BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN031F21

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004229710.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        169   9e-50   Solanum lycopersicum
ref|XP_010691984.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        169   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006354639.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    167   3e-49   Solanum tuberosum [potatoes]
ref|XP_002526500.1|  ATP binding protein, putative                      167   5e-49   Ricinus communis
ref|XP_010919833.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        167   5e-49   Elaeis guineensis
ref|XP_002267346.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        166   1e-48   Vitis vinifera
gb|KJB24925.1|  hypothetical protein B456_004G168100                    166   2e-48   Gossypium raimondii
gb|KJB24923.1|  hypothetical protein B456_004G168100                    165   2e-48   Gossypium raimondii
ref|XP_006375101.1|  chaperonin 10 family protein                       165   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009388341.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        165   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP09382.1|  unnamed protein product                                165   3e-48   Coffea canephora [robusta coffee]
ref|XP_011031730.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    165   4e-48   Populus euphratica
ref|XP_004307266.1|  PREDICTED: 10 kDa chaperonin, cyanelle             164   5e-48   Fragaria vesca subsp. vesca
gb|KDP28905.1|  hypothetical protein JCGZ_14676                         164   6e-48   Jatropha curcas
ref|XP_008784707.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    164   6e-48   Phoenix dactylifera
ref|XP_009767520.1|  PREDICTED: 10 kDa chaperonin, cyanelle-like        164   8e-48   Nicotiana sylvestris
ref|XP_009613430.1|  PREDICTED: 10 kDa chaperonin, cyanelle isofo...    163   1e-47   Nicotiana tomentosiformis
ref|XP_007052412.1|  GroES-like family protein                          163   1e-47   
ref|XP_009370952.1|  PREDICTED: 20 kDa chaperonin, chloroplastic ...    162   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_006662614.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    162   5e-47   
gb|KHG01043.1|  20 kDa chaperonin, chloroplastic -like protein          160   2e-46   Gossypium arboreum [tree cotton]
ref|XP_008343996.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    160   2e-46   
ref|XP_009384697.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    160   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004983611.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    159   4e-46   Setaria italica
ref|XP_010269887.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        159   7e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009370951.1|  PREDICTED: 20 kDa chaperonin, chloroplastic ...    159   7e-46   Pyrus x bretschneideri [bai li]
ref|NP_001065426.2|  Os10g0566700                                       159   1e-45   
ref|XP_010089780.1|  10 kDa chaperonin                                  158   1e-45   Morus notabilis
ref|XP_002302485.2|  hypothetical protein POPTR_0002s13670g             158   1e-45   
ref|XP_006445475.1|  hypothetical protein CICLE_v10022799mg             158   1e-45   Citrus clementina [clementine]
ref|XP_002467468.1|  hypothetical protein SORBIDRAFT_01g028650          157   2e-45   Sorghum bicolor [broomcorn]
ref|XP_003574355.1|  PREDICTED: 10 kDa chaperonin, cyanelle-like        157   3e-45   Brachypodium distachyon [annual false brome]
dbj|BAJ86245.1|  predicted protein                                      157   3e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG32579.1|  CHL-CPN10                                               157   3e-45   Zea mays [maize]
gb|ACF79087.1|  unknown                                                 157   4e-45   Zea mays [maize]
ref|XP_008343989.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    157   5e-45   
gb|EEE51424.1|  hypothetical protein OsJ_32502                          159   7e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011017532.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    155   1e-44   Populus euphratica
ref|NP_001141494.1|  CHL-CPN10 isoform 1                                155   2e-44   
gb|ABK22191.1|  unknown                                                 155   3e-44   Picea sitchensis
ref|XP_008668930.1|  PREDICTED: 10 kDa chaperonin, cyanelle-like ...    154   6e-44   
ref|XP_008438275.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        153   1e-43   Cucumis melo [Oriental melon]
ref|XP_006838441.1|  hypothetical protein AMTR_s00002p00128280          153   2e-43   Amborella trichopoda
ref|XP_010052755.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        152   2e-43   Eucalyptus grandis [rose gum]
gb|ACG44161.1|  CHL-CPN10                                               152   3e-43   Zea mays [maize]
gb|KFK35223.1|  hypothetical protein AALP_AA5G256400                    151   1e-42   Arabis alpina [alpine rockcress]
ref|XP_008367471.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    150   1e-42   
tpg|DAA36151.1|  TPA: CHL-CPN10                                         155   1e-42   
gb|EYU42319.1|  hypothetical protein MIMGU_mgv1a016021mg                150   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_004133964.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    150   2e-42   Cucumis sativus [cucumbers]
ref|XP_004157690.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    150   2e-42   
ref|XP_002878323.1|  hypothetical protein ARALYDRAFT_486490             150   2e-42   
gb|EPS72174.1|  hypothetical protein M569_02588                         148   5e-42   Genlisea aurea
gb|AFK37353.1|  unknown                                                 149   5e-42   Lotus japonicus
ref|NP_191580.1|  GroES-like family protein                             149   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145027.1|  PREDICTED: 10 kDa chaperonin-like                  148   9e-42   Cucumis sativus [cucumbers]
ref|XP_010559078.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        148   9e-42   Tarenaya hassleriana [spider flower]
ref|XP_006293394.1|  hypothetical protein CARUB_v10024286mg             148   9e-42   Capsella rubella
ref|NP_001236450.1|  uncharacterized protein LOC100306026               148   1e-41   Glycine max [soybeans]
gb|EYU40324.1|  hypothetical protein MIMGU_mgv1a016131mg                148   1e-41   Erythranthe guttata [common monkey flower]
gb|KHN10899.1|  20 kDa chaperonin, chloroplastic                        148   1e-41   Glycine soja [wild soybean]
gb|ADN34095.1|  chloroplast chaperonin                                  149   1e-41   Cucumis melo subsp. melo
ref|NP_001236206.1|  uncharacterized protein LOC100500567               147   2e-41   Glycine max [soybeans]
gb|KFK37269.1|  hypothetical protein AALP_AA4G235400                    147   2e-41   Arabis alpina [alpine rockcress]
ref|XP_007134367.1|  hypothetical protein PHAVU_010G041700g             147   3e-41   Phaseolus vulgaris [French bean]
ref|XP_011093981.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        145   3e-41   Sesamum indicum [beniseed]
gb|AAK62415.1|AF386970_1  Unknown protein                               147   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566022.1|  chloroplast chaperonin 10                             147   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626805.1|  10 kDa chaperonin                                  146   6e-41   Medicago truncatula
ref|XP_002881972.1|  CHL-CPN10                                          145   1e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_006292025.1|  hypothetical protein CARUB_v10018214mg             145   1e-40   Capsella rubella
ref|XP_004510137.1|  PREDICTED: 10 kDa chaperonin-like                  145   2e-40   Cicer arietinum [garbanzo]
ref|XP_010518069.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    144   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010506394.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    144   7e-40   Camelina sativa [gold-of-pleasure]
emb|CDY48244.1|  BnaC04g05030D                                          142   1e-39   Brassica napus [oilseed rape]
ref|XP_010508270.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    142   3e-39   Camelina sativa [gold-of-pleasure]
ref|NP_001288850.1|  20 kDa chaperonin, chloroplastic-like              142   3e-39   Brassica rapa
ref|XP_006397646.1|  hypothetical protein EUTSA_v10001677mg             142   4e-39   Eutrema salsugineum [saltwater cress]
emb|CDY23449.1|  BnaC04g49770D                                          141   5e-39   Brassica napus [oilseed rape]
ref|XP_010413592.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    141   6e-39   Camelina sativa [gold-of-pleasure]
gb|ABK78693.1|  chloroplast chaperonin 10                               140   2e-38   Brassica rapa
ref|XP_009143052.1|  PREDICTED: 20 kDa chaperonin, chloroplastic        140   2e-38   Brassica rapa
ref|XP_010512328.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...    138   9e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002991064.1|  hypothetical protein SELMODRAFT_132827             135   2e-37   
gb|KJB24924.1|  hypothetical protein B456_004G168100                    133   4e-36   Gossypium raimondii
ref|XP_001782860.1|  predicted protein                                  127   5e-34   
ref|XP_009613431.1|  PREDICTED: uncharacterized protein LOC104106...    122   5e-32   Nicotiana tomentosiformis
ref|XP_008667777.1|  PREDICTED: CHL-CPN10 isoform 1 isoform X2          119   1e-30   Zea mays [maize]
ref|XP_008668931.1|  PREDICTED: uncharacterized protein LOC103645...    117   4e-30   
ref|XP_001779401.1|  predicted protein                                  118   1e-29   
tpg|DAA36148.1|  TPA: hypothetical protein ZEAMMB73_907288              120   2e-29   
gb|KCW76831.1|  hypothetical protein EUGRSUZ_D01184                     113   4e-28   Eucalyptus grandis [rose gum]
ref|XP_006397645.1|  hypothetical protein EUTSA_v10001677mg             112   9e-28   
ref|XP_008232313.1|  PREDICTED: uncharacterized protein LOC103331473    108   8e-27   
gb|ACG31800.1|  CHL-CPN10                                               106   1e-25   Zea mays [maize]
gb|ACR34714.1|  unknown                                                 105   2e-25   Zea mays [maize]
tpg|DAA46364.1|  TPA: hypothetical protein ZEAMMB73_301142              104   7e-25   
tpg|DAA36146.1|  TPA: hypothetical protein ZEAMMB73_907288              103   8e-25   
tpg|DAA36149.1|  TPA: hypothetical protein ZEAMMB73_907288              105   4e-24   
ref|XP_010469216.1|  PREDICTED: uncharacterized protein LOC104749316  97.4    3e-22   Camelina sativa [gold-of-pleasure]
gb|KJB24927.1|  hypothetical protein B456_004G168100                  94.4    2e-21   Gossypium raimondii
gb|KJB44684.1|  hypothetical protein B456_007G266500                  90.9    3e-20   Gossypium raimondii
ref|XP_004160703.1|  PREDICTED: uncharacterized protein LOC101230269  84.7    2e-17   
ref|XP_007140914.1|  hypothetical protein PHAVU_008G151700g           82.4    5e-17   Phaseolus vulgaris [French bean]
gb|KJB24926.1|  hypothetical protein B456_004G168100                  82.4    6e-17   Gossypium raimondii
ref|NP_001167648.1|  hypothetical protein                             77.8    4e-15   
gb|KHG00544.1|  Nitrogenase iron-molybdenum cofactor biosynthesis...  76.6    9e-15   Gossypium arboreum [tree cotton]
ref|XP_007146624.1|  hypothetical protein PHAVU_006G055900g           73.9    8e-14   Phaseolus vulgaris [French bean]
ref|XP_004173645.1|  PREDICTED: 10 kDa chaperonin-like                67.4    9e-12   
ref|WP_019490874.1|  molecular chaperone GroES                        63.2    8e-10   Calothrix
ref|XP_010687539.1|  PREDICTED: 20 kDa chaperonin, chloroplastic      65.1    9e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KIE07029.1|  chaperonin                                            62.8    1e-09   Tolypothrix bouteillei VB521301
ref|WP_006516274.1|  Co-chaperonin GroES                              62.8    1e-09   Leptolyngbya sp. PCC 7375
ref|WP_006910546.1|  molecular chaperone GroES                        62.4    1e-09   Cyanobium
ref|WP_006854300.1|  molecular chaperone GroES                        62.4    1e-09   Synechococcus
ref|WP_035829454.1|  chaperonin                                       62.4    2e-09   
ref|WP_017321739.1|  molecular chaperone GroES                        62.4    2e-09   cyanobacterium PCC 7702
gb|AAA27313.1|  chaperonin                                            62.0    2e-09   Synechococcus sp.
ref|WP_009629538.1|  10 kDa chaperonin                                62.0    2e-09   Pseudanabaena
ref|WP_015202371.1|  10 kDa chaperonin                                62.0    2e-09   Crinalium epipsammum
ref|WP_015184309.1|  Co-chaperonin GroES                              62.0    2e-09   Microcoleus sp. PCC 7113
ref|WP_015110667.1|  Co-chaperonin GroES                              61.6    3e-09   Cyanobacteria [blue-green bacteria]
ref|WP_010310879.1|  molecular chaperone GroES                        61.6    3e-09   Synechococcus sp. CB0101
ref|WP_011620192.1|  molecular chaperone GroES                        61.6    3e-09   Synechococcus
ref|WP_012630460.1|  molecular chaperone GroES                        61.6    3e-09   Cyanothece sp. PCC 7425
ref|WP_010315361.1|  molecular chaperone GroES                        61.2    3e-09   Synechococcus sp. CB0205
ref|WP_009768318.1|  Co-chaperonin GroES                              61.2    4e-09   Oscillatoriales cyanobacterium JSC-12
ref|WP_036536397.1|  chaperonin                                       61.2    4e-09   Neosynechococcus sphagnicola
ref|WP_023072995.1|  co-chaperonin                                    61.2    4e-09   Leptolyngbya sp. Heron Island J
ref|WP_011244098.1|  MULTISPECIES: molecular chaperone GroES          61.2    4e-09   Synechococcus
ref|WP_011316757.1|  molecular chaperone GroES                        60.8    6e-09   Trichormus variabilis
ref|WP_017286920.1|  molecular chaperone GroES                        60.8    6e-09   Leptolyngbya boryana
ref|WP_017743712.1|  molecular chaperone GroES                        60.5    6e-09   Scytonema hofmannii
ref|WP_009790475.1|  molecular chaperone GroES                        60.5    6e-09   Synechococcus sp. BL107
ref|WP_008312546.1|  Co-chaperonin GroES                              60.5    7e-09   Leptolyngbya sp. PCC 6406
ref|WP_011820918.1|  MULTISPECIES: molecular chaperone GroES          60.5    8e-09   Prochlorococcus marinus
ref|WP_006043324.1|  molecular chaperone GroES                        60.5    8e-09   Synechococcus sp. WH 7805
ref|WP_011125740.1|  MULTISPECIES: molecular chaperone GroES          60.5    9e-09   Prochlorococcus
ref|WP_011133066.1|  molecular chaperone GroES                        60.5    9e-09   Prochlorococcus marinus
ref|WP_017319771.1|  molecular chaperone GroES                        60.1    9e-09   cyanobacterium PCC 7702
ref|WP_011933892.1|  molecular chaperone GroES                        60.1    9e-09   Synechococcus sp. WH 7803
ref|WP_043737222.1|  chaperonin                                       60.1    1e-08   Synechococcus sp. RCC307
ref|WP_011433225.1|  molecular chaperone GroES                        60.1    1e-08   Synechococcus
ref|WP_011295315.1|  molecular chaperone GroES                        59.7    1e-08   Prochlorococcus marinus
ref|WP_011359322.1|  molecular chaperone GroES                        59.7    1e-08   Synechococcus sp. CC9902
ref|WP_028952752.1|  chaperonin                                       59.7    2e-08   Synechococcus sp. CC9616
ref|WP_012196108.1|  molecular chaperone GroES                        59.7    2e-08   Prochlorococcus marinus
ref|WP_012596120.1|  MULTISPECIES: molecular chaperone GroES          59.3    2e-08   Cyanothece
