577  TTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 68/148 (46%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            + YGP G  GG  ++      I QI +S       N   ++     +   K       GG
Sbjct  264  ITYGPWGGTGGSMFNDGTYTGIRQINLS------RNVGIVSMKVCYDQDGKAVWGSKHGG  317

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTP  401
            T      +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  
Sbjct  318  T--GGFRHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQS  375

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+ +   G KIVGF GR G ++DAIG Y
Sbjct  376  FSNKIGEG-KIVGFHGRDGLFLDAIGVY  402



>dbj|BAJ88436.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + + QI+I+ G   ++  IRI +    +     T     
Sbjct  10   SPIVVGPWGGTGGYPWDDGVYSTVCQIMITHGAAVDS--IRIQYDLKGHSVWSQTHGSTE  67

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
             G+ET     D + +D   E L  +SG +G+   S  ++RS+ F +N  ++G +G   GT
Sbjct  68   DGSET-----DKVKLDVPGEILLSVSGYYGSVCGSPVIIRSLTFQSNRSKYGPFGTEDGT  122

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +3

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GT  ++TH   + +D   E LT + G + A  A     LRSI F +N   +G +   VGT
Sbjct  479  GTSGHITHR--VKLDAPHEVLTCVRGYYNADPAEGPRALRSITFVSNRGRYGPFRDEVGT  536

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+  A  G K+VGF GRSG ++DAIG +
Sbjct  537  YFSSPATAGGKVVGFHGRSGQHLDAIGVH  565


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +G         +RS+ F TN R +G YG   GT F+    +G
Sbjct  305  DKIAFDFPSEVLTHITGYYGPTIIMGPTAVRSLTFHTNRRRYGPYGDEYGTYFSTSFADG  364

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             ++VGF GR G+YID IG +
Sbjct  365  -RVVGFHGREGWYIDGIGVH  383



>ref|XP_009622527.1| PREDICTED: agglutinin-like isoform X4 [Nicotiana tomentosiformis]
Length=490

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 77/143 (54%), Gaps = 11/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTETNV  239
            G+ GG  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG GG    V
Sbjct  281  GNIGGSEWNYKLKSSIKEILIAHGDVIDSIMFR---TITEQGTTIDSPKFGGNGGRIYKV  337

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  416
                T       E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+   
Sbjct  338  VIEAT-----PLEHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVM  391

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  IVGF GRSG Y+DAIG Y
Sbjct  392  KEGVAIVGFHGRSGLYLDAIGVY  414


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTETNV  239
            G+ GG  W+++ K+   +I+I+ G   ++    I F      GS  D+   GG G     
Sbjct  75   GNTGGSEWNYKLKSPTIEILIAHGDFIHS----IMFRTITEQGSTIDSPKFGGDGGR---  127

Query  240  THNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
               D + I      YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   
Sbjct  128  --RDKVVIKASPLVYLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVI  184

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  I GF G    Y+DAIG Y
Sbjct  185  KEGGAIEGFHGHCRAYLDAIGVY  207



>gb|EAZ01021.1| hypothetical protein OsI_23055 [Oryza sativa Indica Group]
Length=694

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +3

Query  162  ITFSATKNDGSKDTL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VL  335
            I FS   ++G +  +   GG G    + H  TI++ G  EYL EISGT G F  + + V+
Sbjct  278  IGFSYYDDNGKQHKVGPWGGHGANKGIDH--TIHL-GPSEYLIEISGTVGPFTYAPHGVI  334

Query  336  RSIKFTTNAREFGTYGPNVGTPFNFQAQN-GNKIVGFFGRSGYYIDAIGTYNAPD  497
             S+   T  R +G YG  VG PF+   QN G  IVGFF R G+Y+DA G Y  P+
Sbjct  335  TSLTLVTTIRTYGPYGELVGNPFHIPMQNKGGSIVGFFARVGWYVDAFGIYVNPN  389


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG-NKIVGF  443
            G  E++T + GT G F +  +V+ S++F TNA ++G +G  +GT F      G + IVGF
Sbjct  617  GPSEFVTAVYGTVGPFGNYSSVITSLRFVTNAGKYGPFGQGIGTHFQAPMHKGSSSIVGF  676

Query  444  FGRSGYYIDAIGTYNAP  494
            FGRS   +++IG Y  P
Sbjct  677  FGRSSSCVESIGFYVVP  693


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            E+LT  SGT G      NV+ S+   TNAR +G +G   G PF    +N   IVGFFGR+
Sbjct  470  EFLTGFSGTTG-----HNVVTSLTLITNARSYGPFGQVGGAPFQVPMRNNASIVGFFGRA  524

Query  456  GYYIDAIGTYNAPD  497
              Y++AIG Y  P+
Sbjct  525  DQYLNAIGVYANPE  538



>ref|XP_006662244.1| PREDICTED: uncharacterized protein LOC102708001 [Oryza brachyantha]
Length=334

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN-KIVGF  443
            GE E +TE+SGT G F   +NV+ S+   TN R +G +G   G PF+      N  IVGF
Sbjct  256  GESEVVTEVSGTIGPFHHLNNVITSLSIVTNLRSYGPFGSAKGIPFSTSTLVSNSSIVGF  315

Query  444  FGRSGYYIDAIGTY  485
            FGRSG Y+DAIG Y
Sbjct  316  FGRSGSYLDAIGVY  329



>ref|XP_010924946.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Elaeis 
guineensis]
Length=197

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIG  215
            S  V  GP G +GG  W     N + +I + +      + IR+ +    +   K  L   
Sbjct  8    SKTVKVGPWGGHGGNPWDDGSYNGVREITLVY--DRCIDSIRVLY----DKNGKPVLAEK  61

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNV  392
             GG   N+T    + +   +E+LT +SG +       + V+RS+ F +N R FG +G   
Sbjct  62   HGGNGGNLTVQ--VKLHYPEEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEE  119

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            GTPF F   +G  IVGF GR G+Y+DAIG   +P
Sbjct  120  GTPFTF-PMDGGMIVGFSGRGGWYLDAIGLCLSP  152



>ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1218

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 73/151 (48%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +A GP G   G  W     + + Q+VI  G   ++  I      T     K     G GG
Sbjct  633  IAVGPWGGQNGCRWDDGVYSTVRQLVIVHGSGIDSIQIEYDKKGTSIWSEKHG---GNGG  689

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
              T     D + +D  DEYL  +SG +G+      V +RS+ F +N R +G +G   GT 
Sbjct  690  NRT-----DKVKLDYPDEYLASVSGHYGSLNQWGPVFVRSLTFQSNKRTYGPFGVEQGTY  744

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+F    G +IVGF G+ GY++DAIG Y  P
Sbjct  745  FSF-PMTGGRIVGFHGKGGYFVDAIGIYLKP  774


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = +3

Query  213   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYG  383
             G GGT TN      + ++   E LT ISG +G  AS D    V++S+ F T+  ++G +G
Sbjct  1112  GSGGTATN-----RVKLEYPHEVLTRISGYYGP-ASRDERPTVVKSLTFYTSRGQYGPFG  1165

Query  384   PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
               +GT F      G K+VGF GR G Y+DAIG +
Sbjct  1166  EEIGTFFTSTTTEG-KVVGFHGRCGAYLDAIGVH  1198


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            + I  D   E LT ISGT+G       N+++S+ F TN  + G +G   G  F+ +  NG
Sbjct  923  EKITFDYPYEILTHISGTYGPLMFMGPNIIKSLTFYTNKGKHGPFGDEQGPSFSTKP-NG  981

Query  426  NKIVGFFGRSGYYIDAIGT  482
             KIVGF G+ G ++DAIG 
Sbjct  982  GKIVGFHGKEGLFLDAIGV  1000



>ref|XP_007017646.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017647.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14871.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14872.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=598

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 27/166 (16%)
 Frame = +3

Query  27   MSISTD---VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFS------AT  179
            MS+  D   ++ GP G  GG  W       + Q+VI+ G     + I+I +        +
Sbjct  1    MSLEDDNKPISVGPWGGQGGSSWDDGVYFTVRQLVIAHGS--GIDSIQIEYDNKGNSIWS  58

Query  180  KNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTT  356
            KN G       GGGG+ T     D + +D  DE+LT + G +G       +L RS+ F +
Sbjct  59   KNHG-------GGGGSMT-----DKVKLDYPDEFLTSVHGYYGILHERGPILVRSLTFFS  106

Query  357  NAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            N + +G YG   GT F+       KIVGF GR G ++DAIGT++ P
Sbjct  107  NRKAYGPYGIEQGTSFSMTR---GKIVGFHGRCGCFLDAIGTHSKP  149


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 68/148 (46%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++YGP G NGG  +       I QI +S      N  I    +    DG     +  GG 
Sbjct  243  LSYGPWGGNGGAKFDDGTYTGIRQITLS-----RNVGIVWIKACYDRDGQAVWGSKHGG-  296

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
              T     D I  D   E LT I+GTFG       NV++S+ F TN  + G YG   G  
Sbjct  297  --TGGFKTDRIIFDYPSEILTHITGTFGPLMYMGPNVIKSLTFHTNKGKHGPYGDEQGPS  354

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F  +   G +I+GF GR G ++DA+G Y
Sbjct  355  FTNKMNEG-RIIGFHGREGLFLDAVGVY  381



>gb|EEE55471.1| hypothetical protein OsJ_03649 [Oryza sativa Japonica Group]
Length=833

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G  GG  W     + + Q+VI+ G   ++  I            K     G GG
Sbjct  251  ILVGPWGGLGGTLWDDGVHSTVRQVVITHGAAIDSIKIEYDLKGKSVWSEKHG---GDGG  307

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPF  404
            T+T     D + +D   E LT +SG +G+      V+RS+ F +N  ++G +G   GTPF
Sbjct  308  TKT-----DQVKLDYPQEILTSVSGYYGSLGGC-IVVRSLTFRSNLSKYGPFGSEEGTPF  361

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +       K++GF G+SG+++D+IG +
Sbjct  362  SLPVAVTGKVIGFHGKSGWFLDSIGCH  388


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 71/156 (46%), Gaps = 12/156 (8%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDT  203
            TM+IST V +GP G NGG  +       + QI +  G         +  S  K    ++ 
Sbjct  476  TMTISTPVRFGPWGGNGGTIFDDGIYTGVRQINLKRG---------LGISTMKVLYDRNG  526

Query  204  LTIGGGGT-ETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGT  377
              I G     +     + +  D   E LT I+G F +       V++S+ F T  +  G 
Sbjct  527  QAIWGDKRGSSGAARAEKVVFDFPSEILTHITGYFSSTMIMGSTVIKSLTFHTTKKSHGP  586

Query  378  YGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G   GT F+     G +IVGF GR G+YID+IG +
Sbjct  587  FGDETGTFFSSCLTEG-RIVGFHGRDGWYIDSIGVH  621


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 45/85 (53%), Gaps = 4/85 (5%)
 Frame = +3

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNF  410
             +TH   I +D   E L  I G +         VLRSI   +N  ++G +G  VGT F+ 
Sbjct  726  QITHR--IKLDYPHEVLNCIYGYYNTCQDEGPRVLRSITLVSNRGKYGPFGEEVGTYFSS  783

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
                G K+VGF GRSG Y+DAIG +
Sbjct  784  ATTEG-KVVGFHGRSGLYLDAIGVH  807



>gb|EMS65495.1| hypothetical protein TRIUR3_18396 [Triticum urartu]
Length=431

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W     + + QI+I+ G   ++  IRI +    +     T     
Sbjct  8    SPIVVGPWGGTGGYPWDDGVYSTVCQIMITHGAAVDS--IRIQYDLKGHSIWSQTHGSTE  65

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
             G+ET     D + +D   E L  +SG +G+   S  ++RS+ F +N  ++G +G   GT
Sbjct  66   DGSET-----DKVKLDVPGETLLSVSGHYGSVCGSPIIIRSLTFQSNRSKYGPFGTEDGT  120

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  121  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  148


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 46/87 (53%), Gaps = 8/87 (9%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAR-------EFGTYGPNVGTPF  404
            D I  D   E LT I+G +G         +RS+ F TN R       E+G +G  VGT F
Sbjct  324  DKIAFDFPTEVLTHITGYYGPTIIMGPTAVRSLTFHTNRRRYGPYGDEYGPFGDEVGTYF  383

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +  A    K+VGF GRSG ++DAIG +
Sbjct  384  SSPATAEGKVVGFHGRSGQHLDAIGVH  410



>ref|XP_009391787.1| PREDICTED: agglutinin-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +3

Query  54   GPLGHNGGGFWSFR-----PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            GP G  GG   S R     P  +I ++++  G     + IRI +     D   D    G 
Sbjct  119  GPCGGAGG---SERNMGADPATRILKVMVRHGL--AVDAIRILYRRDGRDEWTDWWG-GR  172

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
            GG  + V  +D       DEYL  +SG +G       V++S+ F TN R +G +G   G 
Sbjct  173  GGQLSEVVLDDE-----RDEYLACLSGRYG-ICGGYLVIKSLTFATNKRTYGPFGVEDGA  226

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNA  491
            PF   A  G +IVGFF R+G ++DAIG Y A
Sbjct  227  PFKLDA-GGQRIVGFFARAGQFLDAIGVYTA  256



>ref|XP_010924945.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Elaeis 
guineensis]
Length=200

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIG  215
            S  V  GP G +GG  W     N + +I + +      + IR+ +    +   K  L   
Sbjct  11   SKTVKVGPWGGHGGNPWDDGSYNGVREITLVY--DRCIDSIRVLY----DKNGKPVLAEK  64