ref|WP_008310159.1|  Co-chaperonin GroES                              59.3    2e-08   Leptolyngbya sp. PCC 6406
gb|AHF64577.1|  GroES                                                 59.7    2e-08   Synechococcus sp. WH 8109
ref|WP_036905521.1|  MULTISPECIES: chaperonin                         59.3    2e-08   Prochlorococcus
ref|WP_035987600.1|  chaperonin                                       59.3    2e-08   Leptolyngbya sp. KIOST-1
ref|WP_009348469.1|  molecular chaperone GroES                        58.9    2e-08   Alloprevotella rava
ref|WP_017298743.1|  molecular chaperone GroES                        59.3    2e-08   Nodosilinea nodulosa
ref|WP_011130818.1|  MULTISPECIES: molecular chaperone GroES          59.3    2e-08   Prochlorococcus
emb|CAK28763.1|  10 kDa chaperonin (Protein Cpn10) (groES protein)    59.3    2e-08   Synechococcus sp. RCC307
ref|WP_022694835.1|  molecular chaperone GroES                        58.9    2e-08   Ponticaulis koreensis
ref|WP_025923511.1|  chaperonin                                       58.9    2e-08   
ref|WP_007101657.1|  molecular chaperone GroES                        58.9    2e-08   Synechococcus sp. RS9917
ref|WP_010476538.1|  molecular chaperone GroES                        58.9    2e-08   Acaryochloris sp. CCMEE 5410
ref|WP_015186660.1|  10 kDa chaperonin                                58.9    2e-08   Gloeocapsa sp. PCC 7428
gb|AAM20895.1|AF373777_1  putative chaperonin protein                 58.9    2e-08   Cyanothece sp. PCC 8801
ref|WP_002744529.1|  10 kDa chaperonin                                58.9    2e-08   Microcystis aeruginosa
ref|WP_011430254.1|  molecular chaperone GroES                        58.9    3e-08   Synechococcus
ref|WP_008180318.1|  molecular chaperone GroES                        58.9    3e-08   Moorea producens
ref|WP_015223060.1|  chaperonin Cpn10                                 58.9    3e-08   
ref|WP_039681375.1|  molecular chaperone GroES                        58.5    3e-08   Peptostreptococcaceae
ref|WP_018590021.1|  co-chaperonin GroES                              58.5    3e-08   Terrisporobacter glycolicus
ref|WP_015157756.1|  Co-chaperonin GroES                              58.9    3e-08   Chamaesiphon
ref|WP_027846172.1|  chaperonin                                       58.5    3e-08   Mastigocoleus testarum
ref|WP_009633920.1|  Co-chaperonin GroES                              58.5    3e-08   Synechocystis sp. PCC 7509
ref|WP_035152189.1|  chaperonin                                       58.5    3e-08   Calothrix sp. 336/3
ref|WP_026097753.1|  chaperonin                                       58.5    4e-08   Geitlerinema sp. PCC 7105
ref|WP_011365113.1|  molecular chaperone GroES                        58.5    4e-08   Synechococcus sp. CC9605
ref|WP_004161432.1|  molecular chaperone GroES                        58.5    4e-08   Microcystis aeruginosa
ref|WP_036004425.1|  chaperonin                                       58.5    4e-08   [Leptolyngbya] sp. JSC-1
ref|WP_007683755.1|  molecular chaperone GroES                        58.2    4e-08   Novosphingobium sp. AP12
ref|WP_032520162.1|  chaperonin                                       58.5    4e-08   Prochlorococcus marinus
ref|WP_038546438.1|  chaperonin                                       58.2    4e-08   Synechococcus sp. KORDI-100
ref|WP_035999452.1|  chaperonin                                       58.2    4e-08   [Leptolyngbya] sp. JSC-1
ref|WP_011377073.1|  MULTISPECIES: molecular chaperone GroES          58.2    4e-08   Prochlorococcus
ref|YP_002048875.1|  co-chaperonin GroES                              58.2    5e-08   Paulinella chromatophora
ref|WP_002806275.1|  MULTISPECIES: molecular chaperone GroES          58.2    5e-08   Prochlorococcus
ref|WP_006292354.1|  MULTISPECIES: co-chaperonin GroES                58.2    5e-08   Holospora
ref|WP_011819052.1|  molecular chaperone GroES                        58.2    5e-08   Prochlorococcus marinus
ref|WP_006101488.1|  molecular chaperone GroES                        58.2    5e-08   Coleofasciculus chthonoplastes
ref|WP_021769306.1|  MULTISPECIES: hypothetical protein               57.8    5e-08   Leptotrichia
ref|WP_037220858.1|  chaperonin                                       58.2    5e-08   
ref|WP_016877281.1|  molecular chaperone GroES                        58.2    5e-08   Chlorogloeopsis fritschii
ref|WP_039337607.1|  molecular chaperone GroES                        58.2    5e-08   Novosphingobium subterraneum
ref|WP_018123706.1|  molecular chaperone GroES                        57.8    5e-08   Desulfovibrio oxyclinae
ref|WP_020642390.1|  chaperonin                                       58.2    6e-08   Amycolatopsis balhimycina
ref|WP_037308521.1|  molecular chaperone GroES                        57.8    6e-08   Ruegeria halocynthiae
ref|WP_034902662.1|  molecular chaperone GroES                        57.4    6e-08   Campylobacter sp. MIT 97-5078
ref|WP_021745275.1|  MULTISPECIES: chaperonin GroS                    57.4    6e-08   Leptotrichia
ref|WP_034957313.1|  molecular chaperone GroES                        57.8    6e-08   Erythrobacter longus
ref|WP_017299961.1|  molecular chaperone GroES                        57.8    6e-08   Nodosilinea nodulosa
ref|WP_006194609.1|  molecular chaperone GroES                        57.8    6e-08   Nodularia spumigena
ref|WP_035986961.1|  chaperonin                                       57.8    6e-08   Leptolyngbya sp. KIOST-1
ref|WP_039713348.1|  MULTISPECIES: chaperonin                         57.8    7e-08   Cyanobacteria [blue-green bacteria]
ref|WP_011127384.1|  molecular chaperone GroES                        57.8    7e-08   Synechococcus
ref|WP_006804030.1|  molecular chaperone GroES                        57.4    7e-08   Leptotrichia hofstadii
ref|WP_008829924.1|  MULTISPECIES: molecular chaperone GroES          57.8    7e-08   Sphingomonadaceae
ref|WP_015217477.1|  10 kDa chaperonin                                57.8    7e-08   Anabaena cylindrica
ref|WP_010997805.1|  MULTISPECIES: molecular chaperone GroES          57.8    7e-08   Nostocaceae
ref|WP_020876316.1|  10 kDa chaperonin                                57.4    7e-08   Desulfococcus multivorans
ref|WP_015147152.1|  Co-chaperonin GroES                              57.8    7e-08   Oscillatoria acuminata
ref|WP_041740016.1|  chaperonin                                       57.8    7e-08   Calothrix parietina
ref|WP_017326109.1|  molecular chaperone GroES                        57.4    8e-08   Synechococcus sp. PCC 7336
ref|WP_016925061.1|  molecular chaperone GroES                        57.4    8e-08   Prochlorothrix hollandica
ref|WP_019491741.1|  molecular chaperone GroES                        57.4    8e-08   Calothrix
gb|AFY86130.1|  Chaperonin Cpn10                                      57.8    8e-08   Chroococcidiopsis thermalis PCC 7203
ref|WP_012167682.1|  molecular chaperone GroES                        57.4    8e-08   Acaryochloris marina
gb|ABM77255.1|  Hypothetical protein P9303_05031                      58.5    8e-08   Prochlorococcus marinus str. MIT 9303
ref|WP_011613645.1|  molecular chaperone GroES                        57.4    8e-08   Trichodesmium erythraeum
ref|WP_006171952.1|  molecular chaperone GroES                        57.4    8e-08   Synechococcus sp. WH 5701
ref|WP_032524979.1|  chaperonin                                       57.4    8e-08   Prochlorococcus marinus
ref|WP_018499646.1|  molecular chaperone GroES                        57.0    8e-08   Leptotrichia wadei
ref|WP_036900502.1|  chaperonin                                       57.4    9e-08   Prochlorococcus sp. MIT 0601
gb|AFZ04388.1|  10 kDa chaperonin                                     57.4    9e-08   Calothrix sp. PCC 6303
ref|WP_014323845.1|  molecular chaperone GroES                        57.0    9e-08   Desulfovibrio desulfuricans
ref|WP_021232879.1|  molecular chaperone GroES                        57.0    1e-07   Novosphingobium lindaniclasticum
ref|WP_015172923.1|  chaperonin Cpn10                                 57.4    1e-07   Geitlerinema sp. PCC 7407
ref|WP_015225431.1|  chaperonin Cpn10                                 57.4    1e-07   Halothece sp. PCC 7418
ref|WP_032527362.1|  chaperonin                                       57.0    1e-07   Prochlorococcus marinus
ref|WP_028082734.1|  chaperonin                                       57.0    1e-07   Dolichospermum circinale
ref|WP_032513302.1|  chaperonin                                       57.0    1e-07   Prochlorococcus marinus
ref|WP_013191733.1|  molecular chaperone GroES                        57.0    1e-07   Trichormus azollae
ref|WP_009756748.1|  MULTISPECIES: molecular chaperone GroES          57.0    1e-07   Fischerella
ref|WP_031933947.1|  molecular chaperone GroES                        57.0    1e-07   Candidatus Hepatobacter penaei
ref|WP_012407590.1|  molecular chaperone GroES                        57.0    1e-07   Nostoc
ref|WP_015142262.1|  Co-chaperonin GroES                              57.0    1e-07   Pleurocapsa minor
ref|WP_022660630.1|  molecular chaperone GroES                        56.6    1e-07   Desulfovibrio longus
ref|WP_013230909.1|  chaperonin                                       57.0    1e-07   Amycolatopsis
ref|WP_024124016.1|  heat shock protein 60 family co-chaperone GroES  57.0    1e-07   Thermosynechococcus sp. NK55a
ref|WP_015130973.1|  MULTISPECIES: 10 kDa chaperonin                  57.0    1e-07   Nostocales
ref|WP_019501756.1|  molecular chaperone GroES                        56.6    1e-07   Pseudanabaena sp. PCC 6802
ref|WP_025747014.1|  molecular chaperone GroES                        56.6    1e-07   Caldicoprobacter
ref|WP_008996322.1|  molecular chaperone GroES                        56.6    1e-07   Novosphingobium sp. Rr 2-17
ref|WP_043569699.1|  chaperonin                                       56.6    1e-07   Actinopolyspora
ref|WP_026894497.1|  molecular chaperone GroES                        56.6    1e-07   Clostridiisalibacter paucivorans
ref|WP_043560528.1|  molecular chaperone GroES                        56.6    2e-07   Acetobacteraceae
ref|WP_027403125.1|  chaperonin                                       56.6    2e-07   Nostocales
ref|WP_036919118.1|  MULTISPECIES: chaperonin                         56.6    2e-07   Prochlorococcus
ref|WP_008757222.1|  molecular chaperone GroES                        56.6    2e-07   Rhodobacteraceae bacterium KLH11
ref|WP_003058043.1|  chaperonin GroES                                 56.6    2e-07   Amycolatopsis vancoresmycina
ref|WP_009787538.1|  MULTISPECIES: molecular chaperone GroES          56.6    2e-07   Lyngbya
ref|WP_031549416.1|  molecular chaperone GroES                        56.2    2e-07   Parvularcula oceani
ref|WP_017717870.1|  molecular chaperone GroES                        56.6    2e-07   Oscillatoria sp. PCC 10802
ref|WP_006633072.1|  MULTISPECIES: molecular chaperone GroES          56.6    2e-07   Oscillatoriales
ref|WP_017324775.1|  hypothetical protein                             56.6    2e-07   Synechococcus sp. PCC 7336
ref|WP_010219561.1|  molecular chaperone GroES                        56.2    2e-07   Sphingomonas sp. PAMC 26621
ref|WP_016951426.1|  molecular chaperone GroES                        56.6    2e-07   Nostocaceae
ref|WP_010404457.1|  MULTISPECIES: molecular chaperone GroES          56.2    2e-07   Sphingomonas
ref|WP_017294973.1|  molecular chaperone GroES                        56.6    2e-07   Geminocystis herdmanii
ref|XP_009624343.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...  58.9    2e-07   Nicotiana tomentosiformis
ref|WP_026735558.1|  chaperonin                                       56.6    2e-07   Fischerella sp. PCC 9605
ref|WP_039753706.1|  chaperonin                                       56.2    2e-07   Tolypothrix sp. NIES-4075
ref|WP_002759486.1|  molecular chaperone GroES                        56.2    2e-07   Microcystis
ref|XP_009770556.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...  58.5    2e-07   Nicotiana sylvestris
ref|WP_029600784.1|  molecular chaperone GroES                        56.2    2e-07   Gemmata obscuriglobus
dbj|BAF95908.1|  chaperonin GroES                                     56.2    2e-07   Nostoc commune KU002
ref|WP_039726131.1|  MULTISPECIES: chaperonin                         56.2    2e-07   Lyngbya confervoides
ref|WP_038556864.1|  chaperonin                                       56.2    2e-07   Synechococcus sp. KORDI-52
ref|WP_009133726.1|  molecular chaperone GroES                        55.8    2e-07   Alistipes indistinctus
ref|WP_008829392.1|  MULTISPECIES: molecular chaperone GroES          56.2    2e-07   Sphingomonadaceae
ref|WP_015218964.1|  10 kDa chaperonin                                56.2    2e-07   Cyanobacterium aponinum
ref|WP_015124241.1|  Co-chaperonin GroES                              56.2    2e-07   Synechococcus sp. PCC 6312
ref|WP_014074408.1|  molecular chaperone GroES                        56.2    2e-07   Sphingobium sp. SYK-6
ref|WP_015205864.1|  Co-chaperonin GroES                              56.2    2e-07   Cylindrospermum stagnale
ref|WP_015228133.1|  Co-chaperonin GroES                              56.2    2e-07   Dactylococcopsis salina
ref|WP_007032412.1|  chaperonin GroES                                 55.8    2e-07   Actinobacteria
ref|WP_013320552.1|  molecular chaperone GroES                        56.2    2e-07   Cyanothece sp. PCC 7822
ref|WP_010183565.1|  molecular chaperone GroES                        55.8    2e-07   Sphingomonas sp. PAMC 26605
ref|WP_015139196.1|  Co-chaperonin GroES                              56.2    2e-07   Nostoc sp. PCC 7524
ref|WP_008038538.1|  molecular chaperone GroES                        55.8    3e-07   Bartonella tamiae
ref|WP_043973791.1|  molecular chaperone GroES                        55.8    3e-07   Novosphingobium
ref|WP_015113912.1|  10 kDa chaperonin                                56.2    3e-07   Nostoc sp. PCC 7107
ref|WP_009342971.1|  molecular chaperone GroES                        55.8    3e-07   Aphanizomenonaceae
ref|WP_026467152.1|  chaperonin                                       56.2    3e-07   
ref|WP_016338185.1|  MULTISPECIES: chaperonin GroES                   56.2    3e-07   
ref|WP_026794087.1|  MULTISPECIES: chaperonin                         55.8    3e-07   
ref|WP_016863380.1|  MULTISPECIES: molecular chaperone GroES          55.8    3e-07   
ref|WP_012830442.1|  molecular chaperone GroES                        55.8    3e-07   
ref|WP_033922939.1|  molecular chaperone GroES                        55.8    3e-07   
ref|WP_009085068.1|  MULTISPECIES: chaperonin                         56.2    3e-07   
ref|WP_029638604.1|  chaperonin [                                     55.8    3e-07   
ref|WP_015083039.1|  chaperonin GroES                                 55.8    3e-07   
gb|AII48545.1|  molecular chaperone GroES                             56.2    3e-07   
ref|WP_009821400.1|  molecular chaperone GroES                        55.8    3e-07   
ref|WP_038521691.1|  chaperonin                                       55.8    3e-07   
ref|WP_025782359.1|  chaperonin                                       55.8    3e-07   
ref|WP_029134558.1|  molecular chaperone GroES                        55.8    3e-07   
ref|WP_025930837.1|  chaperonin                                       55.8    3e-07   
ref|WP_022915182.1|  chaperonin                                       55.8    3e-07   
ref|WP_035153266.1|  chaperonin                                       55.8    3e-07   
gb|KIJ82845.1|  chaperonin                                            55.8    3e-07   
ref|WP_037499735.1|  molecular chaperone GroES                        55.5    3e-07   
ref|WP_002769848.1|  molecular chaperone GroES                        55.5    4e-07   
ref|WP_039794028.1|  chaperonin                                       55.8    4e-07   
ref|WP_017315948.1|  molecular chaperone GroES                        55.5    4e-07   
ref|WP_014147783.1|  molecular chaperone GroES                        55.5    4e-07   
ref|WP_016878545.1|  molecular chaperone GroES                        55.5    4e-07   
ref|WP_016863623.1|  molecular chaperone GroES                        55.8    4e-07   
ref|WP_041037410.1|  chaperonin                                       55.5    4e-07   
ref|WP_015116770.1|  Co-chaperonin GroES                              55.5    4e-07   
ref|WP_039392840.1|  molecular chaperone GroES                        55.5    4e-07   
ref|WP_018294077.1|  molecular chaperone GroES                        55.5    4e-07   
ref|WP_027298451.1|  molecular chaperone GroES                        55.5    4e-07   
gb|EKE08906.1|  hypothetical protein ACD_16C00235G0002                55.5    4e-07   
ref|WP_044546452.1|  molecular chaperone GroES                        55.1    4e-07   
ref|WP_013119662.1|  molecular chaperone GroES                        55.1    4e-07   
ref|WP_004670340.1|  MULTISPECIES: chaperonin                         55.5    4e-07   
ref|WP_005168579.1|  Heat shock protein 60 family co-chaperone GroES  55.5    4e-07   
ref|WP_012599166.1|  molecular chaperone GroES                        55.5    4e-07   
ref|WP_022636062.1|  chaperonin Cpn10                                 55.1    4e-07   
ref|WP_012098520.1|  molecular chaperone GroES                        55.1    5e-07   
ref|WP_033289958.1|  chaperonin                                       55.5    5e-07   
ref|WP_010475295.1|  MULTISPECIES: molecular chaperone GroES          55.5    5e-07   
ref|WP_017594377.1|  hypothetical protein                             55.1    5e-07   
ref|WP_006193124.1|  MULTISPECIES: molecular chaperone GroES          55.1    5e-07   
ref|WP_037808959.1|  MULTISPECIES: chaperonin                         55.5    5e-07   
ref|WP_017321483.1|  molecular chaperone GroES                        55.5    5e-07   
ref|WP_015336280.1|  chaperonin small subunit                         55.1    5e-07   
ref|WP_038575804.1|  molecular chaperone GroES                        55.1    5e-07   
ref|WP_043830742.1|  molecular chaperone GroES                        55.1    5e-07   
ref|WP_026733543.1|  chaperonin                                       55.1    5e-07   
ref|WP_006530606.1|  Co-chaperonin GroES                              55.1    5e-07   
ref|WP_009457502.1|  MULTISPECIES: molecular chaperone GroES          55.1    5e-07   
ref|WP_013787499.1|  MULTISPECIES: molecular chaperone GroES          55.1    6e-07   
emb|CCQ75047.1|  10kDa chaperonin                                     55.1    6e-07   
ref|WP_014224795.1|  molecular chaperone GroES                        54.7    6e-07   
ref|WP_019856183.1|  chaperonin                                       55.1    6e-07   
ref|WP_008125504.1|  molecular chaperone GroES                        55.1    6e-07   
ref|WP_039097319.1|  molecular chaperone GroES                        54.7    6e-07   
ref|WP_027047173.1|  molecular chaperone GroES                        55.1    6e-07   
ref|WP_035028463.1|  MULTISPECIES: molecular chaperone GroES          55.1    6e-07   
ref|WP_044304874.1|  chaperonin                                       55.1    6e-07   
ref|WP_025898345.1|  molecular chaperone GroES                        55.1    6e-07   
ref|WP_014106555.1|  molecular chaperone GroES                        54.7    6e-07   
ref|WP_022603715.1|  co-chaperonin GroES (HSP10)                      55.1    6e-07   
ref|WP_021688414.1|  10 kDa chaperonin                                54.7    6e-07   
ref|WP_025034694.1|  molecular chaperone GroES                        55.1    6e-07   
ref|WP_023936633.1|  MULTISPECIES: heat shock protein 60 family c...  54.7    6e-07   
ref|WP_012308053.1|  MULTISPECIES: molecular chaperone GroES          55.1    6e-07   
ref|WP_007098819.1|  molecular chaperone GroES                        55.1    6e-07   
ref|WP_034160070.1|  molecular chaperone GroES                        54.7    6e-07   
ref|WP_018431327.1|  molecular chaperone GroES                        55.1    6e-07   
ref|WP_025437639.1|  molecular chaperone GroES                        54.7    7e-07   
ref|WP_023836010.1|  molecular chaperone GroES                        55.1    7e-07   
ref|WP_009757809.1|  molecular chaperone GroES                        54.7    7e-07   
ref|WP_016844150.1|  molecular chaperone GroES                        55.1    7e-07   
gb|AFW61545.1|  hypothetical protein ZEAMMB73_489658                  55.1    7e-07   
ref|WP_039732793.1|  molecular chaperone GroES                        54.7    7e-07   
ref|WP_005981927.1|  molecular chaperone GroES                        54.7    7e-07   
ref|WP_040819659.1|  chaperonin                                       55.1    7e-07   
ref|WP_017627860.1|  hypothetical protein                             54.7    7e-07   
ref|WP_026786573.1|  chaperonin                                       54.7    7e-07   
ref|WP_004929299.1|  MULTISPECIES: molecular chaperone GroES          54.7    7e-07   
ref|WP_015852891.1|  molecular chaperone GroES                        54.7    7e-07   
ref|WP_027027752.1|  molecular chaperone GroES                        54.7    7e-07   
ref|WP_025925575.1|  chaperonin                                       54.7    7e-07   
ref|WP_013298561.1|  molecular chaperone GroES                        54.7    7e-07   
ref|WP_013275111.1|  molecular chaperone GroES                        54.7    8e-07   
ref|WP_011415795.1|  molecular chaperone GroES                        54.7    8e-07   
ref|WP_004646315.1|  MULTISPECIES: chaperonin                         54.7    8e-07   
ref|WP_040882031.1|  molecular chaperone GroES                        54.7    8e-07   
ref|XP_010520525.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...  57.0    8e-07   
ref|WP_002737272.1|  MULTISPECIES: molecular chaperone GroES          54.7    8e-07   
ref|WP_018450237.1|  molecular chaperone GroES                        54.3    8e-07   
ref|WP_024545343.1|  chaperonin                                       54.7    9e-07   
ref|WP_015712127.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_011056041.1|  molecular chaperone GroES                        54.7    9e-07   
ref|WP_027721312.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_034706250.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_028580189.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_029896750.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_015135232.1|  10 kDa chaperonin                                54.7    9e-07   
ref|WP_034586362.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_010513746.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_005176348.1|  chaperonin                                       54.3    9e-07   
ref|WP_021688139.1|  chaperonin GroS                                  54.3    9e-07   
ref|WP_008069392.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_024342337.1|  molecular chaperone GroES                        54.7    9e-07   
ref|WP_011413798.1|  molecular chaperone GroES                        54.7    9e-07   
ref|WP_015769104.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_037514464.1|  MULTISPECIES: molecular chaperone GroES          54.3    9e-07   
ref|WP_004863380.1|  chaperonin                                       54.3    9e-07   
ref|WP_010507662.1|  molecular chaperone GroES                        54.3    9e-07   
ref|WP_044107154.1|  chaperonin                                       54.3    9e-07   
ref|WP_004828341.1|  MULTISPECIES: molecular chaperone GroES          54.3    1e-06   
ref|WP_035161790.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_011540765.1|  MULTISPECIES: molecular chaperone GroES          54.3    1e-06   
ref|WP_025812293.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_043787224.1|  chaperonin                                       54.7    1e-06   
ref|XP_010535800.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...  57.0    1e-06   
ref|WP_027637593.1|  molecular chaperone GroES                        54.3    1e-06   
gb|EEY90121.1|  chaperonin GroS                                       54.3    1e-06   
ref|WP_016655344.1|  chaperonin                                       54.3    1e-06   
dbj|GAM06270.1|  co-chaperonin GroES                                  54.3    1e-06   
ref|WP_042787713.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_038383530.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_040988406.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_017839870.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_015707471.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_023175526.1|  co-chaperonin GroES                              54.3    1e-06   
ref|WP_031317559.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_028139166.1|  molecular chaperone GroES                        54.3    1e-06   
tpg|DAA39914.1|  TPA: hypothetical protein ZEAMMB73_187365            57.4    1e-06   
ref|WP_005055182.1|  chaperonin                                       53.9    1e-06   
ref|WP_026079937.1|  chaperonin                                       54.3    1e-06   
ref|WP_028958561.1|  MULTISPECIES: molecular chaperone GroES          53.9    1e-06   
ref|WP_025062271.1|  molecular chaperone GroES                        53.9    1e-06   
ref|XP_008242272.1|  PREDICTED: 20 kDa chaperonin, chloroplastic      56.6    1e-06   
gb|EKD86841.1|  hypothetical protein ACD_37C00130G0001                53.9    1e-06   
ref|WP_015193019.1|  10 kDa chaperonin                                54.3    1e-06   
ref|WP_022676485.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_021243753.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_004328438.1|  MULTISPECIES: molecular chaperone GroES          53.9    1e-06   
ref|WP_029351268.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_021931251.1|  MULTISPECIES: 10 kDa chaperonin                  53.9    1e-06   
ref|WP_006422267.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_028487246.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_028948842.1|  chaperonin                                       54.3    1e-06   
ref|WP_020861555.1|  co-chaperonin GroES                              54.3    1e-06   
ref|WP_027154304.1|  molecular chaperone GroES                        54.3    1e-06   
ref|WP_033121528.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_003618201.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_012970076.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_019557053.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_004810787.1|  MULTISPECIES: molecular chaperone GroES          53.9    1e-06   
ref|WP_022674192.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_002686218.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_038375291.1|  molecular chaperone GroES                        53.9    1e-06   
gb|AIE73932.1|  Heat shock protein 60 family co-chaperone GroES       53.9    1e-06   
ref|WP_010872040.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_020735364.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_005858788.1|  MULTISPECIES: molecular chaperone GroES          53.9    1e-06   
ref|WP_013887379.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_041967795.1|  MULTISPECIES: hypothetical protein               53.9    1e-06   
ref|WP_005144860.1|  MULTISPECIES: chaperonin                         53.9    1e-06   
ref|WP_022101978.1|  10 kDa chaperonin                                53.5    1e-06   
emb|CDX70940.1|  BnaC03g10240D                                        56.2    1e-06   
ref|WP_022679188.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_020663848.1|  chaperonin                                       53.9    1e-06   
ref|WP_043108720.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_021228311.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_013515505.1|  molecular chaperone GroES                        53.9    1e-06   
ref|XP_009131811.1|  PREDICTED: 20 kDa chaperonin, chloroplastic      56.2    1e-06   
ref|WP_016167026.1|  MULTISPECIES: chaperonin                         53.9    1e-06   
ref|WP_039125558.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_027280435.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_007688871.1|  MULTISPECIES: molecular chaperone GroES          53.9    1e-06   
ref|WP_019460690.1|  MULTISPECIES: molecular chaperone GroES          53.9    1e-06   
ref|WP_012954133.1|  molecular chaperone GroES                        53.9    1e-06   
ref|WP_007090384.1|  MULTISPECIES: molecular chaperone GroES          53.9    2e-06   
emb|CDY51837.1|  BnaA03g56040D                                        56.2    2e-06   
ref|WP_029665681.1|  molecular chaperone GroES                        53.9    2e-06   
ref|WP_015596588.1|  molecular chaperone GroES                        53.9    2e-06   
ref|WP_028641022.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_027983058.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_013976221.1|  co-chaperonin GroES                              53.5    2e-06   
ref|WP_007353484.1|  MULTISPECIES: molecular chaperone GroES          53.9    2e-06   
ref|NP_001130154.1|  uncharacterized protein LOC100191248             56.2    2e-06   
ref|WP_039621577.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_026608727.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_042638259.1|  molecular chaperone GroES                        53.9    2e-06   
ref|WP_007190907.1|  molecular chaperone GroES                        53.5    2e-06   
ref|XP_008657984.1|  PREDICTED: uncharacterized protein LOC100191...  56.2    2e-06   
ref|WP_019246679.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_005951097.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_028969148.1|  molecular chaperone GroES                        53.5    2e-06   
gb|ABK96728.1|  unknown                                               56.2    2e-06   
ref|WP_018717579.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_018206348.1|  MULTISPECIES: hypothetical protein               53.5    2e-06   
ref|WP_022070910.1|  10 kDa chaperonin                                53.5    2e-06   
ref|XP_006345251.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...  56.2    2e-06   
ref|XP_009618950.1|  PREDICTED: 20 kDa chaperonin, chloroplastic-...  55.8    2e-06   
ref|WP_007285790.1|  co-chaperonin GroES                              53.5    2e-06   
gb|EAU54348.1|  co-chaperonin GroES                                   54.3    2e-06   
ref|WP_011955838.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_026908004.1|  hypothetical protein                             53.5    2e-06   
ref|WP_023718103.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_009452086.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_010162031.1|  MULTISPECIES: molecular chaperone GroES          53.5    2e-06   
ref|WP_022691615.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_006618364.1|  MULTISPECIES: molecular chaperone GroES          53.5    2e-06   
ref|WP_026134353.1|  chaperonin                                       53.5    2e-06   
ref|WP_010960044.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_022804519.1|  MULTISPECIES: molecular chaperone GroES          53.5    2e-06   
ref|WP_017542128.1|  MULTISPECIES: chaperonin                         53.5    2e-06   
ref|WP_035026152.1|  MULTISPECIES: molecular chaperone GroES          53.5    2e-06   
ref|WP_010544804.1|  MULTISPECIES: molecular chaperone GroES          53.5    2e-06   
gb|ABK96154.1|  unknown                                               55.8    2e-06   
ref|WP_018002775.1|  molecular chaperone GroES                        53.5    2e-06   
ref|WP_021319255.1|  molecular chaperone GroES                        53.1    2e-06   
ref|XP_006381585.1|  20 kDa chaperonin family protein                 55.8    2e-06   
gb|KIE11151.1|  chaperonin                                            53.5    2e-06   
gb|AFK36826.1|  unknown                                               55.8    2e-06   
ref|WP_022730235.1|  molecular chaperone GroES                        53.1    2e-06   