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNV  392
             GG   N+T    + +   +E+LT +SG +       + V+RS+ F +N R FG +G   
Sbjct  65   HGGNGGNLTVQ--VKLHYPEEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEE  122

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            GTPF F   +G  IVGF GR G+Y+DAIG   +P
Sbjct  123  GTPFTF-PMDGGMIVGFSGRGGWYLDAIGLCLSP  155



>ref|XP_009622526.1| PREDICTED: agglutinin-like isoform X3 [Nicotiana tomentosiformis]
Length=539

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 77/143 (54%), Gaps = 11/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTETNV  239
            G+ GG  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG GG    V
Sbjct  330  GNIGGSEWNYKLKSSIKEILIAHGDVIDSIMFR---TITEQGTTIDSPKFGGNGGRIYKV  386

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  416
                T       E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+   
Sbjct  387  VIEAT-----PLEHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVM  440

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  IVGF GRSG Y+DAIG Y
Sbjct  441  KEGVAIVGFHGRSGLYLDAIGVY  463


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTETNV  239
            G+ GG  W+++ K+   +I+I+ G   ++    I F      GS  D+   GG G     
Sbjct  124  GNTGGSEWNYKLKSPTIEILIAHGDFIHS----IMFRTITEQGSTIDSPKFGGDGG----  175

Query  240  THNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
               D + I      YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   
Sbjct  176  -RRDKVVIKASPLVYLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVI  233

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  I GF G    Y+DAIG Y
Sbjct  234  KEGGAIEGFHGHCRAYLDAIGVY  256


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +3

Query  291  ISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYID  470
            I GTFG    S +V++ + F TNA+ +G +G   GTPF+   + G  IVGF GR G Y+D
Sbjct  10   IKGTFGR-CGSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRCGAYLD  68

Query  471  AIGTY  485
            AIG Y
Sbjct  69   AIGVY  73



>ref|XP_007017648.1| Mannose-binding lectin superfamily protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY14873.1| Mannose-binding lectin superfamily protein, putative isoform 
3 [Theobroma cacao]
Length=624

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 27/166 (16%)
 Frame = +3

Query  27   MSISTD---VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFS------AT  179
            MS+  D   ++ GP G  GG  W       + Q+VI+ G     + I+I +        +
Sbjct  1    MSLEDDNKPISVGPWGGQGGSSWDDGVYFTVRQLVIAHGS--GIDSIQIEYDNKGNSIWS  58

Query  180  KNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTT  356
            KN G       GGGG+ T     D + +D  DE+LT + G +G       +L RS+ F +
Sbjct  59   KNHG-------GGGGSMT-----DKVKLDYPDEFLTSVHGYYGILHERGPILVRSLTFFS  106

Query  357  NAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            N + +G YG   GT F+       KIVGF GR G ++DAIGT++ P
Sbjct  107  NRKAYGPYGIEQGTSFSMTR---GKIVGFHGRCGCFLDAIGTHSKP  149


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 68/148 (46%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++YGP G NGG  +       I QI +S      N  I    +    DG     +  GG 
Sbjct  269  LSYGPWGGNGGAKFDDGTYTGIRQITLS-----RNVGIVWIKACYDRDGQAVWGSKHGG-  322

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
              T     D I  D   E LT I+GTFG       NV++S+ F TN  + G YG   G  
Sbjct  323  --TGGFKTDRIIFDYPSEILTHITGTFGPLMYMGPNVIKSLTFHTNKGKHGPYGDEQGPS  380

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F  +   G +I+GF GR G ++DA+G Y
Sbjct  381  FTNKMNEG-RIIGFHGREGLFLDAVGVY  407



>ref|XP_009622525.1| PREDICTED: agglutinin-like isoform X2 [Nicotiana tomentosiformis]
Length=546

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 77/143 (54%), Gaps = 11/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTETNV  239
            G+ GG  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG GG    V
Sbjct  337  GNIGGSEWNYKLKSSIKEILIAHGDVIDSIMFR---TITEQGTTIDSPKFGGNGGRIYKV  393

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  416
                T       E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+   
Sbjct  394  VIEAT-----PLEHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVM  447

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  IVGF GRSG Y+DAIG Y
Sbjct  448  KEGVAIVGFHGRSGLYLDAIGVY  470


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            EYLT I GTFG    S +V++ + F TNA+ +G +G   GTPF+   + G  IVGF GR 
Sbjct  12   EYLTGIKGTFGR-CGSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  70

Query  456  GYYIDAIGTY  485
            G Y+DAIG Y
Sbjct  71   GAYLDAIGVY  80


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTETNV  239
            G+ GG  W+++ K+   +I+I+ G   ++    I F      GS  D+   GG G     
Sbjct  131  GNTGGSEWNYKLKSPTIEILIAHGDFIHS----IMFRTITEQGSTIDSPKFGGDGG----  182

Query  240  THNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
               D + I      YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   
Sbjct  183  -RRDKVVIKASPLVYLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVI  240

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  I GF G    Y+DAIG Y
Sbjct  241  KEGGAIEGFHGHCRAYLDAIGVY  263



>ref|XP_006301377.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
 gb|EOA34275.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
Length=177

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 75/147 (51%), Gaps = 12/147 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            V  GP G NGG  W     + + +I + +    ++    IT    KN     +   GG G
Sbjct  13   VFVGPWGGNGGTAWDDGIYDGVREIRLVY----DHCIDSITVIYDKNCKPARSEKHGGLG  68

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGT  398
            G +T+      I +   DEYL  +SG +    SS   V+RS+ F +N + +G YG   GT
Sbjct  69   GNKTS-----EIKLQYPDEYLIGVSGYYCPLVSSGTPVIRSMTFKSNKQVYGPYGVEQGT  123

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIG  479
            PF F   NG +IVG  GRSG+Y+D+IG
Sbjct  124  PFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_009622528.1| PREDICTED: agglutinin-like isoform X5 [Nicotiana tomentosiformis]
Length=460

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 77/145 (53%), Gaps = 10/145 (7%)
 Frame = +3

Query  57   PLGHN-GGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            P G N GG  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG G   
Sbjct  248  PWGGNIGGSEWNYKLKSSIKEILIAHGDVIDSIMFR---TITEQGTTIDSPKFGGNGGRI  304

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNF  410
                 +   +    E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+ 
Sbjct  305  YKVVIEATPL----EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSL  359

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
              + G  IVGF GRSG Y+DAIG Y
Sbjct  360  VMKEGVAIVGFHGRSGLYLDAIGVY  384


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTETNV  239
            G+ GG  W+++ K+   +I+I+ G   ++    I F      GS  D+   GG G     
Sbjct  45   GNTGGSEWNYKLKSPTIEILIAHGDFIHS----IMFRTITEQGSTIDSPKFGGDGG----  96

Query  240  THNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
               D + I      YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   
Sbjct  97   -RRDKVVIKASPLVYLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVI  154

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  I GF G    Y+DAIG Y
Sbjct  155  KEGGAIEGFHGHCRAYLDAIGVY  177



>ref|XP_010029744.1| PREDICTED: jacalin-related lectin 4-like [Eucalyptus grandis]
Length=1327

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 68/131 (52%), Gaps = 8/131 (6%)
 Frame = +3

Query  108   INQIVISFGGRGNNNPI--RITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEY  281
             + +I+I F    +  PI   ITF   + DG    L    GGT+    H   I++   DEY
Sbjct  901   VRKIIIVF--EPSTEPIIESITFQYEEEDGDL-RLCERHGGTDQGEIH--VIDLSDSDEY  955

Query  282   LTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             LT ISG   + +S   V+RS+ F +N R  G  G   G  F+     G KI+GF+GRSG 
Sbjct  956   LTSISGYIRSSSSCPTVIRSLTFQSNKRTIGPVGDEKGVYFS-SPTTGGKIIGFYGRSGD  1014

Query  462   YIDAIGTYNAP  494
             ++DAIG Y  P
Sbjct  1015  HLDAIGVYFEP  1025


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 76/146 (52%), Gaps = 10/146 (7%)
 Frame = +3

Query  48   AYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
             +GP G  GG  W       I++I + +G   ++    I F     +GSK ++  GG   
Sbjct  732  VFGPFGGAGGDSWDDGQYVHISRIAVRYGTVIDS----IAFDYIDTNGSKRSIMHGGSSG  787

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFN  407
            E N+     + +   DEY+T  SG   +  ++ ++++S+ F TN R +G  G   G  F+
Sbjct  788  E-NICE---VKLAYPDEYITSFSGYMNS-NNNHSLIKSLTFRTNKRIWGPIGKEEGKYFS  842

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
              ++ G K+VGFFGRSG  +D+IG +
Sbjct  843  LPSEAG-KLVGFFGRSGTLLDSIGAH  867


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  252  TINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  431
            T+ +D  +EYLT ISG    +     V++S+KF TN + +G +G   G  F+F   +G +
Sbjct  495  TVKLDYPNEYLTSISGHIRDYQIP-IVIQSLKFHTNRKTYGPFGFERGQFFHFPQVDGGR  553

Query  432  IVGFFGRSGYYIDAIGTYNAP  494
            I+GF G+ G ++D+IG +  P
Sbjct  554  IIGFHGKCGSHLDSIGAHFGP  574


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (45%), Gaps = 7/147 (5%)
 Frame = +3

Query  54    GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
             GP G  GG  W     + + +I I      +++ I   F     +G        G GT  
Sbjct  1036  GPFGGLGGNAWDDGKFSGVREIEIM-----HDDIIHYIFFCYDKNGEPVCSNRRGAGTRN  1090

Query  234   NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQ  413
                    + +D   EYLT ISG +        V+ S+ F +N   +G +G  +G  F + 
Sbjct  1091  GKAKVTKVQLDYPREYLTSISG-YKRETDEPIVVYSLTFYSNKGRYGPFGKEIGRYFGYP  1149

Query  414   AQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             +  G+KI+GF+G SG  +D+IG Y  P
Sbjct  1150  S-TGSKIIGFYGTSGSNLDSIGVYAEP  1175



>gb|AEQ30064.1| mannose/glucose-specific lectin [Litchi chinensis]
 gb|AEQ30065.1| mannose/glucose-specific lectin [Litchi chinensis]
Length=155

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 77/158 (49%), Gaps = 14/158 (9%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPK-NKINQIVISF-GGRGNNNPIRITFSATKNDGSKDTLT  209
            S  +  GP G N G  WS+ P  + I  + + F  GR     I I F +T       T +
Sbjct  3    SNSIKLGPWGGNAGSAWSYNPSGSVITGVFVRFSAGR----LISIYFKSTNVSSGTSTYS  58

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
               GG ++N      + +D  +EY T ISGT    A + N L +++  T     GT  PN
Sbjct  59   DKFGGYDSNTADYTEVLVDWPEEYFTSISGT----AVTSNGLDTVQSLTFHTTKGTRAPN  114

Query  390  ---VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                GTPF+   + G +IVGFFGR+G Y+DAIG    P
Sbjct  115  GNTNGTPFSIPME-GAQIVGFFGRAGEYVDAIGINVVP  151



>gb|KCW56701.1| hypothetical protein EUGRSUZ_I02393, partial [Eucalyptus grandis]
Length=481

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 68/131 (52%), Gaps = 8/131 (6%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPI--RITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEY  281
            + +I+I F    +  PI   ITF   + DG    L    GGT+    H   I++   DEY
Sbjct  55   VRKIIIVF--EPSTEPIIESITFQYEEEDGDL-RLCERHGGTDQGEIH--VIDLSDSDEY  109

Query  282  LTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
            LT ISG   + +S   V+RS+ F +N R  G  G   G  F+     G KI+GF+GRSG 
Sbjct  110  LTSISGYIRSSSSCPTVIRSLTFQSNKRTIGPVGDEKGVYFS-SPTTGGKIIGFYGRSGD  168

Query  462  YIDAIGTYNAP  494
            ++DAIG Y  P
Sbjct  169  HLDAIGVYFEP  179


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (45%), Gaps = 7/147 (5%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G  GG  W     + + +I I      +++ I   F     +G        G GT  
Sbjct  190  GPFGGLGGNAWDDGKFSGVREIEIM-----HDDIIHYIFFCYDKNGEPVCSNRRGAGTRN  244

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQ  413
                   + +D   EYLT ISG +        V+ S+ F +N   +G +G  +G  F + 
Sbjct  245  GKAKVTKVQLDYPREYLTSISG-YKRETDEPIVVYSLTFYSNKGRYGPFGKEIGRYFGYP  303

Query  414  AQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +  G+KI+GF+G SG  +D+IG Y  P
Sbjct  304  S-TGSKIIGFYGTSGSNLDSIGVYAEP  329



>ref|XP_008388156.1| PREDICTED: uncharacterized protein LOC103450568 [Malus domestica]
Length=615

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 76/152 (50%), Gaps = 10/152 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G + G  W  R  + + Q+VI+ G   ++  I+I +    +    D     GG 
Sbjct  12   ISVGPWGGHNGLIWDDRVHSTVKQLVIAHGAAIDS--IQIEYDERGSSVWSDKHGRNGGW  69

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                    D + +   +E+LT I G +G  +    + +RS+ F +N R +G +G   GT 
Sbjct  70   K------TDKVKLASPEEFLTSIEGYYGKKSEWGPITVRSLTFKSNKRTYGPFGVEQGTY  123