>ref|XP_004229710.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Solanum lycopersicum]
Length=135

 Score =   169 bits (427),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEELPEKSAGG+LLPKSAVKFERYLMGE+LSVG+ V++VETGK
Sbjct  43   KWEPTKVVPQADRVLIRLEELPEKSAGGVLLPKSAVKFERYLMGEVLSVGSDVAQVETGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RH FCKE +LLA+VE
Sbjct  103  KVLFSDINAYEVDLGTDARHCFCKESELLALVE  135



>ref|XP_010691984.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=134

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLE+LPEKSAGG+LLPKSAVKFERYLMGEILSVG+ V EVETGK
Sbjct  42   KWEPTKVVPQADRVLIRLEDLPEKSAGGVLLPKSAVKFERYLMGEILSVGSDVGEVETGK  101

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+LG++ RH FCKE DLLAVVE
Sbjct  102  KVLFSDISAYEVDLGSDSRHCFCKESDLLAVVE  134



>ref|XP_006354639.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Solanum tuberosum]
Length=135

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEELPEKSAGG+LLPKSAVKFERYLMGE+LSVG  V++VETGK
Sbjct  43   KWEPTKVVPQADRVLIRLEELPEKSAGGVLLPKSAVKFERYLMGEVLSVGAEVAQVETGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RH FCKE +LLA+VE
Sbjct  103  KVLFSDINAYEVDLGTDARHCFCKESELLALVE  135



>ref|XP_002526500.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35891.1| ATP binding protein, putative [Ricinus communis]
Length=137

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KW+PTKVVPQADRVLIRL+ELPEKS+GG+LLPKSAVKFERYLMGEILSVGT V EVE GK
Sbjct  45   KWDPTKVVPQADRVLIRLDELPEKSSGGVLLPKSAVKFERYLMGEILSVGTEVGEVEAGK  104

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ +H FCK GDLLAVVE
Sbjct  105  KVLFSDINAYEVDLGTDAKHCFCKAGDLLAVVE  137



>ref|XP_010919833.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Elaeis guineensis]
Length=142

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP+KVVPQADRVLIRLEELPEKSAGG+LLPKSAVKFERYLMGEILSVG  V++VETGK
Sbjct  50   KWEPSKVVPQADRVLIRLEELPEKSAGGVLLPKSAVKFERYLMGEILSVGADVAQVETGK  109

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+LGT+ +H FC+ GDLLAVVE
Sbjct  110  KVLFSDISAYEVDLGTDAKHCFCRAGDLLAVVE  142



>ref|XP_002267346.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Vitis vinifera]
 emb|CBI16720.3| unnamed protein product [Vitis vinifera]
Length=134

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRL++LPEKS+GG+LLPKSAVKFERYLMGEILS+G  V EVE GK
Sbjct  42   KWEPTKVVPQADRVLIRLQDLPEKSSGGVLLPKSAVKFERYLMGEILSIGADVGEVEAGK  101

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RH FCKE DLLAVVE
Sbjct  102  KVLFSDINAYEVDLGTDGRHCFCKESDLLAVVE  134



>gb|KJB24925.1| hypothetical protein B456_004G168100 [Gossypium raimondii]
Length=136

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRL+ELPEKSAGG+LLPKSAVKFERYLMGEI+SVG  V  VETGK
Sbjct  44   KWEPTKVVPQADRVLIRLQELPEKSAGGVLLPKSAVKFERYLMGEIVSVGAEVGNVETGK  103

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RHVFCKE DLLA V+
Sbjct  104  KVLFSDINAYEVDLGTDTRHVFCKESDLLAEVD  136



>gb|KJB24923.1| hypothetical protein B456_004G168100 [Gossypium raimondii]
Length=135

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRL+ELPEKSAGG+LLPKSAVKFERYLMGEI+SVG  V  VETGK
Sbjct  43   KWEPTKVVPQADRVLIRLQELPEKSAGGVLLPKSAVKFERYLMGEIVSVGAEVGNVETGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RHVFCKE DLLA V+
Sbjct  103  KVLFSDINAYEVDLGTDTRHVFCKESDLLAEVD  135



>ref|XP_006375101.1| chaperonin 10 family protein [Populus trichocarpa]
 gb|ABK92608.1| unknown [Populus trichocarpa]
 gb|ERP52898.1| chaperonin 10 family protein [Populus trichocarpa]
Length=138

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLE+LPEKS+GG+LLPKSAVKFERYLMGE+LSVG  V EVE GK
Sbjct  46   KWEPTKVVPQADRVLIRLEDLPEKSSGGVLLPKSAVKFERYLMGEVLSVGAEVGEVEAGK  105

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYE++LGT+ +H FCK GDLLAVVE
Sbjct  106  KVLFSDINAYEIDLGTDAKHCFCKAGDLLAVVE  138



>ref|XP_009388341.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=140

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP+KV PQADRVLIRLEELPEKSAGG+LLPKSAVKFERY+MG++LSVG+ V+EVE GK
Sbjct  48   KWEPSKVAPQADRVLIRLEELPEKSAGGVLLPKSAVKFERYIMGKVLSVGSDVAEVEAGK  107

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGTE +H FCK GDLLAVVE
Sbjct  108  KVLFSDINAYEVDLGTEAKHCFCKAGDLLAVVE  140



>emb|CDP09382.1| unnamed protein product [Coffea canephora]
Length=137

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K+EPTKVVPQADRVLIRLEELP+KSAGG+LLPKSAVKFERYLMGE++SVGT   EV +GK
Sbjct  45   KFEPTKVVPQADRVLIRLEELPQKSAGGVLLPKSAVKFERYLMGEVISVGTEAGEVNSGK  104

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGTE RH FCK GDLLAVVE
Sbjct  105  KVLFSDINAYEVDLGTEARHCFCKAGDLLAVVE  137



>ref|XP_011031730.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Populus euphratica]
Length=138

 Score =   165 bits (417),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLE+LPEKS+GG+LLPKSAVKFERYLMGE+LSVG  V EVE GK
Sbjct  46   KWEPTKVVPQADRVLIRLEDLPEKSSGGVLLPKSAVKFERYLMGEVLSVGAEVGEVEAGK  105

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYE++LGT+ +H FCK GDLLAVVE
Sbjct  106  KVLFSDINAYEIDLGTDAKHCFCKAGDLLAVVE  138



>ref|XP_004307266.1| PREDICTED: 10 kDa chaperonin, cyanelle [Fragaria vesca subsp. 
vesca]
Length=135

 Score =   164 bits (416),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLE+LPEKS GG+LLPKSAVKFERYLMGE+LSVG  V EV+ GK
Sbjct  43   KWEPTKVVPQADRVLIRLEQLPEKSTGGVLLPKSAVKFERYLMGEVLSVGADVGEVQAGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGTE RH FCKE +LLAVVE
Sbjct  103  KVLFSDINAYEVDLGTEGRHCFCKESELLAVVE  135



>gb|KDP28905.1| hypothetical protein JCGZ_14676 [Jatropha curcas]
Length=135

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLE+LPEKS GG+LLPKSAVKFERYLMGE+LSVG  V EV+ GK
Sbjct  43   KWEPTKVVPQADRVLIRLEDLPEKSTGGVLLPKSAVKFERYLMGEVLSVGAEVGEVDAGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ +H FCK GDLLAVVE
Sbjct  103  KVLFSDINAYEVDLGTDAKHCFCKAGDLLAVVE  135



>ref|XP_008784707.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Phoenix dactylifera]
Length=142

 Score =   164 bits (416),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP+KVVPQADRVLIRLEELPEKSAGG+LLPKSAVKFERYLMGEILSVG  V++VE GK
Sbjct  50   KWEPSKVVPQADRVLIRLEELPEKSAGGVLLPKSAVKFERYLMGEILSVGADVAQVEAGK  109

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LG + +H FC+ GDLLAVVE
Sbjct  110  KVLFSDINAYEVDLGADVKHCFCRAGDLLAVVE  142



>ref|XP_009767520.1| PREDICTED: 10 kDa chaperonin, cyanelle-like [Nicotiana sylvestris]
Length=135

 Score =   164 bits (414),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEEL EKSAGG+LLPKSAVKFERYLMGE+LSVG+ V++VE GK
Sbjct  43   KWEPTKVVPQADRVLIRLEELSEKSAGGVLLPKSAVKFERYLMGEVLSVGSEVAQVEAGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RH FCKE +LLA+VE
Sbjct  103  KVLFSDINAYEVDLGTDARHCFCKESELLALVE  135



>ref|XP_009613430.1| PREDICTED: 10 kDa chaperonin, cyanelle isoform X1 [Nicotiana 
tomentosiformis]
Length=135

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEEL EKSAGG+LLPKSAVKFERYLMGE+LSVG+ V++VE GK
Sbjct  43   KWEPTKVVPQADRVLIRLEELAEKSAGGVLLPKSAVKFERYLMGEVLSVGSEVAQVEAGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RH FCKE +LLA+VE
Sbjct  103  KVLFSDINAYEVDLGTDARHCFCKESELLALVE  135



>ref|XP_007052412.1| GroES-like family protein [Theobroma cacao]
 gb|EOX96569.1| GroES-like family protein [Theobroma cacao]
Length=135

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRL+ELPEKSAGG+LLPKSAVKFERYLMGEI+SVGT V +VE GK
Sbjct  43   KWEPTKVVPQADRVLIRLQELPEKSAGGLLLPKSAVKFERYLMGEIVSVGTDVGKVEPGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYE++LGT+ RHVFCK  DLLA VE
Sbjct  103  KVLFSDINAYEIDLGTDTRHVFCKVSDLLAEVE  135



>ref|XP_009370952.1| PREDICTED: 20 kDa chaperonin, chloroplastic isoform X2 [Pyrus 
x bretschneideri]
Length=136

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEELP+KSAGG+LLPKSAVKFERYLMGEILSVG  V EV+ GK
Sbjct  44   KWEPTKVVPQADRVLIRLEELPQKSAGGVLLPKSAVKFERYLMGEILSVGADVGEVKAGK  103

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LG + RH FCKE +LLAVVE
Sbjct  104  KVLFSDINAYEVDLGVDGRHCFCKESELLAVVE  136



>ref|XP_006662614.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Oryza brachyantha]
Length=149

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P+KV PQ+DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILSVG  VSEVE GK
Sbjct  57   KYDPSKVAPQSDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSVGADVSEVEAGK  116

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+E+H FC+E DLLAVVE
Sbjct  117  KVLFSDINAYEVDLGTDEKHCFCRESDLLAVVE  149



>gb|KHG01043.1| 20 kDa chaperonin, chloroplastic -like protein [Gossypium arboreum]
Length=135

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRL+EL EKSAGG+LLPKSAVKFERYLMGEI+SVG  V  +ETGK
Sbjct  43   KWEPTKVVPQADRVLIRLQELSEKSAGGVLLPKSAVKFERYLMGEIVSVGAEVGNMETGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ +HVFCKE DLLA V+
Sbjct  103  KVLFSDINAYEVDLGTDTKHVFCKESDLLAEVD  135



>ref|XP_008343996.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like isoform X2 [Malus 
domestica]
Length=136

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLE LP+KSAGG+LLPKSAVKFERYLMGEILSVG  V EV+ GK
Sbjct  44   KWEPTKVVPQADRVLIRLEXLPQKSAGGVLLPKSAVKFERYLMGEILSVGADVGEVKAGK  103

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LG + RH FCKE +LLAVVE
Sbjct  104  KVLFSDINAYEVDLGVDGRHCFCKESELLAVVE  136



>ref|XP_009384697.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=143

 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K EP+K+ PQADRVL+RLEELPEKSAGG+LLPKSAVKFERYLMGEILSVG+ V+EVE GK
Sbjct  51   KCEPSKIAPQADRVLVRLEELPEKSAGGVLLPKSAVKFERYLMGEILSVGSDVTEVEAGK  110

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ +H FCK  DLLAVVE
Sbjct  111  KVLFSDINAYEVDLGTDTKHCFCKASDLLAVVE  143



>ref|XP_004983611.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Setaria italica]
Length=133

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ+DRVL+RL ++PEKSAGG+LLPKSAVKFERYLMGEILSVG  VSEVE GK
Sbjct  41   KYDPAKVAPQSDRVLVRLHQIPEKSAGGVLLPKSAVKFERYLMGEILSVGADVSEVEAGK  100

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+E+H FC+E DLLAVVE
Sbjct  101  KVLFSDINAYEVDLGTDEKHCFCRESDLLAVVE  133



>ref|XP_010269887.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Nelumbo nucifera]
Length=135

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQ+DRVLIRLEELP KS GG+LLPKSAVKFERYLMGEILSVG+ V EVE GK
Sbjct  43   KWEPTKVVPQSDRVLIRLEELPAKSVGGVLLPKSAVKFERYLMGEILSVGSDVKEVEAGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVL SD+NAYEV+LGT+ RH F +E DL+AVVE
Sbjct  103  KVLLSDINAYEVDLGTDARHCFARESDLMAVVE  135



>ref|XP_009370951.1| PREDICTED: 20 kDa chaperonin, chloroplastic isoform X1 [Pyrus 
x bretschneideri]
Length=139

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 85/96 (89%), Gaps = 3/96 (3%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEELP+KSAGG+LLPKSAVKFERYLMGEILSVG  V EV+ GK
Sbjct  44   KWEPTKVVPQADRVLIRLEELPQKSAGGVLLPKSAVKFERYLMGEILSVGADVGEVKAGK  103

Query  210  KVLFSDVNAYEVN---LGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEVN   LG + RH FCKE +LLAVVE
Sbjct  104  KVLFSDINAYEVNRVDLGVDGRHCFCKESELLAVVE  139



>ref|NP_001065426.2| Os10g0566700 [Oryza sativa Japonica Group]
 gb|AAL79700.1|AC087599_19 putative chloroplast chaperonin [Oryza sativa Japonica Group]
 gb|AAP55067.1| chloroplast chaperonin 10, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEC67465.1| hypothetical protein OsI_34694 [Oryza sativa Indica Group]
 dbj|BAF27263.2| Os10g0566700 [Oryza sativa Japonica Group]
Length=140

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P+KV PQ+DRVL+RLE++PEKS GG+LLPKSAVKFERYLMGEILSVG  V+EVE GK
Sbjct  48   KYDPSKVAPQSDRVLVRLEQIPEKSVGGVLLPKSAVKFERYLMGEILSVGADVNEVEAGK  107

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+E+H FC+E DLLAVVE
Sbjct  108  KVLFSDINAYEVDLGTDEKHCFCRESDLLAVVE  140



>ref|XP_010089780.1| 10 kDa chaperonin [Morus notabilis]
 gb|EXB38372.1| 10 kDa chaperonin [Morus notabilis]
Length=136

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVL+RLE+LPEKSAGG+LLPKSAVKFERYL GEILSVG  V  V+ G 
Sbjct  44   KWEPTKVVPQADRVLVRLEQLPEKSAGGVLLPKSAVKFERYLTGEILSVGADVGGVKAGT  103

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ +H FCKE DLLAVVE
Sbjct  104  KVLFSDINAYEVDLGTDTKHCFCKESDLLAVVE  136



>ref|XP_002302485.2| hypothetical protein POPTR_0002s13670g [Populus trichocarpa]
 gb|EEE81758.2| hypothetical protein POPTR_0002s13670g [Populus trichocarpa]
Length=129

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KV PQADRV+IRLE+LPEKS+GG+LLPKSAVKFERYLMGE+LSVG    EVE GK
Sbjct  37   KWEPAKVAPQADRVVIRLEDLPEKSSGGVLLPKSAVKFERYLMGEVLSVGAEAGEVEAGK  96

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            +VLFSD+NAYEV+LGT+ +H FCK GDLLAVVE
Sbjct  97   RVLFSDINAYEVDLGTDAKHCFCKAGDLLAVVE  129



>ref|XP_006445475.1| hypothetical protein CICLE_v10022799mg [Citrus clementina]
 ref|XP_006464381.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Citrus sinensis]
 gb|ESR58715.1| hypothetical protein CICLE_v10022799mg [Citrus clementina]
 gb|KDO85418.1| hypothetical protein CISIN_1g032685mg [Citrus sinensis]
Length=136

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVL+RLE+LPEKSAGGILLPK+AVKFERYLMGEIL+VG  V +V  GK
Sbjct  44   KWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGK  103

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+LG +ERH F KE DLLAVVE
Sbjct  104  KVLFSDISAYEVDLGADERHCFVKESDLLAVVE  136



>ref|XP_002467468.1| hypothetical protein SORBIDRAFT_01g028650 [Sorghum bicolor]
 gb|EER94466.1| hypothetical protein SORBIDRAFT_01g028650 [Sorghum bicolor]
Length=134

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+R++++PEKSAGG+LLPKSAVKFERYLMGEILSVG  VSEVE GK
Sbjct  42   KYDPAKVAPQNDRVLVRIQQIPEKSAGGVLLPKSAVKFERYLMGEILSVGADVSEVEAGK  101

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+E+H FC+E DLLA+VE
Sbjct  102  KVLFSDINAYEVDLGTDEKHCFCRESDLLALVE  134



>ref|XP_003574355.1| PREDICTED: 10 kDa chaperonin, cyanelle-like [Brachypodium distachyon]
Length=143

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
              +P+KV PQ+DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILSVG  VSEVE GK
Sbjct  51   NCDPSKVAPQSDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSVGADVSEVEAGK  110

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            KVLFSD+NAYEV+LGTEE+H FC+E DLLAVV
Sbjct  111  KVLFSDINAYEVDLGTEEKHCFCRESDLLAVV  142



>dbj|BAJ86245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=137

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K +P+KV PQ+DRVL+RLE +PEKSAGG+LLPKSAVKFERYLMGEILSVG  VSEVE GK
Sbjct  45   KCDPSKVEPQSDRVLVRLETIPEKSAGGVLLPKSAVKFERYLMGEILSVGVDVSEVEAGK  104

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            KVLFSD+NAYEV+LGTEE+H FC+E DLLAVV
Sbjct  105  KVLFSDINAYEVDLGTEEKHCFCRESDLLAVV  136



>gb|ACG32579.1| CHL-CPN10 [Zea mays]
Length=132

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RL+++PEKSAGG+LLPKSAVKFERYLMGEILSVG  VSEVE GK
Sbjct  40   KYDPAKVAPQNDRVLVRLQQIPEKSAGGVLLPKSAVKFERYLMGEILSVGADVSEVEAGK  99

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+L T+E+H FC+E DLLAVVE
Sbjct  100  KVLFSDINAYEVDLDTDEKHCFCRESDLLAVVE  132



>gb|ACF79087.1| unknown [Zea mays]
 gb|ACF85869.1| unknown [Zea mays]
 gb|ACG27064.1| CHL-CPN10 [Zea mays]
 gb|ACG46453.1| CHL-CPN10 [Zea mays]
 gb|AFW87808.2| hypothetical protein ZEAMMB73_436274 [Zea mays]
Length=135