Query  402  FNFQAQNGN-KIVGFFGRSGYYIDAIGTYNAP  494
            F+ Q    N KIVGF G SG+Y+D+IG Y  P
Sbjct  124  FSLQETASNIKIVGFHGMSGWYLDSIGAYVKP  155


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (49%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            VAYGP G  GG  +     + I QI +S         I + +   + D + + +  G  G
Sbjct  253  VAYGPFGGTGGAAFDDGIYSGIRQIKLS-------RNIGVVYIKVQYDRNGEAVWEGRHG  305

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTP  401
              T    +D I  D  +E LT I+GTF        +V++S+ F T  ++ G YG   G  
Sbjct  306  G-TGGFKSDKIVFDYPNEILTHITGTFAPTMVMGTSVIKSLTFHTTKKQHGPYGEEQGAC  364

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F  + + G KIVG  GRSG ++DA+G +
Sbjct  365  FTTKLKEG-KIVGIHGRSGLFLDALGVH  391


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 5/81 (6%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSD----NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            I ++   E +T ISG +G  +        +++S+ F T+  ++G +G  VGT F   A  
Sbjct  515  IKLEYPHEVITCISGYYGCISKDQGQGPKIIKSLTFFTSRGKYGPFGEQVGTFFTSTATE  574

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G K+VGF GRS  Y+DAIG +
Sbjct  575  G-KLVGFHGRSSLYLDAIGVH  594



>ref|XP_009622524.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Nicotiana 
tomentosiformis]
Length=569

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 12/146 (8%)
 Frame = +3

Query  57   PLGHN-GGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-GGTE  230
            P G N GG  W+++ K+ I +I+I+ G   ++   R   + T+   + D+   GG GG  
Sbjct  357  PWGGNIGGSEWNYKLKSSIKEILIAHGDVIDSIMFR---TITEQGTTIDSPKFGGNGGRI  413

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFN  407
              V    T       E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+
Sbjct  414  YKVVIEAT-----PLEHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFS  467

Query  408  FQAQNGNKIVGFFGRSGYYIDAIGTY  485
               + G  IVGF GRSG Y+DAIG Y
Sbjct  468  LVMKEGVAIVGFHGRSGLYLDAIGVY  493


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  455
            EYLT I GTFG    S +V++ + F TNA+ +G +G   GTPF+   + G  IVGF GR 
Sbjct  35   EYLTGIKGTFGR-CGSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  93

Query  456  GYYIDAIGTY  485
            G Y+DAIG Y
Sbjct  94   GAYLDAIGVY  103


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK-DTLTIGGGGTETNV  239
            G+ GG  W+++ K+   +I+I+ G   ++    I F      GS  D+   GG G     
Sbjct  154  GNTGGSEWNYKLKSPTIEILIAHGDFIHS----IMFRTITEQGSTIDSPKFGGDGG----  205

Query  240  THNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
               D + I      YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   
Sbjct  206  -RRDKVVIKASPLVYLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVI  263

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  I GF G    Y+DAIG Y
Sbjct  264  KEGGAIEGFHGHCRAYLDAIGVY  286



>ref|XP_008221341.1| PREDICTED: uncharacterized protein LOC103321320 [Prunus mume]
Length=622

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 78/153 (51%), Gaps = 11/153 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V+ GP G   G  W     + + Q+VI+ G   ++  +      T     +     G GG
Sbjct  13   VSVGPWGGQTGLIWEDGVYSTVKQLVIAHGAAIDSIQVEYDEKGTSFWAERHG---GNGG  69

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T     DT+ +   +E+LT I G +G  +    V +RS+KF +N + +G +G   GT 
Sbjct  70   WKT-----DTVKLAYPEEFLTSIEGHYGKISEWGPVSIRSLKFKSNKKTYGPFGIEQGTY  124

Query  402  FNFQAQNG--NKIVGFFGRSGYYIDAIGTYNAP  494
            F+  A     +KIVGFFG+SG+++D+IG Y  P
Sbjct  125  FSLPAARAGSSKIVGFFGKSGWFLDSIGAYLKP  157


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D  +E LT I+GTFGA      NV++S+ F T  ++ G YG   GTPF  + + 
Sbjct  313  SDKIVFDFPNEILTHITGTFGAAMMMGPNVIKSLTFHTTKKKHGPYGEEQGTPFTTKLRE  372

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KIVG  GR G ++DA+G +
Sbjct  373  G-KIVGIHGRKGLFLDALGVH  392


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  428
            I ++   E LT ISG +G  + ++   +++S+ F T+  ++G +G  VGT F      G 
Sbjct  525  IKLEYPHEVLTCISGYYGCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  583

Query  429  KIVGFFGRSGYYIDAIGTY  485
            K+VG  GRS  Y+DAIG +
Sbjct  584  KVVGLHGRSSLYLDAIGVH  602



>ref|XP_009608041.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608042.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608043.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608044.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1582

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 78/143 (55%), Gaps = 12/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVT  242
            G+ GG  W+++ K+ I +I+I   G G+     I  + T+   + D+   GG G      
Sbjct  210  GNIGGSEWNYKLKSPIKEILI---GHGDFIDSIIFRTITEQGTTIDSPKFGGNGGRI---  263

Query  243  HNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  416
              D + I+    EYLT I GTFG + S  +V++ + F TN++ +G +G   G TPF+F  
Sbjct  264  --DKVVIEATSLEYLTGIKGTFGCYGSH-SVIKILCFITNSKNYGPFGSEAGGTPFSFVL  320

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            + G  IVGF G SG  ++AIG Y
Sbjct  321  K-GVAIVGFHGCSGVLLEAIGVY  342


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVT  242
            G+  G  W+++ K+ I +I+I+ G   ++  +R   + T+   + D+   G  G      
Sbjct  3    GNTDGSEWNYKLKSHIKEILIAHGDVIDSILLR---TITEQGTTIDSPMFGRNGGR----  55

Query  243  HNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  416
              D + I     EYLT I GTF  + S   V+ S+ F TNA+ +G +G   G TPF+F  
Sbjct  56   -RDKVVIKAPPLEYLTGIKGTFRRYGSH-LVINSLCFITNAKNYGPFGSEAGGTPFSFVM  113

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            +    I GF GR G Y+DAIG Y
Sbjct  114  KEVGAIEGFHGRCGAYLDAIGIY  136



>emb|CDM80625.1| unnamed protein product [Triticum aestivum]
 emb|CDM80626.1| unnamed protein product [Triticum aestivum]
Length=307

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +3

Query  270  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  449
            +DEYLT + G +G F     V+RS+KF +N R +G YG   G  F   A  G KI+GF  
Sbjct  231  QDEYLTSVHGHYGQFKGF-VVVRSLKFVSNLRSYGPYGKEDGVSFALHAGPGGKIIGFHA  289

Query  450  RSGYYIDAIGTYNAPD  497
            RSG ++DAIGTY   D
Sbjct  290  RSGQFLDAIGTYVKMD  305



>ref|XP_006473571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X1 [Citrus sinensis]
Length=619

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +A GP G   G  W       + Q+VI+ G     + I+I +      GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGA--GIDSIQIEYD--NKGGSCWSEKHGGNG  66

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                 T  D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT 
Sbjct  67   G----TKFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +3

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQ  413
            T+   I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  VGT F   
Sbjct  517  TYTHRIKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTST  576

Query  414  AQNGNKIVGFFGRSGYYIDAIGTY  485
               G K+VGF GRS +Y+DAIG +
Sbjct  577  TTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 68/148 (46%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            + YGP G  GG  ++      I QI +S       N   ++     +   K       GG
Sbjct  264  ITYGPWGGTGGSMFNDGTYTGIRQINLS------RNVGIVSMKVCYDQDGKAVWGSKHGG  317

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTP  401
            T      +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  
Sbjct  318  T--GGFRHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQS  375

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+ +   G KIVGF GR G ++DAIG Y
Sbjct  376  FSNKIGEG-KIVGFHGRDGLFLDAIGVY  402



>gb|EAY93469.1| hypothetical protein OsI_15270 [Oryza sativa Indica Group]
Length=150

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 73/147 (50%), Gaps = 10/147 (7%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTE  230
            +GP G  GG    +R        ++    R  +    I+F+    DG      +G  G++
Sbjct  8    FGPWGGPGG---DYRDVQVAPYRLVRLTIRSGDTVDGISFTYIGIDGL--VYHMGHWGSD  62

Query  231  TNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYG-PNVGTPF  404
              V H   +   G  +++ EISGT G + S   NVLRS+K TT  R +G YG P  G PF
Sbjct  63   GGVPHEIHL---GLMDFVMEISGTTGMWVSGMRNVLRSLKITTLKRTYGPYGNPEAGIPF  119

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +F     ++I GFF R+G+  DAIG Y
Sbjct  120  SFSVDGSDRITGFFVRAGFITDAIGVY  146



>ref|XP_006435072.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
 gb|ESR48312.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
Length=619

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +A GP G   G  W       + Q+VI+ G     + I+I +      GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGA--GIDSIQIEYD--NKGGSCWSEKHGGNG  66

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                 T  D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT 
Sbjct  67   G----TKFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +3

Query  240  THNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQ  413
            T+   I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  VGT F   
Sbjct  517  TYTHRIKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTST  576

Query  414  AQNGNKIVGFFGRSGYYIDAIGTY  485
               G K+VGF GRS +Y+DAIG +
Sbjct  577  TTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 68/148 (46%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            + YGP G  GG  ++      I QI +S       N   ++     +   K       GG
Sbjct  264  ITYGPWGGTGGSMFNDGTYTGIRQINLS------RNVGIVSMKVCYDQDGKAVWGSKHGG  317

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
            T      +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  
Sbjct  318  T--GGFRHDRVIFDYPYEILTQITGTYGPLMYMGPNIIRSLTFHTTKGKHGPFGEEQGQS  375

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+ +   G KIVGF GR G ++DAIG Y
Sbjct  376  FSNKIGEG-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X2 [Citrus sinensis]
Length=1252

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +A GP G   G  W       + Q+VI+ G     + I+I +      GS  +   GG G
Sbjct  644  IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGA--GIDSIQIEYD--NKGGSCWSEKHGGNG  699

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                 T  D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT 
Sbjct  700  G----TKFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  755

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  756  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  782


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +3

Query  213   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGP  386
             G GGT T+      I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G 
Sbjct  1146  GNGGTYTH-----RIKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGE  1200

Query  387   NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              VGT F      G K+VGF GRS +Y+DAIG +
Sbjct  1201  EVGTFFTSTTTEG-KVVGFHGRSSFYLDAIGVH  1232


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +3

Query  243   HNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQ  419
              +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  F+ +  
Sbjct  955   RHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIG  1014

Query  420   NGNKIVGFFGRSGYYIDAIGTY  485
              G KIVGF GR G ++DAIG Y
Sbjct  1015  EG-KIVGFHGRDGLFLDAIGVY  1035



>gb|KJB63589.1| hypothetical protein B456_010G007400 [Gossypium raimondii]
Length=599

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 78/151 (52%), Gaps = 12/151 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V+YGP G  GG +W       I Q+VI  G     + I+I +    N+G+       GG 
Sbjct  10   VSYGPWGGQGGLYWDDGVNFTIKQLVIVHGL--GIDSIQIEYD---NEGNSIWSRKHGGD  64

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVGTP  401
              + +   D + +D  +E+LT I G +G       ++ RS+   +N + +G YG   GT 
Sbjct  65   GGSKM---DKVKLDYPNEFLTSIHGYYGNLNERGPIMVRSLTLQSNRKAYGPYGVEQGTC  121

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+    N  KIVGF G+SG+Y+DAIG Y+ P
Sbjct  122  FSM---NRGKIVGFHGKSGWYLDAIGVYSMP  149


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 71/149 (48%), Gaps = 12/149 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            +AYGP G NGG  +       + QI +S     N   + I     +N  +      GG G
Sbjct  244  IAYGPWGGNGGTKFDDGTYTGVRQITLSR----NVGIVSIKVCYDRNGQAHWGSKHGGTG  299

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGT  398
            G +T     + I  D   E LT ++GTFG       NV++S+ F TN  + G YG   G 
Sbjct  300  GFKT-----ERIMFDYPSEILTHVTGTFGPLMYIGPNVIKSLTFYTNKGKHGPYGDEQGP  354

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             F+ +   G KIVGF G+ G ++DA G +
Sbjct  355  SFSNKINEG-KIVGFHGKEGLFLDAFGVH  382



>ref|XP_006654724.1| PREDICTED: agglutinin-like [Oryza brachyantha]
Length=200

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 74/150 (49%), Gaps = 12/150 (8%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G  GG  W       I  I +S+    ++  +    +     G +     G GG +T
Sbjct  11   GPWGGAGGSPWDDGGHTGIRSITLSYDRCVDSIAVEYDRNGVAVPGERHG---GAGGNQT  67

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASS--DNVLRSIKFTTNAREFGTYGPNV-GTPF  404
                   I +   +EY+T +SG +   A+   +  +RS+ FTTN RE+G +G    GTPF
Sbjct  68   T-----QIKLSFPEEYVTTVSGHYAPVAAHGGEPAIRSLAFTTNRREYGPFGAAAEGTPF  122

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F   +G  +VGF+GRSG  +DA+G + AP
Sbjct  123  TFPV-DGGAVVGFWGRSGRQLDAVGVHVAP  151



>ref|XP_011030089.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
 ref|XP_011030090.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
Length=191

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 79/159 (50%), Gaps = 18/159 (11%)
 Frame = +3