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RL+++PEKSAGG+LLPKSAVKFERYLMGEILSVG  VSEVE GK
Sbjct  43   KYDPAKVAPQNDRVLVRLQQIPEKSAGGVLLPKSAVKFERYLMGEILSVGADVSEVEAGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+L T+E+H FC+E DLLAVVE
Sbjct  103  KVLFSDINAYEVDLDTDEKHCFCRESDLLAVVE  135



>ref|XP_008343989.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like isoform X1 [Malus 
domestica]
Length=139

 Score =   157 bits (396),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 84/96 (88%), Gaps = 3/96 (3%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLE LP+KSAGG+LLPKSAVKFERYLMGEILSVG  V EV+ GK
Sbjct  44   KWEPTKVVPQADRVLIRLEXLPQKSAGGVLLPKSAVKFERYLMGEILSVGADVGEVKAGK  103

Query  210  KVLFSDVNAYEVN---LGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEVN   LG + RH FCKE +LLAVVE
Sbjct  104  KVLFSDINAYEVNRVDLGVDGRHCFCKESELLAVVE  139



>gb|EEE51424.1| hypothetical protein OsJ_32502 [Oryza sativa Japonica Group]
Length=221

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P+KV PQ+DRVL+RLE++PEKS GG+LLPKSAVKFERYLMGEILSVG  V+EVE GK
Sbjct  129  KYDPSKVAPQSDRVLVRLEQIPEKSVGGVLLPKSAVKFERYLMGEILSVGADVNEVEAGK  188

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+E+H FC+E DLLAVVE
Sbjct  189  KVLFSDINAYEVDLGTDEKHCFCRESDLLAVVE  221



>ref|XP_011017532.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like, partial [Populus 
euphratica]
Length=122

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKV PQADRVLIRLE+LPEKS+GG+LLPKSAVKFERYLMGE+LSVG  V EVE  K
Sbjct  30   KWEPTKVGPQADRVLIRLEDLPEKSSGGVLLPKSAVKFERYLMGEVLSVGAEVGEVEAVK  89

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            +VLFSD+NAYEV+LGT  +H FCK GDLLAVVE
Sbjct  90   RVLFSDINAYEVDLGTYAKHCFCKAGDLLAVVE  122



>ref|NP_001141494.1| CHL-CPN10 isoform 1 [Zea mays]
 ref|XP_008667772.1| PREDICTED: CHL-CPN10 isoform 1 isoform X1 [Zea mays]
 gb|ACF79524.1| unknown [Zea mays]
 gb|ACF84508.1| unknown [Zea mays]
 gb|ACF86488.1| unknown [Zea mays]
 tpg|DAA46365.1| TPA: CHL-CPN10 isoform 1 [Zea mays]
 tpg|DAA46366.1| TPA: CHL-CPN10 isoform 2 [Zea mays]
Length=134

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  41   KYDPAKVAPQNDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  100

Query  210  KVLFSDVNAYEVNLGT-EERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV LGT EE+H FC+E DLLAVVE
Sbjct  101  KVLFSDINAYEVELGTDEEKHCFCRESDLLAVVE  134



>gb|ABK22191.1| unknown [Picea sitchensis]
 gb|ACN40138.1| unknown [Picea sitchensis]
Length=153

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLF  221
            +KVVPQADRVLIRLEELPEKSAGG+LLPKSAVKFE YLMG++LSVG+ V  +ETGK+V+F
Sbjct  65   SKVVPQADRVLIRLEELPEKSAGGVLLPKSAVKFEHYLMGQVLSVGSEVGNIETGKQVMF  124

Query  222  SDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            SD+NAYEVNLGT E+H FC+ GDLLAVVE
Sbjct  125  SDINAYEVNLGTPEKHCFCRAGDLLAVVE  153



>ref|XP_008668930.1| PREDICTED: 10 kDa chaperonin, cyanelle-like isoform X1 [Zea mays]
 tpg|DAA36145.1| TPA: CHL-CPN10 [Zea mays]
Length=134

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  41   KYDPAKVAPQNDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  100

Query  210  KVLFSDVNAYEVNLGT-EERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV LGT +E+H FC+E DLLAVVE
Sbjct  101  KVLFSDINAYEVELGTDDEKHCFCRESDLLAVVE  134



>ref|XP_008438275.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Cucumis melo]
Length=141

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGT--GVSEVET  203
            KWEP KVVPQADRVL+RLEELPEKSAGG+LLPKSAVKFERYL+GEILSVG   G +++  
Sbjct  47   KWEPAKVVPQADRVLVRLEELPEKSAGGVLLPKSAVKFERYLVGEILSVGAEVGGNDIAP  106

Query  204  GKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            GKKVL SD+NAYEV+LGT+ +H FCK GDLLAVVE
Sbjct  107  GKKVLLSDINAYEVDLGTDAKHCFCKAGDLLAVVE  141



>ref|XP_006838441.1| hypothetical protein AMTR_s00002p00128280 [Amborella trichopoda]
 gb|ERN01010.1| hypothetical protein AMTR_s00002p00128280 [Amborella trichopoda]
Length=137

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP+KVVPQ DRVLIRLEELP+KSAGG+LLPKSAVK ERYLMGE+LSVG  V  VE GK
Sbjct  45   KWEPSKVVPQVDRVLIRLEELPQKSAGGVLLPKSAVKLERYLMGEVLSVGKEVGSVEAGK  104

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+LGT+ +H FC+E DLLA+VE
Sbjct  105  KVLFSDLSAYEVDLGTDGKHCFCRESDLLALVE  137



>ref|XP_010052755.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Eucalyptus grandis]
 gb|KCW76829.1| hypothetical protein EUGRSUZ_D01184 [Eucalyptus grandis]
 gb|KCW76830.1| hypothetical protein EUGRSUZ_D01184 [Eucalyptus grandis]
Length=135

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVL+RLE+LPEKSAGG+LLPKSAVKFERYLMGE+LSVGT    V+ GK
Sbjct  43   KWEPAKVVPQADRVLVRLEQLPEKSAGGVLLPKSAVKFERYLMGEVLSVGTEAGVVDAGK  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSDV+AYEV+LG + +H F K GDLLAVVE
Sbjct  103  KVLFSDVSAYEVDLGGDAKHCFVKAGDLLAVVE  135



>gb|ACG44161.1| CHL-CPN10 [Zea mays]
Length=134

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKS GG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  41   KYDPAKVAPQNDRVLVRLEQIPEKSTGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  100

Query  210  KVLFSDVNAYEVNLGT-EERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV LGT +E+H FC+E DLLAVVE
Sbjct  101  KVLFSDINAYEVELGTDDEKHCFCRESDLLAVVE  134



>gb|KFK35223.1| hypothetical protein AALP_AA5G256400 [Arabis alpina]
Length=139

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVL+RLE L EKS+GG+LLPK+AVKFERYLMGE++SVG+ V+EV+ GK
Sbjct  47   KWEPTKVVPQADRVLVRLEVLREKSSGGVLLPKAAVKFERYLMGEVVSVGSEVAEVKPGK  106

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+ GT+ +H FCKE DLLA+V+
Sbjct  107  KVLFSDISAYEVDFGTDAKHCFCKESDLLAMVQ  139



>ref|XP_008367471.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Malus domestica]
Length=142

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTK+VPQADRVLIRLEELP KSAGG+LLP+SAVKFERYLMGEILSVG  V EV+ GK
Sbjct  55   KWEPTKLVPQADRVLIRLEELPLKSAGGVLLPRSAVKFERYLMGEILSVGADVGEVKAGK  114

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDL  293
            KVLFSD+NAYEV+LG + RH FCKE +L
Sbjct  115  KVLFSDINAYEVDLGVDGRHCFCKESEL  142



>tpg|DAA36151.1| TPA: CHL-CPN10 [Zea mays]
Length=289

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  196  KYDPAKVAPQNDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  255

Query  210  KVLFSDVNAYEVNLGT-EERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV LGT +E+H FC+E DLLAVVE
Sbjct  256  KVLFSDINAYEVELGTDDEKHCFCRESDLLAVVE  289



>gb|EYU42319.1| hypothetical protein MIMGU_mgv1a016021mg [Erythranthe guttata]
Length=137

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  33   WEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKK  212
            +EP KVVPQADRVL+RLEEL EKSAGG+LLPKSAVKFERYL+GE++S G  V EVETGKK
Sbjct  46   YEPAKVVPQADRVLVRLEELAEKSAGGVLLPKSAVKFERYLVGEVVSRGAEVEEVETGKK  105

Query  213  VLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            VLFSDV AYEV+LGT  RH FCK  DLLAV+E
Sbjct  106  VLFSDVTAYEVDLGTSARHCFCKASDLLAVIE  137



>ref|XP_004133964.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Cucumis sativus]
 gb|KGN56679.1| hypothetical protein Csa_3G128890 [Cucumis sativus]
Length=141

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 83/95 (87%), Gaps = 2/95 (2%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGT--GVSEVET  203
            KWEP KVVPQADRVL+RLEELPEKS GG+LLPKSAVKFERYL+G ILSVGT  G +++  
Sbjct  47   KWEPAKVVPQADRVLVRLEELPEKSVGGVLLPKSAVKFERYLVGVILSVGTEVGGNDIAP  106

Query  204  GKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            GKKVL SD+NAYEV+LGT+ +H FCK GDLLA+VE
Sbjct  107  GKKVLLSDINAYEVDLGTDAKHCFCKAGDLLAIVE  141



>ref|XP_004157690.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Cucumis sativus]
Length=138

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 83/95 (87%), Gaps = 2/95 (2%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGT--GVSEVET  203
            KWEP KVVPQADRVL+RLEELPEKS GG+LLPKSAVKFERYL+G ILSVGT  G +++  
Sbjct  44   KWEPAKVVPQADRVLVRLEELPEKSVGGVLLPKSAVKFERYLVGVILSVGTEVGGNDIAP  103

Query  204  GKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            GKKVL SD+NAYEV+LGT+ +H FCK GDLLA+VE
Sbjct  104  GKKVLLSDINAYEVDLGTDAKHCFCKAGDLLAIVE  138



>ref|XP_002878323.1| hypothetical protein ARALYDRAFT_486490 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54582.1| hypothetical protein ARALYDRAFT_486490 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVL+RLE LPEKS+GG+LLPKSAVKFERYL GE++SVG+ V EVE GK
Sbjct  45   KWEPAKVVPQADRVLVRLEVLPEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVEPGK  104

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KV+FSD++AYEV+ GT+ +H FCKE DLLA+V+
Sbjct  105  KVVFSDMSAYEVDFGTDAKHCFCKESDLLAIVQ  137



>gb|EPS72174.1| hypothetical protein M569_02588, partial [Genlisea aurea]
Length=109

 Score =   148 bits (374),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
             +EP+KVVPQADRVLIRLEELPEKSAGG+LLPKSAVKFERYL+GE+LS+G    +VETG 
Sbjct  16   NYEPSKVVPQADRVLIRLEELPEKSAGGVLLPKSAVKFERYLVGEVLSIGIDAGDVETGN  75

Query  210  KVLFSDVNAYEVNLGTEE-RHVFCKEGDLLAVVE  308
            KV+FSDVNAYEV+LG ++ R+ FCK GDL+AVV+
Sbjct  76   KVMFSDVNAYEVDLGRDDGRYCFCKAGDLMAVVD  109



>gb|AFK37353.1| unknown [Lotus japonicus]
 gb|AFK39467.1| unknown [Lotus japonicus]
Length=138

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVLIRLEEL +K+ GGILLPKSAVKFERYL+GE+L+VG    EV+ G 
Sbjct  46   KWEPAKVVPQADRVLIRLEELAQKTTGGILLPKSAVKFERYLVGEVLTVGAEAGEVKAGA  105

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLF+DVNAYEV+LGT+ +H FCK  DLLAVVE
Sbjct  106  KVLFTDVNAYEVDLGTDAKHCFCKASDLLAVVE  138



>ref|NP_191580.1| GroES-like family protein [Arabidopsis thaliana]
 emb|CAB75936.1| putative protein [Arabidopsis thaliana]
 gb|AAM65007.1| unknown [Arabidopsis thaliana]
 gb|AAO64777.1| At3g60210 [Arabidopsis thaliana]
 dbj|BAF00250.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80024.1| GroES-like family protein [Arabidopsis thaliana]
Length=138

 Score =   149 bits (375),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVL+RLE LPEKS+GG+LLPKSAVKFERYL GE++SVG+ V EVE GK
Sbjct  45   KWEPAKVVPQADRVLVRLEVLPEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVEPGK  104

Query  210  KVLFSDVNAYEVNLGTEE-RHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+ GTE+ +H FCKE DLLA+V+
Sbjct  105  KVLFSDMSAYEVDFGTEDAKHCFCKESDLLAIVQ  138