Query  18   HSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK  197
             ST    + +  GP G NGG  W     + + +I I +      + I++ +     D + 
Sbjct  7    QSTARKKSTILVGPWGGNGGNSWDDGIYHGVREITIVYDQ--CIDSIQVVY-----DKNG  59

Query  198  DTLTI----GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNA  362
             T+T     G GG+ T       I +   +EYLT +SG +         V+RS+ F++N 
Sbjct  60   KTITAENHGGVGGSRTA-----EIKLRYPEEYLTSVSGHYCPVVYGGSPVIRSLTFSSNK  114

Query  363  REFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  479
            R FG +G   GTPF   + +G  IVGF GRSG+Y+DAIG
Sbjct  115  RTFGPFGVEEGTPFTL-SMDGASIVGFKGRSGWYLDAIG  152



>ref|XP_010088386.1| hypothetical protein L484_008121 [Morus notabilis]
 gb|EXB34860.1| hypothetical protein L484_008121 [Morus notabilis]
Length=193

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 78/150 (52%), Gaps = 12/150 (8%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIG  215
            S  +A GP G NGG  W     + + +I + F  R  ++ IR+ +   KN         G
Sbjct  13   SKGIAVGPWGGNGGNSWDDGAYSGVREITL-FYDRCIDS-IRVVYD--KNGKPVAAEKHG  68

Query  216  G-GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPN  389
            G GG+ T       I ++  +EYL  +SG +       + V+RS+   +N R FG YG  
Sbjct  69   GIGGSRTA-----EIKLNYPEEYLVSVSGYYCPVVHGGSPVIRSLTLKSNKRTFGPYGVE  123

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  479
             GTPF+F  Q G  IVGF GR+G+Y+DAIG
Sbjct  124  EGTPFSFPIQ-GGLIVGFKGRNGWYLDAIG  152



>ref|XP_011074623.1| PREDICTED: jacalin-related lectin 3 [Sesamum indicum]
Length=670

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 77/148 (52%), Gaps = 10/148 (7%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G +W     + I Q+ I  G     + IRI + +T      +    G GGT+T
Sbjct  14   GPWGGQSGYYWDDGVHSTIRQLEIGHGT--GVDSIRIEYDSTGRSVWSERHG-GSGGTKT  70

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVGTPFNF  410
                 D + ++  DE+L  + G +G+     +V+ RS+ F +N R++G +G   GT F  
Sbjct  71   -----DKVRLEYPDEFLISVHGYYGSLQERGHVIIRSLTFESNKRKYGPFGVEKGTYFTS  125

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
               +G KIVGF G++G+Y+DAIG Y  P
Sbjct  126  STTHG-KIVGFVGKAGWYLDAIGFYIEP  152


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            D + +D   E LT +SG +G         V++S+ F T+ R +G +G  +GT F      
Sbjct  570  DRVKLDYPHEVLTCVSGYYGPIKKEQGTKVIQSLTFHTSRRTYGPFGQELGTYFASGTTE  629

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G K+VGF GRS  Y+DAIG +
Sbjct  630  G-KVVGFHGRSSMYLDAIGVH  649


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 23/155 (15%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQI-------VISFGGRGNNNPIRITFSATKNDGSKDT  203
            V YGP G +GG  +     + I QI       V+S         IR+ +     DG    
Sbjct  255  VTYGPWGGSGGSLFDDGVYDGIRQINVYRNVGVVS---------IRVCYD---KDGKAVW  302

Query  204  LTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTY  380
             +  GG   T    +D I  D   E LT ++G          +V++S+ F T   ++G Y
Sbjct  303  GSKNGG---TGSFKSDKIVFDYPSEILTHLTGYHAPTMIMGPDVIKSLTFHTTKGKYGPY  359

Query  381  GPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            G   G  F+ + + G+ +VGF GR G ++DA+G +
Sbjct  360  GEEQGEFFSTKLKEGSMVVGFHGRKGLFVDAVGVH  394



>ref|XP_007222058.1| hypothetical protein PRUPE_ppa003185mg [Prunus persica]
 gb|EMJ23257.1| hypothetical protein PRUPE_ppa003185mg [Prunus persica]
Length=595

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 78/153 (51%), Gaps = 11/153 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V+ GP G   G  W     + + Q+VI+ G   ++  +      T     +     G GG
Sbjct  12   VSVGPWGGQTGLIWEDGVYSTVKQLVIAHGAAIDSIQVEYDEKGTSFWAERHG---GNGG  68

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T     DT+ +   +E+LT I G +G  +    V +RS+KF +N + +G +G   GT 
Sbjct  69   WKT-----DTVKLAYPEEFLTSIEGHYGKISEWGPVSIRSLKFKSNKKTYGPFGIEQGTY  123

Query  402  FNFQAQNG--NKIVGFFGRSGYYIDAIGTYNAP  494
            F+  A     +KIVGFFG+SG+++D+IG Y  P
Sbjct  124  FSLPAARAGSSKIVGFFGKSGWFLDSIGAYLRP  156


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D  +E LT I+GTFGA       V++S+ F T  ++ G YG   GTPF  + + 
Sbjct  286  SDKIVFDFPNEILTHITGTFGAAMMMGPIVIKSLTFHTTKKKHGPYGEEQGTPFTTKLRE  345

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KIVG  GR G ++DA+G +
Sbjct  346  G-KIVGIHGRKGLFLDALGVH  365


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  428
            I ++   E LT ISG +G  + ++   +++S+ F T+  ++G +G  VGT F      G 
Sbjct  498  IKLEYPHEVLTCISGYYGCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  556

Query  429  KIVGFFGRSGYYIDAIGTY  485
            K+VG  GRS +Y+DAIG +
Sbjct  557  KVVGLHGRSSFYLDAIGVH  575



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  452
            EYLT I GTFG    S +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  29   EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGR  87

Query  453  SGYYIDAIGTY  485
             G Y+DAIG Y
Sbjct  88   CGAYLDAIGVY  98



>ref|XP_010664949.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 
[Vitis vinifera]
Length=1593

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/157 (33%), Positives = 77/157 (49%), Gaps = 12/157 (8%)
 Frame = +3

Query  30    SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
             S    ++ GP G   G  W     + + Q+VI+ G   ++    I     KN  S  +  
Sbjct  959   SFDNPISVGPWGGQDGLRWDDGVYSTVRQLVIAHGVGIDS----ILIEYDKNGSSVWSEK  1014

Query  210   IGG-GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYG  383
              GG GGT TN      + +D  DE+LT I G +G+      V +RS+   +N R +G +G
Sbjct  1015  HGGSGGTRTN-----RVKLDSPDEFLTSIHGHYGSLLERGPVFVRSLTLESNKRTYGPFG  1069

Query  384   PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                G  F+     G KI+GF G+SG+Y+DAIG +  P
Sbjct  1070  IEQGIYFSLPT-TGGKIIGFHGKSGWYLDAIGVHLKP  1105


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 52/152 (34%), Positives = 72/152 (47%), Gaps = 18/152 (12%)
 Frame = +3

Query  45    VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKND----GSKDTLTI  212
             V YGP G  GG  +       + QI +S     N   + I     +N     GSK+    
Sbjct  1230  VTYGPWGGKGGFVFDDGVSTGVRQINLS----RNIGIVSIKVLYDQNGQAVWGSKNG---  1282

Query  213   GGGGTETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPN  389
             G GG       ND I ID   E LT I+G +        N+++S+ F T   ++G +G  
Sbjct  1283  GTGGFR-----NDKIVIDYPYEVLTHITGYYAPTMVMGPNIIKSLTFHTTKTKYGPFGEE  1337

Query  390   VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              GTPF+   + G  IVGF GR+G +IDAIG +
Sbjct  1338  QGTPFSSNIKEG-VIVGFHGRTGLFIDAIGVH  1368


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/91 (33%), Positives = 50/91 (55%), Gaps = 5/91 (5%)
 Frame = +3

Query  219   GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNV  392
             GG     TH   + ++   E ++ I G +G  + ++  N ++S+ F T+  ++G +G  +
Sbjct  1486  GGDYGTTTHR--VKLEYPHEVVSCICGYYGPISINEPWNAIKSLTFYTSRGKYGPFGEEI  1543

Query  393   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             GT F      G K+VGF GRS  Y+DAIG +
Sbjct  1544  GTYFTSTRTEG-KVVGFHGRSSLYLDAIGVH  1573



>ref|XP_009413293.1| PREDICTED: protein GOS9-like [Musa acuminata subsp. malaccensis]
Length=142

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 77/156 (49%), Gaps = 15/156 (10%)
 Frame = +3

Query  33   ISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI  212
            ++ ++  G  G NGG  W      +I  I I  G   N + I ITF+     G  +T   
Sbjct  1    MAGEIKVGLWGGNGGSEWDMGAAYRITNIKIRAGD--NIDAIVITFT---RYGLTETKHF  55

Query  213  GG-GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  389
            GG GGT   +          EDEYL  + G+         ++R++   TN + +G +G +
Sbjct  56   GGSGGTPYEIPLQ-------EDEYLVGVEGSVDTLGRI-TLVRNLTLRTNKKSYGPFGTS  107

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAPD  497
             G PF+    +G KI+GFFGR+G  IDAIG Y AP+
Sbjct  108  GGKPFSVPVASG-KIIGFFGRAGTMIDAIGVYLAPN  142



>ref|XP_006644795.1| PREDICTED: mannose/glucose-specific lectin-like [Oryza brachyantha]
Length=600

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  27   MSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTL  206
            M+    +  GP G  GG  W     + + QIVI+ G   ++  I            K   
Sbjct  1    MNAKNPIPVGPWGGLGGTTWDDGVHSTVRQIVITHGTAIDSIKIEYDLKGKSIWSEKHG-  59

Query  207  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  386
              G GGT+      D + +D   E LT +SG +G+      V+RS+ F +N  ++G +G 
Sbjct  60   --GDGGTKI-----DQVKLDYPQEILTSVSGYYGSLGGC-VVVRSLTFGSNLSKYGPFGA  111

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              GTPF+       K+VGF GRSG+++D+IG +
Sbjct  112  EQGTPFSLPVAITGKVVGFHGRSGWFLDSIGCH  144


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 73/156 (47%), Gaps = 12/156 (8%)
 Frame = +3

Query  24   TMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDT  203
            TM+IST V +GP G NGG  +       + QI ++ G         +  S+ K    ++ 
Sbjct  244  TMTISTPVRFGPWGGNGGTIFDDGICTGVRQINLTRG---------LGISSMKVLYDRNG  294

Query  204  LTIGGGGT-ETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGT  377
              I G     +     + +  D   E LT I+G FG        V++S+ F T  +  G 
Sbjct  295  QAIWGDKRGASGAARAEKVVFDFPSEILTHITGYFGPTMIMGSTVIKSLTFHTTKKSHGP  354

Query  378  YGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G   GT F+     G +IVGF GR G+YID+IG +
Sbjct  355  FGDENGTFFSSCLTEG-RIVGFHGREGWYIDSIGVH  389


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = +3

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNF  410
             +TH   I +D   E LT + G +         VLRSI   ++  ++G +G  +GT F+ 
Sbjct  494  QITHR--IKLDYPHEVLTCVYGYYNTCPEEGPRVLRSITLVSSRGKYGPFGEEIGTYFSS  551

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
                G K+VGF GRSG Y+DAIG +
Sbjct  552  ATTEG-KVVGFHGRSGQYLDAIGVH  575



>ref|XP_010233169.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=1055

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (50%), Gaps = 8/149 (5%)
 Frame = +3

Query  39   TDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG  218
            + +  GP G  GG  W       I Q VI+ G   ++  IRI +    N     T     
Sbjct  466  SPIVVGPWGGTGGYPWDDGVYTTIRQFVITHGAAIDS--IRIEYDLKGNSVWSKTHGSND  523

Query  219  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  398
             G+E      D + +D  +E L  +SG +G+   +  ++RS+ F +N  ++G +G   GT
Sbjct  524  EGSEI-----DKVKLDFPEEILVSVSGHYGSVCGTPVIIRSLTFQSNHTKYGPFGTEDGT  578

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            PF+    +G KI+GF GRSG Y+ +IG Y
Sbjct  579  PFSLPVSSG-KIIGFHGRSGSYLSSIGFY  606


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +3

Query  222   GTETNVTHNDTINIDGEDEYLTEISGTF--GAFASSDNVLRSIKFTTNAREFGTYGPNVG  395
             GT  ++TH   + +D   E LT + G +  G       VLRSI F +N   +G +G  VG
Sbjct  946   GTSGHITHR--VKLDSPHEVLTSVRGYYNTGGEDGGPRVLRSITFVSNRGRYGPFGDEVG  1003

Query  396   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
               F+  A    K+VGF GRSG Y+DAIG +
Sbjct  1004  VYFSSPATVEGKVVGFHGRSGQYLDAIGLH  1033


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +G        V+RS+ F TN R +G YG   GT F+    NG
Sbjct  764  DKIAFDFPSEILTHITGFYGPTMIMGPTVVRSLTFHTNKRRYGPYGDEYGTYFSTSFTNG  823

Query  426  NKIVGFFGRSGYYIDAIGTY  485
             +IVGF GR G+YID IG +
Sbjct  824  -RIVGFHGRDGWYIDGIGVH  842



>emb|CBI19765.3| unnamed protein product [Vitis vinifera]
Length=670

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 78/161 (48%), Gaps = 12/161 (7%)
 Frame = +3

Query  18   HSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSK  197
            H   S    ++ GP G   G  W     + + Q+VI+ G   ++    I     KN  S 
Sbjct  32   HHAFSFDNPISVGPWGGQDGLRWDDGVYSTVRQLVIAHGVGIDS----ILIEYDKNGSSV  87

Query  198  DTLTIGG-GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREF  371
             +   GG GGT TN      + +D  DE+LT I G +G+      V +RS+   +N R +
Sbjct  88   WSEKHGGSGGTRTN-----RVKLDSPDEFLTSIHGHYGSLLERGPVFVRSLTLESNKRTY  142

Query  372  GTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            G +G   G  F+     G KI+GF G+SG+Y+DAIG +  P
Sbjct  143  GPFGIEQGIYFSLPT-TGGKIIGFHGKSGWYLDAIGVHLKP  182


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            ND I ID   E LT I+G +        N+++S+ F T   ++G +G   GTPF+   + 
Sbjct  366  NDKIVIDYPYEVLTHITGYYAPTMVMGPNIIKSLTFHTTKTKYGPFGEEQGTPFSSNIKE  425

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G  IVGF GR+G +IDAIG +
Sbjct  426  G-VIVGFHGRTGLFIDAIGVH  445



>gb|EAY96520.1| hypothetical protein OsI_18424 [Oryza sativa Indica Group]
Length=144

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 9/114 (8%)
 Frame = +3

Query  162  ITFSATKNDGSKDTL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLR  338
            ++F+    DG+K      GG G E    H   +   GE E +TE+SGT G +     V+R
Sbjct  37   LSFTYAAIDGAKHAAGPWGGSGGEK---HKVKL---GEAERITEVSGTLGPWGPHACVVR  90

Query  339  SIKFTTNA-REFGTYGPNVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            S+ F T+A +  G +G  VG   F    + G ++VGFF RSG+ +DA+G Y  P
Sbjct  91   SLAFVTSAGKTHGPFGEEVGGAAFRVPVKGGGRVVGFFARSGWLLDAVGVYVHP  144



>ref|XP_004490606.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Cicer 
arietinum]
Length=605

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 79/162 (49%), Gaps = 10/162 (6%)
 Frame = +3

Query  3    LLFNYHSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATK  182
            +L    S  SI    + GP G NGG  W     + + Q+VI  G     + I+I +   K
Sbjct  2    MLCIQSSDDSIKKPASVGPWGGNGGSRWDDGIYSGVRQLVIIHGT--GIDSIQIEYDK-K  58

Query  183  NDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTN  359
                      G GG +T     D + +D  DE+LT I G +G+      N++RS+ F +N
Sbjct  59   GSSIWSEKHGGSGGNKT-----DKVKLDYPDEFLTSIHGYYGSLNQWGHNLVRSLSFESN  113

Query  360  AREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             + +G +G   GT F+     G KIVGF G  G+Y+DAIG Y
Sbjct  114  KKTYGPFGVEHGTFFSV-PMTGAKIVGFHGSCGWYLDAIGVY  154


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 57/110 (52%), Gaps = 7/110 (6%)
 Frame = +3

Query  162  ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VL  335
            I     +N  S  ++  GG G +T       I ++   E LT ISG +G+    +N  ++
Sbjct  482  IQIEYDRNRQSVWSVKHGGNGGDTM----HRIQLEYPHEVLTCISGYYGSITKDENQTII  537

Query  336  RSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +S+ F T+  ++G YG  VG  F      G K+VGF GRS  Y+DAIG +
Sbjct  538  KSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  586


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            ND I  D   E LT ISG +G        V+RS+ F T  R++G +G   GT F  + + 
Sbjct  309  NDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYGPFGEEQGTYFTTKVKE  368

Query  423  GNKIVGFFGRSGYYIDAIG  479
            G KIVG  G+ G ++DA G
Sbjct  369  G-KIVGIHGKKGLFLDAFG  386



>ref|XP_007142198.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
 gb|ESW14192.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
Length=507

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 75/153 (49%), Gaps = 10/153 (7%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            SI    + GP G NGG  W     + + Q+VI  G     + I+I +   K         
Sbjct  6    SIKKPQSVGPWGGNGGSPWDDGVYSGVRQLVIVHGA--GIDSIQIEYDK-KGSSIWSEKH  62

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGP  386
             G GG +T     D +  D   E LT+I G  G+F     N++RS+ F +N + +G +G 
Sbjct  63   GGSGGRKT-----DKVKFDYPKEILTKIHGYCGSFNQLGPNLVRSLSFESNKKTYGPFGV  117

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              GT F+     G KIVGF GR G+YIDAIG Y
Sbjct  118  EQGTYFSVPL-TGAKIVGFHGRCGWYIDAIGVY  149



>ref|XP_007142199.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
 gb|ESW14193.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
Length=598

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 75/153 (49%), Gaps = 10/153 (7%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            SI    + GP G NGG  W     + + Q+VI  G     + I+I +   K         
Sbjct  6    SIKKPQSVGPWGGNGGSPWDDGVYSGVRQLVIVHGA--GIDSIQIEYDK-KGSSIWSEKH  62

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGP  386
             G GG +T     D +  D   E LT+I G  G+F     N++RS+ F +N + +G +G 
Sbjct  63   GGSGGRKT-----DKVKFDYPKEILTKIHGYCGSFNQLGPNLVRSLSFESNKKTYGPFGV  117

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              GT F+     G KIVGF GR G+YIDAIG Y
Sbjct  118  EQGTYFSVPL-TGAKIVGFHGRCGWYIDAIGVY  149



>gb|EMS51533.1| hypothetical protein TRIUR3_05238 [Triticum urartu]
Length=304

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = +3

Query  243  HNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQ  419
            H   I +   DE+LT +SG +GA A     V+RS+ F T    +G +G   GTPF F A 
Sbjct  163  HTTQIKLSFPDEHLTAVSGRYGAVAPGGSPVIRSLAFRTERAAYGPFGAAEGTPFEF-AV  221

Query  420  NGNKIVGFFGRSGYYIDAIGTYNAP  494
             G  IVG  GRSG+ +DA+G Y  P
Sbjct  222  EGGVIVGLCGRSGWQLDAVGMYVTP  246



>ref|NP_001054618.1| Os05g0143600 [Oryza sativa Japonica Group]
 gb|AAU90197.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16532.1| Os05g0143600 [Oryza sativa Japonica Group]
 gb|EEE62296.1| hypothetical protein OsJ_17084 [Oryza sativa Japonica Group]
Length=152

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 9/114 (8%)
 Frame = +3

Query  162  ITFSATKNDGSKDTL-TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLR  338
            ++F+    DG+K      GG G E    H   +   GE E +TE+SGT G +     V+R
Sbjct  45   LSFTYAAIDGAKHAAGPWGGSGGEK---HKVKL---GEAERVTEVSGTLGPWGPHACVVR  98

Query  339  SIKFTTNA-REFGTYGPNVG-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            S+ F T+A +  G +G  VG   F    + G ++VGFF RSG+ +DA+G Y  P
Sbjct  99   SLAFVTSAGKTHGPFGEEVGGAAFRVPVKGGGRVVGFFARSGWLLDAVGVYVHP  152



>ref|XP_006372328.1| hypothetical protein POPTR_0017s00620g, partial [Populus trichocarpa]
 gb|ERP50125.1| hypothetical protein POPTR_0017s00620g, partial [Populus trichocarpa]
Length=151

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 81/161 (50%), Gaps = 16/161 (10%)
 Frame = +3

Query  3    LLFNYHSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATK  182
            LL N H ++S+      G  G  GG  +SFR  + I +I++  G     N   ++F    
Sbjct  7    LLANSHGSISV------GQWGGPGGDPFSFRVGSWIKEIIVHEG----TNIKSLSF----  52

Query  183  NDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNA  362
             DG+       GG    +      I IDG  E+LT I+GT+G +A    V+ S+ F TN 
Sbjct  53   KDGNDQEYGKFGGNNANDTGEERRIEIDGLSEHLTSITGTYGNYAGI-VVITSLSFITNL  111

Query  363  REFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
               G +G   GT F+   + G+ ++GF GRSG+Y DAIG +
Sbjct  112  TTHGPFGTATGTSFSVPIE-GSVVIGFHGRSGHYFDAIGIH  151



>ref|XP_002439182.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
 gb|EES17612.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
Length=304

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 65/134 (49%), Gaps = 14/134 (10%)
 Frame = +3

Query  96   PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTI--GGGGTETNVTHNDTINIDG  269
            P  ++  + I    R  +    I F+   N G K T     G GGT   +  +D      
Sbjct  183  PPKRLQSLTI----RSGSAIDAIEFTYIDNAGQKHTAGAWGGPGGTAHRIDLDDA-----  233

Query  270  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  449
              EY+ E+SGT+G F     VL S K  TN R +G +    GTPF+  A   + IVGF+G
Sbjct  234  --EYVKEVSGTYGTF-EGITVLTSFKLVTNVRTWGPWAIENGTPFSITAPTNSSIVGFYG  290

Query  450  RSGYYIDAIGTYNA  491
            R+G  IDAIG Y A
Sbjct  291  RAGRLIDAIGVYFA  304



>gb|KDP38566.1| hypothetical protein JCGZ_04491 [Jatropha curcas]
Length=545

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 73/151 (48%), Gaps = 9/151 (6%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G   G  W     N + Q+VI  G    +  ++  +   K          G GG
Sbjct  12   ISVGPWGGQNGVRWDDGVFNSVRQVVICHGAAIES--VQFEYIDKKGISVWSDKHGGTGG  69

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVGTP  401
              TN      + +D  DEYL  I G +G+      +L RS+ F +N R++G +G  +GT 
Sbjct  70   IRTN-----KVKLDFPDEYLVTIIGHYGSVVDYGPILVRSLVFESNRRKYGPFGIQMGTD  124

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+F    G K++GF GR  +Y+D+IG Y  P
Sbjct  125  FSFPL-TGGKVIGFHGRCSWYLDSIGVYLKP  154


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            D I  D   E LT I+G +G+       V++S+ F TN R++G +G   G  F+    N 
Sbjct  267  DKIAFDYPSEILTRITGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGISFSSAGSNN  326

Query  426  NK-IVGFFGRSGYYIDAIGTYNAP  494
            N+ IVGF GR G++ID+IG ++ P
Sbjct  327  NEMIVGFHGRKGWFIDSIGVHSRP  350


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 6/92 (7%)
 Frame = +3

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPN  389
            GGG+E +   +  I ++   E LT + G +G+    D   V+RS+ F TN  ++G +G  
Sbjct  432  GGGSEAS---SHLIKLEYPYEILTSVCGYYGSLTGDDCNTVIRSLTFYTNKGKYGPFGEE  488

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            VG+ F   A+   KIVGF GRSG Y++AIG +
Sbjct  489  VGSFFT-SAKTEGKIVGFHGRSGCYLNAIGVH  519



>gb|EAY90359.1| hypothetical protein OsI_11939 [Oryza sativa Indica Group]
Length=150

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 4/111 (4%)
 Frame = +3

Query  162  ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRS  341
            I+FS    D  K   T+G  G +  V+  +TI ++   EY+ E+ G+ G      +V+ S
Sbjct  43   ISFSYLDKD--KTLHTVGPWGGQGGVS-EETITLE-PSEYVKEVHGSVGPIGDYTHVVTS  98

Query  342  IKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +K  TN R  G +G   GTPF     N   +VGFF R+G Y+++IG Y  P
Sbjct  99   LKLVTNQRTIGPFGNGAGTPFAVPVLNNGSVVGFFARAGPYLESIGIYVHP  149



>gb|EAZ25557.1| hypothetical protein OsJ_09383 [Oryza sativa Japonica Group]
Length=126

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E++T++ GT G F    +V+ SI FTTNA  +G +G   GT F     +   IVGFF
Sbjct  50   GPSEFVTKVYGTIGPFGKFSSVITSIHFTTNADRYGPFGQGTGTRFEAPMHSDGSIVGFF  109

Query  447  GRSGYYIDAIGTYNAP  494
            GR+  Y+DAIG Y  P
Sbjct  110  GRTSSYVDAIGFYVVP  125



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 62/108 (57%), Gaps = 5/108 (5%)
 Frame = +3

Query  162  ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRS  341
            + FS +K++G K    IG  G    ++H  T+   G  E+L  + GT G F +S  V+ S
Sbjct  731  LAFSYSKSNGQK--YDIGPWGGPGGMSH--TVKF-GSSEFLVRVFGTIGPFRASRCVVTS  785

Query  342  IKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            + F TN R +G +G   GTPF+   Q+  KIVGFFG +  Y++A+G Y
Sbjct  786  VTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGFFGHARSYVEALGVY  833


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 71/147 (48%), Gaps = 10/147 (7%)
 Frame = +3

Query  51   YGPLGHNGGGFWSFR-PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            +GP G  GG  +    P +++  + I  G   ++    + FS    +G   T+   GG  
Sbjct  376  FGPWGGKGGSAYDIEVPPHRLYSVTICSGEIIDS----LAFSYIGPNGQSITIGPWGGNP  431

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPF  404
              +     TI + G  E+L E+SGT G FA+S  NV+ S+   TN   +G +G   G PF
Sbjct  432  GPSPY---TIQL-GPSEFLLEVSGTIGRFANSRSNVITSLTLVTNEDRYGHFGTERGDPF  487

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTY  485
                Q    IVGFF R+  Y+ AIG Y
Sbjct  488  CTTLQTNCSIVGFFARASRYMHAIGVY  514



>ref|XP_004490607.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Cicer 
arietinum]
Length=600