>ref|XP_004145027.1| PREDICTED: 10 kDa chaperonin-like [Cucumis sativus]
 ref|XP_004153035.1| PREDICTED: 10 kDa chaperonin-like [Cucumis sativus]
 gb|KGN46296.1| hypothetical protein Csa_6G080390 [Cucumis sativus]
Length=133

 Score =   148 bits (374),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K EP KVVPQ DRVLIRLEELPEKSAGG+LLPKSAVKFERYL+GEILS G    ++  GK
Sbjct  41   KLEPAKVVPQGDRVLIRLEELPEKSAGGVLLPKSAVKFERYLLGEILSTGADAGDLGQGK  100

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+LGT+ +HVFCK  DLLAVVE
Sbjct  101  KVLFSDISAYEVDLGTDAKHVFCKASDLLAVVE  133



>ref|XP_010559078.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Tarenaya hassleriana]
Length=139

 Score =   148 bits (374),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KW+P KVVPQADRVL+RLEELPEKS+GG+LLPK+AVKFERYL GE++SVG+ V  V  GK
Sbjct  47   KWDPAKVVPQADRVLVRLEELPEKSSGGVLLPKAAVKFERYLTGEVVSVGSEVGGVAPGK  106

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+LG + RH FCKE DLLA VE
Sbjct  107  KVLFSDISAYEVDLGVDARHCFCKESDLLAAVE  139



>ref|XP_006293394.1| hypothetical protein CARUB_v10024286mg [Capsella rubella]
 gb|EOA26292.1| hypothetical protein CARUB_v10024286mg [Capsella rubella]
Length=138

 Score =   148 bits (374),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 85/94 (90%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KW+PTKVVPQADRVL+RLE+LP KS+GG+LLPK+AVKFERYL GE++SVG+ V  +V TG
Sbjct  45   KWDPTKVVPQADRVLVRLEDLPIKSSGGVLLPKAAVKFERYLTGEVISVGSEVGQQVGTG  104

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV+AYEV+LGT+ RH FCKE DLLA+VE
Sbjct  105  KKVLFSDVSAYEVDLGTDARHCFCKESDLLALVE  138



>ref|NP_001236450.1| uncharacterized protein LOC100306026 [Glycine max]
 gb|ACU14003.1| unknown [Glycine max]
Length=134

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEEL +K+ GG+LLPKSAVKFERYL+GEIL+VG    E++ G 
Sbjct  42   KWEPTKVVPQADRVLIRLEELSDKTVGGVLLPKSAVKFERYLVGEILTVGAEAGELKAGT  101

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLF+D+NAYEV+LGT+ +H FCK  DLLAVVE
Sbjct  102  KVLFTDMNAYEVDLGTDAKHCFCKASDLLAVVE  134



>gb|EYU40324.1| hypothetical protein MIMGU_mgv1a016131mg [Erythranthe guttata]
Length=133

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K+EPTKVVPQADRVLIRLE L EKSAGG+LLPKSAVKFERYL+GE+L+VG  V EV+ GK
Sbjct  40   KYEPTKVVPQADRVLIRLEALAEKSAGGVLLPKSAVKFERYLVGEVLTVGAEVEEVKAGK  99

Query  210  KVLFSDVNAYEVNLGTEE-RHVFCKEGDLLAVVE  308
            KV+FSDV+AYEV LGT++ R+ FCK GDLLAVVE
Sbjct  100  KVMFSDVSAYEVELGTDDARYCFCKAGDLLAVVE  133



>gb|KHN10899.1| 20 kDa chaperonin, chloroplastic [Glycine soja]
Length=134

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEEL +K+ GG+LLPKSAVKFERYL+GEIL+VG    E++ G 
Sbjct  42   KWEPTKVVPQADRVLIRLEELSDKTVGGVLLPKSAVKFERYLVGEILTVGAEAGELKAGT  101

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLF+D+NAYEV+LGT+ +H FCK  DLLAVVE
Sbjct  102  KVLFTDMNAYEVDLGTDAKHCFCKASDLLAVVE  134



>gb|ADN34095.1| chloroplast chaperonin [Cucumis melo subsp. melo]
Length=152

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K EP KVVPQ DRVLIRLEELPEKSAGG+LLPKSAVKFERYL+GEILS G    ++  GK
Sbjct  41   KLEPAKVVPQGDRVLIRLEELPEKSAGGVLLPKSAVKFERYLLGEILSTGADAGDLGQGK  100

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD++AYEV+LGT+ +HVFCK  DLLAVV+
Sbjct  101  KVLFSDISAYEVDLGTDAKHVFCKASDLLAVVD  133



>ref|NP_001236206.1| uncharacterized protein LOC100500567 [Glycine max]
 gb|ACU15682.1| unknown [Glycine max]
 gb|KHN12255.1| 10 kDa chaperonin [Glycine soja]
Length=134

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVL+RLEEL +K+ GG+LLPKSAVKFERYL+GEIL+VG    E++ G 
Sbjct  42   KWEPTKVVPQADRVLVRLEELSDKTVGGVLLPKSAVKFERYLVGEILTVGAEAGELKAGT  101

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLF+D+NAYEV+LGT+ +H FCK  DLLAVVE
Sbjct  102  KVLFTDMNAYEVDLGTDAKHCFCKASDLLAVVE  134



>gb|KFK37269.1| hypothetical protein AALP_AA4G235400 [Arabis alpina]
Length=138

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLEELP+ + GG+LLPK+AVKFERYL GEI++VGT V  +V  G
Sbjct  45   KWEPTKVVPQADRVLVRLEELPQTTTGGVLLPKAAVKFERYLTGEIVAVGTEVGQQVGPG  104

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSD++AYEV+LGT  RHVFCKE DLLA+VE
Sbjct  105  KKVLFSDMSAYEVDLGTSARHVFCKESDLLALVE  138



>ref|XP_007134367.1| hypothetical protein PHAVU_010G041700g [Phaseolus vulgaris]
 gb|ESW06361.1| hypothetical protein PHAVU_010G041700g [Phaseolus vulgaris]
Length=134

 Score =   147 bits (371),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRLEEL +K+AGG+LLP+SAVKFERYL+GEIL+VG    E++ G 
Sbjct  42   KWEPTKVVPQADRVLIRLEELSDKTAGGVLLPRSAVKFERYLVGEILNVGAEAGELKAGT  101

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLF+D++AYEV+LGT+ +H FCK  DLLAVVE
Sbjct  102  KVLFTDMSAYEVDLGTDAKHCFCKASDLLAVVE  134



>ref|XP_011093981.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Sesamum indicum]
Length=90

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFS  224
            +VVPQADRVLIRLEELPEKSAGG+LLPKSAVKFERYL+GE++S+G  V E+E GKKVLFS
Sbjct  3    RVVPQADRVLIRLEELPEKSAGGVLLPKSAVKFERYLVGEVVSLGAEVGELERGKKVLFS  62

Query  225  DVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            D+NAYEV+LGT+ RH FCK  DLLAVVE
Sbjct  63   DINAYEVDLGTDARHCFCKASDLLAVVE  90



>gb|AAK62415.1|AF386970_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL66945.1| unknown protein [Arabidopsis thaliana]
Length=139

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLE+LP KS+GG+LLPK+AVKFERYL GEI+SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEDLPIKSSGGVLLPKAAVKFERYLTGEIISVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            K+VLFSDV+AYEV+LGT+ RH FCKE DLLA+VE
Sbjct  106  KRVLFSDVSAYEVDLGTDARHCFCKESDLLALVE  139



>ref|NP_566022.1| chloroplast chaperonin 10 [Arabidopsis thaliana]
 gb|AAC27467.1| expressed protein [Arabidopsis thaliana]
 dbj|BAB55457.1| chloroplast chaperonin 10 [Arabidopsis thaliana]
 gb|AEC10451.1| chloroplast chaperonin 10 [Arabidopsis thaliana]
Length=139

 Score =   147 bits (370),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLE+LP KS+GG+LLPK+AVKFERYL GEI+SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEDLPIKSSGGVLLPKAAVKFERYLTGEIISVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            K+VLFSDV+AYEV+LGT+ RH FCKE DLLA+VE
Sbjct  106  KRVLFSDVSAYEVDLGTDARHCFCKESDLLALVE  139



>ref|XP_003626805.1| 10 kDa chaperonin [Medicago truncatula]
 gb|AET01281.1| GroES chaperonin [Medicago truncatula]
 gb|AFK47502.1| unknown [Medicago truncatula]
 gb|AFK48935.1| unknown [Medicago truncatula]
Length=135

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP+KVVPQADRVLIRLEEL EK+AGGILLPKSAVKFERYL+GE+L+VG     V+ G 
Sbjct  43   KWEPSKVVPQADRVLIRLEELSEKTAGGILLPKSAVKFERYLVGEVLNVGAEAENVKAGS  102

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLF+D+NAYEV+LGT+ +H F K  DLLAVVE
Sbjct  103  KVLFTDINAYEVDLGTDAKHCFIKSSDLLAVVE  135



>ref|XP_002881972.1| CHL-CPN10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58231.1| CHL-CPN10 [Arabidopsis lyrata subsp. lyrata]
Length=138

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQ DRVL+RLE+LP KS+GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  45   KWEPTKVVPQGDRVLVRLEDLPMKSSGGVLLPKAAVKFERYLTGEVISVGSEVGQQVGPG  104

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV+AYEV+LGT+ RH FCKE DLLA+VE
Sbjct  105  KKVLFSDVSAYEVDLGTDARHCFCKESDLLALVE  138



>ref|XP_006292025.1| hypothetical protein CARUB_v10018214mg [Capsella rubella]
 gb|EOA24923.1| hypothetical protein CARUB_v10018214mg [Capsella rubella]
Length=137

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVL+RLE LPE S+GG+LLPKSAVKFERYL GE++SVG+ V EV  GK
Sbjct  45   KWEPAKVVPQADRVLVRLEVLPETSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVGPGK  104

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KV+FSD++AYEV+ GT+ +H FCKE DLLAVV+
Sbjct  105  KVVFSDMSAYEVDFGTDAKHCFCKESDLLAVVQ  137



>ref|XP_004510137.1| PREDICTED: 10 kDa chaperonin-like [Cicer arietinum]
Length=136

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +3

Query  33   WEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE-VETGK  209
            WEPTKVVPQADRVLIRL+EL +K+AGGILLPKSAVKFERYL+GE+L+VG    + V+ G 
Sbjct  44   WEPTKVVPQADRVLIRLDELKDKTAGGILLPKSAVKFERYLVGEVLNVGAEAGDSVKAGS  103

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLF+DVNAYEV+LGT+ +H FCK  DLLAVVE
Sbjct  104  KVLFTDVNAYEVDLGTDAKHCFCKSSDLLAVVE  136



>ref|XP_010518069.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Camelina sativa]
Length=139

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEP+KVVPQADRVL+RLE+LP KS+GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  46   KWEPSKVVPQADRVLVRLEDLPMKSSGGVLLPKAAVKFERYLTGEVISVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  106  KKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  139



>ref|XP_010506394.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Camelina sativa]
Length=138

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KW+P+KVVPQADRVL+RLE+LP KS+GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  45   KWDPSKVVPQADRVLVRLEDLPMKSSGGVLLPKAAVKFERYLTGEVISVGSEVGQQVGPG  104

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  105  KKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  138



>emb|CDY48244.1| BnaC04g05030D [Brassica napus]
Length=107

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 85/105 (81%), Gaps = 8/105 (8%)
 Frame = +3

Query  18   CPFP-------KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSV  176
            C FP       KWEPTKVVPQADRVL+RLEEL + ++GG+LLPK+AVKFERYL GE++SV
Sbjct  3    CFFPHVSSISTKWEPTKVVPQADRVLVRLEELAQTTSGGVLLPKAAVKFERYLTGEVVSV  62

Query  177  GTGV-SEVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            G+ V  +V  GKKVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  63   GSEVGQQVGPGKKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  107



>ref|XP_010508270.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Camelina sativa]
Length=138

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE-VETG  206
            KWEP+KVVPQA RVL+RLE+LP KS+GG+LLPK+AVKFERYL GE++SVG+ V E V  G
Sbjct  45   KWEPSKVVPQAGRVLVRLEDLPMKSSGGVLLPKAAVKFERYLTGEVISVGSEVGEQVGPG  104

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  105  KKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  138



>ref|NP_001288850.1| 20 kDa chaperonin, chloroplastic-like [Brassica rapa]
 gb|ABL97949.1| CHL-CPN10 [Brassica rapa]
 emb|CDY30480.1| BnaA04g25810D [Brassica napus]
Length=139

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLEEL + ++GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEELAQTTSGGVLLPKAAVKFERYLTGEVVSVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  106  KKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  139



>ref|XP_006397646.1| hypothetical protein EUTSA_v10001677mg [Eutrema salsugineum]
 gb|ESQ39099.1| hypothetical protein EUTSA_v10001677mg [Eutrema salsugineum]
Length=139

 Score =   142 bits (357),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLEEL + ++GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEELAQTTSGGVLLPKAAVKFERYLTGEVVSVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  106  KKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  139