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 76/153 (50%), Gaps = 10/153 (7%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            SI    + GP G NGG  W     + + Q+VI  G     + I+I +   K         
Sbjct  6    SIKKPASVGPWGGNGGSRWDDGIYSGVRQLVIIHGT--GIDSIQIEYDK-KGSSIWSEKH  62

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGP  386
             G GG +T     D + +D  DE+LT I G +G+      N++RS+ F +N + +G +G 
Sbjct  63   GGSGGNKT-----DKVKLDYPDEFLTSIHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGV  117

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              GT F+     G KIVGF G  G+Y+DAIG Y
Sbjct  118  EHGTFFSV-PMTGAKIVGFHGSCGWYLDAIGVY  149


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 57/110 (52%), Gaps = 7/110 (6%)
 Frame = +3

Query  162  ITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VL  335
            I     +N  S  ++  GG G +T       I ++   E LT ISG +G+    +N  ++
Sbjct  477  IQIEYDRNRQSVWSVKHGGNGGDTM----HRIQLEYPHEVLTCISGYYGSITKDENQTII  532

Query  336  RSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +S+ F T+  ++G YG  VG  F      G K+VGF GRS  Y+DAIG +
Sbjct  533  KSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  581


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            ND I  D   E LT ISG +G        V+RS+ F T  R++G +G   GT F  + + 
Sbjct  304  NDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYGPFGEEQGTYFTTKVKE  363

Query  423  GNKIVGFFGRSGYYIDAIG  479
            G KIVG  G+ G ++DA G
Sbjct  364  G-KIVGIHGKKGLFLDAFG  381



>ref|XP_006853909.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
 gb|ERN15376.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
Length=196

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 74/145 (51%), Gaps = 10/145 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G  GG  W     + ++QI + +      + IR+ +    +   K  +    GG
Sbjct  24   IKIGPWGGQGGSPWDDGSFDGVSQITLVYDR--CIDSIRVEY----DKNGKLVMAEKHGG  77

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTP  401
               N  H   I +   +E++TE+SG +         V+RS+KF T+ R +G YG   GTP
Sbjct  78   DGGN--HTAHIKLQYPEEFITEVSGHYCPVVHGGTPVIRSLKFITSKRTYGPYGVEEGTP  135

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAI  476
            F+F   +G  IVGF GR+G+Y+DAI
Sbjct  136  FSF-LMDGGLIVGFKGRNGWYLDAI  159



>gb|KHN02073.1| Agglutinin [Glycine soja]
Length=607

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 10/147 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V+ GP G NGG  W     + + Q+VI  G     + I+I +   K   S  +L  GG G
Sbjct  8    VSVGPWGGNGGYHWDDGVYSTVRQLVIVHGE--GIDSIQIEYD--KQGSSIWSLKYGGSG  63

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                    D I +D  DE+LT I G +G+ +    + +RS+ F +N + +G +G   GT 
Sbjct  64   G----YKIDKIKLDYPDEFLTSIEGYYGSLSQWGPIFIRSLSFESNKKLYGPFGVEQGTY  119

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGT  482
            F+     G KIVGF GR G+++DAIG 
Sbjct  120  FSL-PMTGGKIVGFHGRYGWHLDAIGV  145


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (51%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QI ++    G  + I+I +   K    +   ++  GG   N  H   I ++  +E LT
Sbjct  468  IKQIYLTKAPEGICS-IQIEYDRYK----QSVWSVKHGGNGGNTMHR--IKLEYPNEVLT  520

Query  288  EISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             ISG +G+  + +   +++S+ F T+  ++G +G  VG  F      G K+VG  GRS  
Sbjct  521  CISGYYGSVTADEQPIIIKSLTFHTSRGQYGPFGDEVGKYFTSTTTEG-KVVGLHGRSSM  579

Query  462  YIDAIGTY  485
            Y+DAIG +
Sbjct  580  YLDAIGVH  587


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 73/163 (45%), Gaps = 12/163 (7%)
 Frame = +3

Query  3    LLFNYHSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATK  182
            ++F   +   +   V YGP G  GG  +   P   + QI +S      N  I    +   
Sbjct  221  IVFVEKAPSMVEGVVTYGPWGGTGGYVFDDGPYTGVRQIDLS-----RNVGIVWIRALYD  275

Query  183  NDGSKDT-LTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTT  356
             DG        GG G       ++ I  D   E LT ISG +G+       V+RS+ F T
Sbjct  276  LDGEPVWGYKHGGAGG----FKHEKIIFDFPYEVLTHISGYYGSLMYMGPAVIRSLTFHT  331

Query  357  NAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              R +G +G   GT F  + + G K+VG  GRSG ++D++G +
Sbjct  332  TKRSYGPFGDEYGTYFTTKLREG-KVVGIHGRSGLFLDSLGVH  373



>ref|XP_010060992.1| PREDICTED: jacalin-related lectin 3 [Eucalyptus grandis]
 gb|KCW67893.1| hypothetical protein EUGRSUZ_F01603 [Eucalyptus grandis]
Length=598

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 78/152 (51%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            V+ GP G   G  W     + + Q+VI+ G     + I+I +    N  S  T   GG G
Sbjct  11   VSVGPWGGQDGFRWDDGVYSTVRQLVIAHGA--GIDSIQIEYDMKGN--SIWTEKHGGNG  66

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVGT  398
            G +      DT+ +D  DE+L  + G +G       +L RS+ F +N + +G YG   G 
Sbjct  67   GCKV-----DTVKLDFPDEFLISVHGHYGKINDWGPILVRSLTFESNRKTYGPYGVQQGG  121

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F+F +  G KIVGF G++G+Y+DAIG Y  P
Sbjct  122  SFSFPSTTG-KIVGFHGKAGWYLDAIGVYLKP  152


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I +D  DE LT I+GT G   S    ++RSI F TN  + G +G   G  F  +++ 
Sbjct  305  HDKIVLDYPDEVLTHITGTCGPLMSMGPTIIRSIAFHTNRGKHGPFGEERGASFTSKSKE  364

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KI+GF GR G +IDAIG +
Sbjct  365  G-KIIGFHGRGGLFIDAIGIH  384


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 69/148 (47%), Gaps = 13/148 (9%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G  W     + I QI+++           I     +N  S  ++  GG G  T
Sbjct  440  GPWGGEFGRPWDDGVFSGIRQIILTR----TEAICSIQIEYDRNGQSVWSVRHGGNGGLT  495

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSD----NVLRSIKFTTNAREFGTYGPNVGTP  401
              TH   I ++  +E LT ISG +G     +      +RS+ F T+  ++G +G  VGT 
Sbjct  496  --THR--IKLEYPNEVLTCISGYYGPVGKDEWPQPQFIRSLTFHTSRGKYGPFGEEVGTF  551

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F      G K+VGF GRS  Y+DAIG +
Sbjct  552  FTSTTTEG-KVVGFHGRSSLYLDAIGVH  578



>gb|EMT07330.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=885

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 43/106 (41%), Positives = 61/106 (58%), Gaps = 8/106 (8%)
 Frame = +3

Query  180  KNDGSKDTLTIGG-GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTT  356
            KN+   +T   GG GGT     H  TI ++   E + EISGTFG +    ++++S+   T
Sbjct  787  KNENLHETPLWGGVGGT----IH--TILLE-PSELVLEISGTFGPYGQFPSIIKSLMLVT  839

Query  357  NAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            N R +G +G   GTPF+ + +    IVGFFG SG ++DAIG Y  P
Sbjct  840  NLRTYGPFGQLHGTPFHSRVKKNGTIVGFFGCSGEFLDAIGVYIHP  885



>ref|XP_010477194.1| PREDICTED: jacalin-related lectin 3-like isoform X1 [Camelina 
sativa]
Length=624

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 84/167 (50%), Gaps = 10/167 (6%)
 Frame = +3

Query  6    LFNYHSTMSISTDV---AYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSA  176
            +F  H  + +S +    + GP G   G  W       + QI+I  G   + + I++ +  
Sbjct  19   VFRVHLNLRMSVECKPASVGPWGGQSGHAWDDGMYTTVRQIIIGHGS--SIDSIQVEY--  74

Query  177  TKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFT  353
             + +G        GG         D + +D   EYL  ++GT+G+F A  +  +RS+   
Sbjct  75   -EKNGCSVWSEKRGGKGGKGGKKTDNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILE  133

Query  354  TNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            +N R++G +G   GT F    ++G+KI+GF G++G+YIDAIG +  P
Sbjct  134  SNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGKAGWYIDAIGVHIQP  179


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  324  HDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDE  383

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G K+VGF GR G ++DAIG +
Sbjct  384  G-KVVGFLGREGLFLDAIGVH  403


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QI ++   RGN+    I     +N  S    +   GG     TH   I ++  +E LT
Sbjct  484  IKQIFVT---RGNDAISSIQIEYDRNGQS--VWSTKHGGNNGVATHR--IKLEYPNETLT  536

Query  288  EISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             ISG +G   +SD  NV++S+ F T+  ++G YG   GT F     +G K++GF GR G 
Sbjct  537  CISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEECGTFFTSTTTHG-KVLGFHGRCGC  595

Query  462  YIDAIGTY  485
             +DAIG +
Sbjct  596  NLDAIGVH  603



>ref|XP_006602089.1| PREDICTED: agglutinin-like [Glycine max]
Length=589

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 10/147 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            V+ GP G NGG  W     + + Q+VI  G     + I+I +   K   S  +L  GG G
Sbjct  8    VSVGPWGGNGGYHWDDGVYSTVRQLVIVHGE--GIDSIQIEYD--KQGSSIWSLKYGGSG  63

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
                    D I +D  DE+LT I G +G+ +    + +RS+ F +N + +G +G   GT 
Sbjct  64   G----YKIDKIKLDYPDEFLTSIDGYYGSLSQWGPIFIRSLSFESNKKLYGPFGVEQGTY  119

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGT  482
            F+     G KIVGF GR G+++DAIG 
Sbjct  120  FSL-PMTGGKIVGFHGRYGWHLDAIGV  145


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (51%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QI ++    G  + I+I +   K    +   ++  GG   N  H   I ++  +E LT
Sbjct  450  IKQIYLTKAPEGICS-IQIEYDRYK----QSVWSVKHGGNGGNTMHR--IKLEYPNEVLT  502

Query  288  EISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             ISG +G+  + +   +++S+ F T+  ++G +G  VG  F      G K+VG  GRS  
Sbjct  503  CISGYYGSVTADEQPIIIKSLTFHTSRGQYGPFGDEVGKYFTSTTTEG-KVVGLHGRSSM  561

Query  462  YIDAIGTY  485
            Y+DAIG +
Sbjct  562  YLDAIGVH  569


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 73/163 (45%), Gaps = 12/163 (7%)
 Frame = +3

Query  3    LLFNYHSTMSISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATK  182
            ++F   +   +   V YGP G  GG  +   P   + QI +S      N  I    +   
Sbjct  221  IVFVEKAPSMVEGVVTYGPWGGTGGYVFDDGPYTGVRQIDLS-----RNVGIVWIRALYD  275

Query  183  NDGSKDT-LTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTT  356
             DG        GG G       ++ I  D   E LT ISG +G+       V+RS+ F T
Sbjct  276  LDGEPVWGYKHGGAGG----FKHEKIIFDFPYEVLTHISGYYGSLMYMGPAVIRSLTFHT  331

Query  357  NAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              R +G +G   GT F  + + G K+VG  GRSG ++D++G +
Sbjct  332  TKRSYGPFGDEYGTYFTTKLREG-KVVGIHGRSGLFLDSLGVH  373



>gb|KHN46147.1| Agglutinin [Glycine soja]
Length=597

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 75/145 (52%), Gaps = 10/145 (7%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G NGG  W     + + Q+VI  G     + I+I +   K          G GG +T
Sbjct  14   GPWGGNGGSRWDDGIYSGVRQLVIVHGT--GIDSIQIEYDK-KGSSIWSEKHGGSGGRKT  70

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNF  410
                 D + +D  +E+LT+I G +G+      N +RS+ F +N + +G +G  +GT F+ 
Sbjct  71   -----DKVKLDCPNEFLTKIHGYYGSSNQRGPNFVRSLSFESNKKTYGPFGVELGTYFSV  125

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTY  485
                G KIVGF GR G+Y+DAIG Y
Sbjct  126  PL-TGAKIVGFHGRCGWYVDAIGVY  149


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            ND I  D   E LT ISG +G       +V+RS+ F T  R++G YG   GT F  + + 
Sbjct  301  NDKIVFDFPYEALTHISGYYGPLMYMGPSVIRSLTFHTTKRKYGPYGEEQGTYFTTKVKE  360

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KIVG  GR G ++DA G +
Sbjct  361  G-KIVGIHGRKGLFLDAFGVH  380


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +3

Query  195  KDTLTIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNARE  368
            +   ++  GG+  +  H   I ++  +E LT ISG +G  A  +   +++S+ F T+  +
Sbjct  483  QSVWSVKHGGSGGDTMHR--IQLEYPNEVLTCISGYYGPIAKDEQHIIMKSLTFNTSRGK  540

Query  369  FGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            +G +G  VG  F      G K+VGF GRS  Y+DAIG +
Sbjct  541  YGPFGEEVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  578



>ref|XP_002440568.1| hypothetical protein SORBIDRAFT_09g003330 [Sorghum bicolor]
 gb|EES18998.1| hypothetical protein SORBIDRAFT_09g003330 [Sorghum bicolor]
Length=120

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 10/95 (11%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PN  389
            G GG +  V   DT       E + EISGT+GAF   +    S+ F TNA + G +G P 
Sbjct  35   GSGGQKHKVRFADT-------EVVKEISGTYGAFDGHEA--SSLTFVTNAGKHGPFGEPR  85

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             GTPF+    NG ++VGFF RSG  +DA+G Y  P
Sbjct  86   QGTPFSVPVHNGGRVVGFFWRSGSLLDALGVYVHP  120



>ref|XP_009608045.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1547

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = +3

Query  63   GHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVT  242
            G+  G  W+++ K+ I +I+I+ G   ++  +R   + T+   + D+   G  G      
Sbjct  3    GNTDGSEWNYKLKSHIKEILIAHGDVIDSILLR---TITEQGTTIDSPMFGRNGGR----  55

Query  243  HNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  416
              D + I     EYLT I GTF  + S   V+ S+ F TNA+ +G +G   G TPF+F  
Sbjct  56   -RDKVVIKAPPLEYLTGIKGTFRRYGSH-LVINSLCFITNAKNYGPFGSEAGGTPFSFVM  113

Query  417  QNGNKIVGFFGRSGYYIDAIGTY  485
            +    I GF GR G Y+DAIG Y
Sbjct  114  KEVGAIEGFHGRCGAYLDAIGIY  136



>ref|XP_011048833.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Populus 
euphratica]
 ref|XP_011048834.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Populus 
euphratica]
Length=646

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 77/151 (51%), Gaps = 11/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            VA GP G   G  W     + + Q+VI++G     + ++I +   K       +  G GG
Sbjct  11   VAVGPWGGQDGYRWDDGVHSTVRQLVIAYGA--GIDSLQIEYDK-KGSSIWSQIHGGNGG  67

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T       + +D   E+LT I G +G+      V +RS+ F +N + +G +G   GT 
Sbjct  68   MKT------AVKLDYPHEFLTSIHGYYGSLDGWGPVFVRSLTFQSNKKTYGPFGVEHGTY  121

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+F   +G KIVGF G SG+Y+DAIG Y  P
Sbjct  122  FSF-PMSGGKIVGFHGMSGWYLDAIGIYLKP  151


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D   E LT ++GT+G+      N++RS+ F TN  + G +G   G  F  +   
Sbjct  349  SDKIIFDYPYEILTRVTGTYGSLMYMGPNIIRSLTFYTNKGKHGPFGEEQGPSFTNKIDE  408

Query  423  GNKIVGFFGRSGYYIDAIGT  482
            G KIVGF GR G  +DAIG 
Sbjct  409  G-KIVGFHGREGILLDAIGV  427


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS---SDNVLRSIKFTTNAREFGTYG  383
            G GGT T+      + +    E L  +SG +G       S  V++S+ F T+  ++G +G
Sbjct  539  GNGGTATH-----RVKLQYPHEVLICLSGYYGPVGCDEKSPKVVKSLTFHTSRGKYGPFG  593

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              +GT F      G K+VGF GRS  Y+DAIG +
Sbjct  594  EEIGTYFTSTTTEG-KVVGFHGRSSAYMDAIGVH  626



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +3

Query  270  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  449
             DE+LT + G  G  A    V++S+ F +N R +G YG + G PF   A  G +IVGF G
Sbjct  153  RDEHLTCVKGLLGNHAQW-FVVKSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211

Query  450  RSGYYIDAIGTYNAPDY  500
            RSG  +DAIGTY   D+
Sbjct  212  RSGGLLDAIGTYVRMDW  228



>ref|XP_011048832.1| PREDICTED: jacalin-related lectin 3-like isoform X1 [Populus 
euphratica]
Length=650

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 77/151 (51%), Gaps = 11/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            VA GP G   G  W     + + Q+VI++G     + ++I +   K       +  G GG
Sbjct  15   VAVGPWGGQDGYRWDDGVHSTVRQLVIAYGA--GIDSLQIEYDK-KGSSIWSQIHGGNGG  71

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T       + +D   E+LT I G +G+      V +RS+ F +N + +G +G   GT 
Sbjct  72   MKT------AVKLDYPHEFLTSIHGYYGSLDGWGPVFVRSLTFQSNKKTYGPFGVEHGTY  125

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F+F   +G KIVGF G SG+Y+DAIG Y  P
Sbjct  126  FSF-PMSGGKIVGFHGMSGWYLDAIGIYLKP  155


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D   E LT ++GT+G+      N++RS+ F TN  + G +G   G  F  +   
Sbjct  353  SDKIIFDYPYEILTRVTGTYGSLMYMGPNIIRSLTFYTNKGKHGPFGEEQGPSFTNKIDE  412

Query  423  GNKIVGFFGRSGYYIDAIGT  482
            G KIVGF GR G  +DAIG 
Sbjct  413  G-KIVGFHGREGILLDAIGV  431


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS---SDNVLRSIKFTTNAREFGTYG  383
            G GGT T+      + +    E L  +SG +G       S  V++S+ F T+  ++G +G
Sbjct  543  GNGGTATH-----RVKLQYPHEVLICLSGYYGPVGCDEKSPKVVKSLTFHTSRGKYGPFG  597

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              +GT F      G K+VGF GRS  Y+DAIG +
Sbjct  598  EEIGTYFTSTTTEG-KVVGFHGRSSAYMDAIGVH  630



>ref|XP_004235622.1| PREDICTED: jacalin-related lectin 19 [Solanum lycopersicum]
Length=201

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query  240  THNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
            +    I +   +EYLT +SG +         V+RS+ F++N R+FG +G   GTPF+   
Sbjct  70   SRTAQIKLQFPEEYLTSVSGYYCPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM  129

Query  417  QNGNKIVGFFGRSGYYIDAIGTYNA  491
            + G +IVGF GRSG+Y+DAIG Y A
Sbjct  130  EGG-QIVGFKGRSGWYVDAIGFYIA  153



>ref|XP_008654963.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
 ref|XP_008654964.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
Length=231

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  431
            I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G   GTPF F   +G  
Sbjct  104  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  162

Query  432  IVGFFGRSGYYIDAIGTYNAP  494
            IVGF GRSG+ +DA+G Y AP
Sbjct  163  IVGFCGRSGWQLDAVGLYVAP  183



>ref|XP_008654962.1| PREDICTED: LOC100282355 isoform X2 [Zea mays]
 gb|AFW80927.1| hypothetical protein ZEAMMB73_478294 [Zea mays]
Length=237

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  431
            I +   DEYLT +SG +   A   + V+RS+ F TN   +G +G   GTPF F   +G  
Sbjct  110  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  168

Query  432  IVGFFGRSGYYIDAIGTYNAP  494
            IVGF GRSG+ +DA+G Y AP
Sbjct  169  IVGFCGRSGWQLDAVGLYVAP  189



>ref|XP_008654961.1| PREDICTED: LOC100282355 isoform X1 [Zea mays]
Length=238

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  431
            I +   DEYLT +SG +   A     V+RS+ F TN   +G +G   GTPF F   +G  
Sbjct  111  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  169

Query  432  IVGFFGRSGYYIDAIGTYNAP  494
            IVGF GRSG+ +DA+G Y AP
Sbjct  170  IVGFCGRSGWQLDAVGLYVAP  190



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  431
            I     +E++T +SG +     S   V+RS+KF TN + +G YG   GTPF+F   +G  
Sbjct  16   IKFQYPEEFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVEEGTPFSF-PMDGGH  74

Query  432  IVGFFGRSGYYIDAIG  479
            IVGF GRSG+Y+DAIG
Sbjct  75   IVGFKGRSGWYLDAIG  90



>ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis]
 gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis]
Length=514

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (50%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G NGG  W     N + +I I +    ++  I++ +   KN  +  T   GG G
Sbjct  337  LLVGPWGGNGGSTWDDGVFNGVREITIVYDHCIDS--IKVVYD--KNGKAVATEKHGGVG  392

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
                 T    I +   +EYL   SG +         V+RSI F +N R FG +G   GTP
Sbjct  393  G----TKRTEIKLQYPEEYLVSASGNYCPVVYGGSPVIRSITFKSNRRTFGPFGIEEGTP  448

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F   + +G ++VGF GRSG+Y+DAIG   +P
Sbjct  449  FTL-SMDGRRVVGFTGRSGWYLDAIGFRLSP  478



>ref|XP_010471351.1| PREDICTED: jacalin-related lectin 19 [Camelina sativa]
Length=177

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 75/147 (51%), Gaps = 12/147 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            V  GP G NGG  W     + + +I + +    ++    IT    KN     +   GG G
Sbjct  13   VFVGPWGGNGGTAWDDGIYHGVREIRLLY----DHCIDSITVIYDKNGKPARSEKHGGVG  68

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGT  398
            G +T+      I +   DEYL  +SG +    +S   V+RS+ F +N + +G YG   GT
Sbjct  69   GNKTS-----EIKLQYPDEYLIGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGT  123

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIG  479
            PF F   NG +IVG  GRSG+Y+D+IG
Sbjct  124  PFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_009599289.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Nicotiana tomentosiformis]
Length=649

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 10/151 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            ++ GP G + G  W     + I Q+ I+ G   ++  +    + T     K     G GG
Sbjct  11   ISVGPWGGDNGLHWDDGVYSTIRQLEIAHGTGVDSLKVEYDKNGTSVWSEKHG---GSGG  67

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTP  401
             +T     D + ++  DE+LT + G +G+     +V +RS+ F +N R +G YG   GT 
Sbjct  68   AKT-----DKVRLNYPDEFLTCLHGYYGSLHERGSVFVRSLTFQSNKRTYGPYGVQQGTY  122

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            F      G K+VGF G+SG+Y+DAIG Y  P
Sbjct  123  FTLPISRG-KVVGFHGKSGWYLDAIGVYVEP  152


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  428
            + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      G 
Sbjct  552  VKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATTEG-  610

Query  429  KIVGFFGRSGYYIDAIGTY  485
            K+VGF GRSG Y+DAIG +
Sbjct  611  KVVGFHGRSGMYLDAIGVH  629


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            + I  D   E LT I+G +G A     N+++S+ F T   + G YG   G  F+ + + G
Sbjct  314  ERIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLKEG  373

Query  426  NKIVGFFGRSGYYIDAIGTY  485
              IVGF GR G ++DA+G +
Sbjct  374  I-IVGFHGRKGLFLDALGVH  392



>ref|XP_006416472.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
 gb|ESQ34825.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
Length=594

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 80/150 (53%), Gaps = 10/150 (7%)
 Frame = +3

Query  48   AYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGT  227
            + GP G   G  W       + QIV++ G   + + I++ +   KN  S  +   GG G 
Sbjct  9    SVGPWGGQSGHAWDDGMFTTVRQIVVAHGS--SIDSIQVEYD--KNGSSVWSEKRGGKGG  64

Query  228  ETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPF  404
                T  D + +D   EYLT + GT+G+F    ++ +RS+ F +N +++G +G   GT F
Sbjct  65   ----TKFDKVKLDYPHEYLTSVRGTYGSFDVWGHLCVRSLTFESNRKKYGPFGVESGTYF  120

Query  405  NFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                 + +KI+GF G++G+Y+DAIG +  P
Sbjct  121  ALPKLD-SKIIGFHGKAGWYVDAIGVHLQP  149


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = +3

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPN  389
            GGG     TH   I ++  +E LT ISG +G   +SD  NV++S+ F T+  ++G YG  
Sbjct  485  GGGNNGVATHR--IKLEYPNEMLTCISGYYGPLNNSDRSNVVKSLCFFTSRGKYGPYGEE  542

Query  390  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
             GT F   A  G K++G  GRS  Y+DAIG +
Sbjct  543  TGTFFTSTATEG-KVLGLHGRSSSYLDAIGVH  573


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  294  HDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFHTNLGKHGPFGEEQGPSFAHKIDE  353

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G K+VGF GR G ++D+IG +
Sbjct  354  G-KVVGFLGREGLFLDSIGVH  373



>ref|NP_001148448.1| jasmonate-induced protein [Zea mays]
 gb|ACG31498.1| jasmonate-induced protein [Zea mays]
Length=184

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = +3

Query  213  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYG  383
            GG G ET       I + G+ E LTE+SGT G       V+ SIKF T+ +    FG +G
Sbjct  93   GGSGGETE----PVIQL-GDSEVLTELSGTIG-IVDGHTVITSIKFVTSLKTYGPFGAWG  146

Query  384  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
                TPF    Q G+ IVGFF R+G Y+DA+G Y
Sbjct  147  DGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVY  180



>ref|XP_006343016.1| PREDICTED: agglutinin-like [Solanum tuberosum]
Length=201

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query  240  THNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  416
            +    I +   +EYLT +SG +         V+RS+ F++N R+FG +G   GTPF+   
Sbjct  70   SRTAQIKLQFPEEYLTSVSGYYSPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM  129

Query  417  QNGNKIVGFFGRSGYYIDAIGTYNA  491
            + G +IVGF GRSG+Y+DAIG Y A
Sbjct  130  EGG-QIVGFKGRSGWYLDAIGFYIA  153



>ref|XP_009599288.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Nicotiana tomentosiformis]
Length=661

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 80/152 (53%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGG-G  221
            ++ GP G + G  W     + I Q+ I+ G     + +++ +   KN  S  +   GG G
Sbjct  11   ISVGPWGGDNGLHWDDGVYSTIRQLEIAHGT--GVDSLKVEYD--KNGTSVWSEKHGGSG  66

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGT  398
            G +T     D + ++  DE+LT + G +G+     +V +RS+ F +N R +G YG   GT
Sbjct  67   GAKT-----DKVRLNYPDEFLTCLHGYYGSLHERGSVFVRSLTFQSNKRTYGPYGVQQGT  121

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F      G K+VGF G+SG+Y+DAIG Y  P
Sbjct  122  YFTLPISRG-KVVGFHGKSGWYLDAIGVYVEP  152


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +3

Query  255  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  428
            + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      G 
Sbjct  564  VKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATTEG-  622

Query  429  KIVGFFGRSGYYIDAIGTY  485
            K+VGF GRSG Y+DAIG +
Sbjct  623  KVVGFHGRSGMYLDAIGVH  641


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  425
            + I  D   E LT I+G +G A     N+++S+ F T   + G YG   G  F+ + + G
Sbjct  314  ERIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLKEG  373

Query  426  NKIVGFFGRSGYYIDAIGTY  485
              IVGF GR G ++DA+G +
Sbjct  374  I-IVGFHGRKGLFLDALGVH  392



>ref|XP_006362248.1| PREDICTED: myrosinase-binding protein-like At3g16470-like isoform 
X2 [Solanum tuberosum]
Length=654

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 78/152 (51%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGG-  221
            ++ GP G   G  W     + I Q+ I+ G     + I++ +   KN  S  +   GGG 
Sbjct  11   ISVGPWGGENGLHWDDGVYSTIRQLEIAHGT--GVDSIKVEYD--KNGTSVFSEKHGGGV  66

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGT  398
            G +T     D I +   DE+LT + G +G+     +V +RS+ F +N R +G YG   GT
Sbjct  67   GAKT-----DKIILSYPDEFLTSMHGYYGSLYERGSVFVRSLTFESNKRTYGPYGVEQGT  121

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F      G KIVGF G+SG+Y+DAIG Y  P
Sbjct  122  YFTLPISRG-KIVGFHGKSGWYLDAIGVYIEP  152


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            + + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      
Sbjct  555  NKVKLEFPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSSTTE  614

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G K+VGF GRSG Y+DAIG +
Sbjct  615  G-KVVGFHGRSGMYLDAIGVH  634



>ref|XP_006362247.1| PREDICTED: myrosinase-binding protein-like At3g16470-like isoform 
X1 [Solanum tuberosum]
Length=666

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 78/152 (51%), Gaps = 12/152 (8%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGG-  221
            ++ GP G   G  W     + I Q+ I+ G     + I++ +   KN  S  +   GGG 
Sbjct  11   ISVGPWGGENGLHWDDGVYSTIRQLEIAHGT--GVDSIKVEYD--KNGTSVFSEKHGGGV  66

Query  222  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGT  398
            G +T     D I +   DE+LT + G +G+     +V +RS+ F +N R +G YG   GT
Sbjct  67   GAKT-----DKIILSYPDEFLTSMHGYYGSLYERGSVFVRSLTFESNKRTYGPYGVEQGT  121

Query  399  PFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
             F      G KIVGF G+SG+Y+DAIG Y  P
Sbjct  122  YFTLPISRG-KIVGFHGKSGWYLDAIGVYIEP  152


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +3

Query  249  DTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            + + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      
Sbjct  567  NKVKLEFPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSSTTE  626

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G K+VGF GRSG Y+DAIG +
Sbjct  627  G-KVVGFHGRSGMYLDAIGVH  646



>ref|XP_006426466.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
 ref|XP_006466099.1| PREDICTED: agglutinin-like [Citrus sinensis]
 gb|ESR39706.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
Length=190

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 74/148 (50%), Gaps = 10/148 (7%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G NGG  W     + + +I +++      + IR+ +    N  + +      GG
Sbjct  15   IVIGPWGGNGGTSWDDGIYHGVREITLAY--DRCIDSIRVVYDKKGNPVTAEKH----GG  68

Query  225  TETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTP  401
               N T    I +   +E+L  +SG +         V+RS+ F +N R FG +G   GTP
Sbjct  69   VGGNRTAE--IKLRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTP  126

Query  402  FNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
            F F + +G  +VGF GRSG+Y+DAIG Y
Sbjct  127  FTF-SMDGGLVVGFKGRSGWYVDAIGFY  153



>ref|XP_004960459.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=149

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
            G  E++ EISGT+G F     V+RS+ F TN  + G +G    TPF+   Q+  ++VGFF
Sbjct  75   GAGEFVKEISGTYGPFGGH-TVVRSLTFVTNVGKHGPFGNPGQTPFSVPVQDDARVVGFF  133

Query  447  GRSGYYIDAIGTYNAP  494
            GRSG  +DA+G Y  P
Sbjct  134  GRSGSLLDAVGVYVHP  149



>gb|KDO58671.1| hypothetical protein CISIN_1g037526mg, partial [Citrus sinensis]
Length=200

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 74/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  45   VAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGG  224
            +  GP G NGG  W     + + +I +++      + IR+ +    N  + +     GG 
Sbjct  14   IVIGPWGGNGGTSWDDGIYHGVREITLAY--DRCIDSIRVVYDKKGNPVTAEKHGGVGGN  71

Query  225  TETNVTHNDT-----INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGP  386
                +    T     I +   +E+L  +SG +         V+RS+ F +N R FG +G 
Sbjct  72   RTAEICSIPTLLSFPIKLRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGV  131

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              GTPF F + +G  +VGF GRSG+Y+DAIG Y
Sbjct  132  EEGTPFTF-SMDGGLVVGFKGRSGWYVDAIGFY  163



>gb|AFW81812.1| putative protein kinase superfamily protein [Zea mays]
Length=503

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 71/134 (53%), Gaps = 10/134 (7%)
 Frame = +3

Query  96   PKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGED  275
            P +++  + +  G   ++    + FS T  DG +     G G   +    +  + ++   
Sbjct  378  PPHRLKAVWLKHGAVIDS----LQFSYTDCDGREQ----GAGPWGSQDAWDKVLQLEPY-  428

Query  276  EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  452
            E+L  +SGT G +A    +V+RS+ F TN R + T G  VG PF  +A  G+ IVGF  R
Sbjct  429  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  488

Query  453  SGYYIDAIGTYNAP  494
            +G+++DA+G Y+ P
Sbjct  489  AGHFLDALGVYHRP  502



>ref|XP_002450764.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
 gb|EES09752.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
Length=1080

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  276   EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  452
             EY+ E+SGT+G  +   D V+ S+   TN   +G +G   GTPF+ +      IVGFFGR
Sbjct  1004  EYVKEVSGTYGLCSPHPDVVITSLTLVTNLCSYGPFGQPTGTPFHTRVDKTASIVGFFGR  1063

Query  453   SGYYIDAIGTYNAP  494
             SG Y+DAIG Y  P
Sbjct  1064  SGIYLDAIGVYVRP  1077



>ref|XP_010533571.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Tarenaya hassleriana]
Length=598

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G  W     + + QIVI+ G     + I+I +   KN  S      GG G   
Sbjct  14   GPWGGQSGSPWDDGVYSSVRQIVIAHGS--GIDSIQIEYD--KNGKSVWGDKHGGKGGNK  69

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNF  410
                 D + ++  DEYLT + GT+G+F     + +RS+ F +N R++G +G   GT F+ 
Sbjct  70   F----DKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSL  125

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                  KIVGF G++G+Y+DAIG +  P
Sbjct  126  PKSEA-KIVGFHGKTGWYLDAIGVHIQP  152


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D +  D   E LT I+GT+G+      NV+RS+ F TN  + G YG   G  F  +   
Sbjct  300  HDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGE  359

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KIVGF GR G ++DAIG +
Sbjct  360  G-KIVGFLGREGLFLDAIGVH  379


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 64/128 (50%), Gaps = 8/128 (6%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QI ++   RG      I     +N  S  ++  GG       TH   I ++   E LT
Sbjct  458  IKQIFVT---RGETAITSIQVEYDRNGQSVWSVKHGGNNNGGVATHR--IKLECPHEVLT  512

Query  288  EISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             +SG +G  ++SD   V++S+ F T+  ++G YG   GT +      G K+VGF GRS  
Sbjct  513  CLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTSTKTEG-KVVGFHGRSSS  571

Query  462  YIDAIGTY  485
            Y+DAIG +
Sbjct  572  YLDAIGVH  579



>ref|XP_009400545.1| PREDICTED: agglutinin alpha chain [Musa acuminata subsp. malaccensis]
Length=200

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 74/154 (48%), Gaps = 10/154 (6%)
 Frame = +3

Query  36   STDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIG  215
            S  +  GP G +GG  W       + +I + +      + IR+ +    +   K  L   
Sbjct  11   SKTLKVGPWGGHGGSTWDDGINTGVREITLVYDQ--CIDSIRVEY----DKNGKPFLAEK  64

Query  216  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNV  392
             GG   ++T    I ++  +EYLT ISG +   A     V+RS+ F +N R FG +G   
Sbjct  65   HGGNGGSMTTK--IKLEHPEEYLTTISGHYCPMAYGGSPVIRSLTFKSNQRTFGPFGVQD  122

Query  393  GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
            G PF    + G  IVGF GR G+Y+DAIG   +P
Sbjct  123  GIPFTLPMEGG-MIVGFSGRCGWYLDAIGWCISP  155



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +3

Query  267  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  446
             + E++ EIS TFG F  +  V+ S+KF TN R FG +   +GTPF+   Q+ + IVGFF
Sbjct  43   ADSEFVKEISRTFGTFDGA-IVVTSLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFF  101

Query  447  GRSGYYIDAIGTY  485
               G Y+DAIG +
Sbjct  102  AHVGKYLDAIGVH  114



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +3

Query  276  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  452
            EYLT I GTFG    S  V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  54   EYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHGR  112

Query  453  SGYYIDAIGTY  485
             G Y+DAIG Y
Sbjct  113  CGAYLDAIGVY  123



>gb|AAQ07258.1| jacalin-like lectin [Ananas comosus]
Length=145

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 62/126 (49%), Gaps = 11/126 (9%)
 Frame = +3

Query  144  NNNPIRIT---------FSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLTEIS  296
            + +P R+T           A + D  +D  T   G    N   +DTI      EYL  I 
Sbjct  21   DGHPTRLTKIVIRSAHAIDALQFDYVEDGKTFAAGQWGGNGGKSDTIEFQ-PGEYLIAIK  79

Query  297  GTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAI  476
            GT GA  +  N++RS+ F +N R +G +G   GTPF+    +G +IV F+GR G  +DA 
Sbjct  80   GTTGALGAVTNLVRSLTFISNMRTYGPFGLEHGTPFSVPVASG-RIVAFYGRFGSLVDAF  138

Query  477  GTYNAP  494
            G Y  P
Sbjct  139  GIYLMP  144



>ref|XP_010533565.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +3

Query  54   GPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTET  233
            GP G   G  W     + + QIVI+ G     + I+I +   KN  S      GG G   
Sbjct  17   GPWGGQSGSPWDDGVYSSVRQIVIAHGS--GIDSIQIEYD--KNGKSVWGDKHGGKGGNK  72

Query  234  NVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNF  410
                 D + ++  DEYLT + GT+G+F     + +RS+ F +N R++G +G   GT F+ 
Sbjct  73   F----DKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSL  128

Query  411  QAQNGNKIVGFFGRSGYYIDAIGTYNAP  494
                  KIVGF G++G+Y+DAIG +  P
Sbjct  129  PKSEA-KIVGFHGKTGWYLDAIGVHIQP  155


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  422
            +D +  D   E LT I+GT+G+      NV+RS+ F TN  + G YG   G  F  +   
Sbjct  303  HDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGE  362

Query  423  GNKIVGFFGRSGYYIDAIGTY  485
            G KIVGF GR G ++DAIG +
Sbjct  363  G-KIVGFLGREGLFLDAIGVH  382


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 64/128 (50%), Gaps = 8/128 (6%)
 Frame = +3

Query  108  INQIVISFGGRGNNNPIRITFSATKNDGSKDTLTIGGGGTETNVTHNDTINIDGEDEYLT  287
            I QI ++   RG      I     +N  S  ++  GG       TH   I ++   E LT
Sbjct  461  IKQIFVT---RGETAITSIQVEYDRNGQSVWSVKHGGNNNGGVATHR--IKLECPHEVLT  515

Query  288  EISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  461
             +SG +G  ++SD   V++S+ F T+  ++G YG   GT +      G K+VGF GRS  
Sbjct  516  CLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTSTKTEG-KVVGFHGRSSS  574

Query  462  YIDAIGTY  485
            Y+DAIG +
Sbjct  575  YLDAIGVH  582



>ref|XP_010690084.1| PREDICTED: jacalin-related lectin 19 [Beta vulgaris subsp. vulgaris]
Length=189

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 73/153 (48%), Gaps = 10/153 (7%)
 Frame = +3

Query  30   SISTDVAYGPLGHNGGGFWSFRPKNKINQIVISFGGRGNNNPIRITFSATKNDGSKDTLT  209
            S    +A GP G NGG  W     + + +I + +    +     I+    K+     +  
Sbjct  10   SAKMKIAVGPWGGNGGTSWDDGCYSGVREIKLVY----DRCIDSISVVYDKHGKLVKSQK  65

Query  210  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGP  386
             GG G    V     I +   +EYL  +SG +         V+RS+ F +N R FG +G 
Sbjct  66   HGGNGGTITVE----IKLIYPEEYLISVSGYYSPVVQGMTPVVRSLSFKSNRRSFGPFGV  121

Query  387  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  485
              GTPF F  + G +I+GF GRSG+Y+D+IG Y
Sbjct  122  EEGTPFYFPVE-GGRIIGFKGRSGWYLDSIGFY  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875