>emb|CDY23449.1| BnaC04g49770D [Brassica napus]
Length=139

 Score =   141 bits (356),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLEEL + ++GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEELAQTTSGGVLLPKAAVKFERYLTGEVVSVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KKVLFSDV AYEV+LGT  RH FCKE DLLA+VE
Sbjct  106  KKVLFSDVRAYEVDLGTGARHCFCKESDLLALVE  139



>ref|XP_010413592.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Camelina sativa]
Length=138

 Score =   141 bits (355),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVL+RLE   EKS+GG+LLPKSAVKFERYL GE++SVG+ V EV  GK
Sbjct  46   KWEPAKVVPQADRVLVRLEVPSEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVGPGK  105

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KV+FSD++AYEV+ GT+ +H FCKE DLLA+V+
Sbjct  106  KVVFSDMSAYEVDFGTDAKHCFCKESDLLAIVQ  138



>gb|ABK78693.1| chloroplast chaperonin 10 [Brassica rapa]
Length=139

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLEEL + ++GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEELAQTTSGGVLLPKAAVKFERYLTGEVVSVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             KVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  106  NKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  139



>ref|XP_009143052.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Brassica rapa]
Length=139

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLEEL + ++GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEELAQTTSGGVLLPKAAVKFERYLTGEVVSVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             KVLFSDV+AYEV+LGT  RH FCKE DLLA+VE
Sbjct  106  NKVLFSDVSAYEVDLGTGARHCFCKESDLLALVE  139



>ref|XP_010512328.1| PREDICTED: 20 kDa chaperonin, chloroplastic-like [Camelina sativa]
Length=139

 Score =   138 bits (348),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP+KVVPQADRVL+RLE   EKS+GG+LLPKSAVKFERYL GE++SVG+ V EV  GK
Sbjct  47   KWEPSKVVPQADRVLVRLEVPSEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVGPGK  106

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KV+FS ++AYEV+ GT+ +H FCKE DLLA+V+
Sbjct  107  KVVFSYMSAYEVDFGTDAKHCFCKESDLLAIVQ  139



>ref|XP_002991064.1| hypothetical protein SELMODRAFT_132827 [Selaginella moellendorffii]
 ref|XP_002991676.1| hypothetical protein SELMODRAFT_134021 [Selaginella moellendorffii]
 gb|EFJ07247.1| hypothetical protein SELMODRAFT_134021 [Selaginella moellendorffii]
 gb|EFJ07872.1| hypothetical protein SELMODRAFT_132827 [Selaginella moellendorffii]
Length=89

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFS  224
            +V PQADRVL+RLEELPEKS GG+LLPK+AVKFERYL+GE++SVG     VE G+KV+FS
Sbjct  2    QVSPQADRVLVRLEELPEKSEGGVLLPKNAVKFERYLVGEVISVGKDAGSVERGQKVMFS  61

Query  225  DVNAYEVNLGTEERHVFCKEGDLLAVV  305
            D+NAYEVN GT E+H FCK GDLLA +
Sbjct  62   DINAYEVNFGTSEKHCFCKVGDLLATI  88



>gb|KJB24924.1| hypothetical protein B456_004G168100 [Gossypium raimondii]
Length=115

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTKVVPQADRVLIRL+ELPEKSAGG+LLPKSAVKFERYLMGEI+SVG  V  VETGK
Sbjct  43   KWEPTKVVPQADRVLIRLQELPEKSAGGVLLPKSAVKFERYLMGEIVSVGAEVGNVETGK  102

Query  210  KVLFSDVNAYEVN  248
            KVLFSD+NAYEV+
Sbjct  103  KVLFSDINAYEVS  115



>ref|XP_001782860.1| predicted protein [Physcomitrella patens]
 gb|EDQ52315.1| predicted protein [Physcomitrella patens]
Length=93

 Score =   127 bits (319),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLF  221
            +++VPQADRVLIRL+ L   SAGG+LLP SAVK++R+L GEI++ G+ V+EVE G++V+F
Sbjct  5    SQIVPQADRVLIRLDALAPTSAGGVLLPSSAVKYDRFLQGEIIAAGSEVNEVEKGQRVMF  64

Query  222  SDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            +D+NAYE+NLGT +R  FC+ GDLLA+V+
Sbjct  65   ADINAYEINLGTSDRLCFCRSGDLLAIVQ  93



>ref|XP_009613431.1| PREDICTED: uncharacterized protein LOC104106566 isoform X2 [Nicotiana 
tomentosiformis]
Length=118

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 71/93 (76%), Gaps = 17/93 (18%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEPTK                 KSAGG+LLPKSAVKFERYLMGE+LSVG+ V++VE GK
Sbjct  43   KWEPTK-----------------KSAGGVLLPKSAVKFERYLMGEVLSVGSEVAQVEAGK  85

Query  210  KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            KVLFSD+NAYEV+LGT+ RH FCKE +LLA+VE
Sbjct  86   KVLFSDINAYEVDLGTDARHCFCKESELLALVE  118



>ref|XP_008667777.1| PREDICTED: CHL-CPN10 isoform 1 isoform X2 [Zea mays]
 gb|ACG26307.1| CHL-CPN10 [Zea mays]
 tpg|DAA46368.1| TPA: CHL-CPN10 [Zea mays]
Length=117

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  96   EKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVNLGT-EERHV  272
            +KSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GKKVLFSD+NAYEV LGT EE+H 
Sbjct  46   KKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGKKVLFSDINAYEVELGTDEEKHC  105

Query  273  FCKEGDLLAVVE  308
            FC+E DLLAVVE
Sbjct  106  FCRESDLLAVVE  117



>ref|XP_008668931.1| PREDICTED: uncharacterized protein LOC103645976 isoform X2 [Zea 
mays]
Length=117

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  96   EKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVNLGT-EERHV  272
            +KSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GKKVLFSD+NAYEV LGT +E+H 
Sbjct  46   KKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGKKVLFSDINAYEVELGTDDEKHC  105

Query  273  FCKEGDLLAVVE  308
            FC+E DLLAVVE
Sbjct  106  FCRESDLLAVVE  117



>ref|XP_001779401.1| predicted protein [Physcomitrella patens]
 gb|EDQ55791.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFS  224
            K+VPQADRVLIRL+ L   SAGG+LLP ++VK++R+L GE+++ G+  ++V  G+KV+F+
Sbjct  78   KIVPQADRVLIRLDALASTSAGGVLLPSASVKYDRFLQGEVIAAGSEATDVVKGQKVMFA  137

Query  225  DVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            D+NAYEVN GT ++   C+ GDLLAV++
Sbjct  138  DINAYEVNFGTSDKLCLCRSGDLLAVLQ  165



>tpg|DAA36148.1| TPA: hypothetical protein ZEAMMB73_907288 [Zea mays]
Length=272

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  96   EKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVNLGT-EERHV  272
            +KSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GKKVLFSD+NAYEV LGT +E+H 
Sbjct  201  KKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGKKVLFSDINAYEVELGTDDEKHC  260

Query  273  FCKEGDLLAVVE  308
            FC+E DLLAVVE
Sbjct  261  FCRESDLLAVVE  272



>gb|KCW76831.1| hypothetical protein EUGRSUZ_D01184 [Eucalyptus grandis]
Length=131

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVL+RLE+LPEKSAGG+LLPKSAVKFERYLMGE+LSVGT    V+ GK
Sbjct  43   KWEPAKVVPQADRVLVRLEQLPEKSAGGVLLPKSAVKFERYLMGEVLSVGTEAGVVDAGK  102

Query  210  KV-LFSDVNAYEVNLG  254
            KV  F DV+A+   +G
Sbjct  103  KVGNFVDVHAFVCGVG  118



>ref|XP_006397645.1| hypothetical protein EUTSA_v10001677mg [Eutrema salsugineum]
 gb|ESQ39098.1| hypothetical protein EUTSA_v10001677mg [Eutrema salsugineum]
Length=128

 Score =   112 bits (279),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETG  206
            KWEPTKVVPQADRVL+RLEEL + ++GG+LLPK+AVKFERYL GE++SVG+ V  +V  G
Sbjct  46   KWEPTKVVPQADRVLVRLEELAQTTSGGVLLPKAAVKFERYLTGEVVSVGSEVGQQVGPG  105

Query  207  KKVLFSDVNAYEVNL  251
            KKVLFSDV+AYEV+L
Sbjct  106  KKVLFSDVSAYEVSL  120



>ref|XP_008232313.1| PREDICTED: uncharacterized protein LOC103331473 [Prunus mume]
Length=84

 Score =   108 bits (270),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 5/78 (6%)
 Frame = +3

Query  90   LPEKSAGGILLPKSAVKFERYLMGE-----ILSVGTGVSEVETGKKVLFSDVNAYEVNLG  254
            +P+KSAGG+LLPKSAVK E+YLMGE     ILSVG  V EV+ GKKVLFSD+ AYEV+LG
Sbjct  7    MPQKSAGGVLLPKSAVKLEQYLMGEHCYSHILSVGDEVGEVKAGKKVLFSDIKAYEVDLG  66

Query  255  TEERHVFCKEGDLLAVVE  308
            T+ RH FCKE +LLAVVE
Sbjct  67   TDGRHCFCKESELLAVVE  84



>gb|ACG31800.1| CHL-CPN10 [Zea mays]
Length=132

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  126  KSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            KSAVKFERYLMGEILSVG  VSEVE GKKVLFSD+NAYEV+L T+E+H FC+E DLLAVV
Sbjct  72   KSAVKFERYLMGEILSVGADVSEVEAGKKVLFSDINAYEVDLDTDEKHCFCRESDLLAVV  131

Query  306  E  308
            E
Sbjct  132  E  132



>gb|ACR34714.1| unknown [Zea mays]
 tpg|DAA46367.1| TPA: hypothetical protein ZEAMMB73_301142 [Zea mays]
Length=106

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  41   KYDPAKVAPQNDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  100

Query  210  KV  215
            KV
Sbjct  101  KV  102



>tpg|DAA46364.1| TPA: hypothetical protein ZEAMMB73_301142 [Zea mays]
Length=114

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  41   KYDPAKVAPQNDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  100

Query  210  K  212
            K
Sbjct  101  K  101



>tpg|DAA36146.1| TPA: hypothetical protein ZEAMMB73_907288 [Zea mays]
Length=114

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  41   KYDPAKVAPQNDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  100

Query  210  K  212
            K
Sbjct  101  K  101



>tpg|DAA36149.1| TPA: hypothetical protein ZEAMMB73_907288 [Zea mays]
 tpg|DAA36150.1| TPA: hypothetical protein ZEAMMB73_907288 [Zea mays]
Length=261

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            K++P KV PQ DRVL+RLE++PEKSAGG+LLPKSAVKFERYLMGEILS+G  VSEVE GK
Sbjct  196  KYDPAKVAPQNDRVLVRLEQIPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGK  255

Query  210  KV  215
            KV
Sbjct  256  KV  257



>ref|XP_010469216.1| PREDICTED: uncharacterized protein LOC104749316 [Camelina sativa]
Length=112

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK  209
            KWEP KVVPQADRVL+RLE   EKS+GG+LLPKSAVKFERYL GE++SVG+ V EV  GK
Sbjct  45   KWEPAKVVPQADRVLVRLELPSEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVGPGK  104

Query  210  KVLF  221
            KV+F
Sbjct  105  KVVF  108



>gb|KJB24927.1| hypothetical protein B456_004G168100 [Gossypium raimondii]
Length=88

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEI  167
            KWEPTKVVPQADRVLIRL+ELPEKSAGG+LLPKSAVKFERYLMGE+
Sbjct  43   KWEPTKVVPQADRVLIRLQELPEKSAGGVLLPKSAVKFERYLMGEV  88



>gb|KJB44684.1| hypothetical protein B456_007G266500 [Gossypium raimondii]
Length=70

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  117  LLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLL  296
            LLPKSAVKFERY + EI+S G  V +V+  KKV+FSD+NAYEV+LG + RHVFCKE DLL
Sbjct  7    LLPKSAVKFERYQIREIVSTGVEVRKVKPRKKVIFSDINAYEVDLGIDTRHVFCKESDLL  66

Query  297  AVVE  308
            A V+
Sbjct  67   AEVD  70



>ref|XP_004160703.1| PREDICTED: uncharacterized protein LOC101230269 [Cucumis sativus]
Length=119

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEI  167
            K EP KVVPQ DRVLIRLEELPEKSAGG+LLPKSAVKFERYL+GE 
Sbjct  41   KLEPAKVVPQGDRVLIRLEELPEKSAGGVLLPKSAVKFERYLLGEC  86



>ref|XP_007140914.1| hypothetical protein PHAVU_008G151700g [Phaseolus vulgaris]
 gb|ESW12908.1| hypothetical protein PHAVU_008G151700g [Phaseolus vulgaris]
Length=74

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 7/67 (10%)
 Frame = +3

Query  81   LEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVNLGTE  260
            +EEL +K+AGG+LLP+SAVKFERYL+GE         E++ G KVLF+D++AYEV+LGT+
Sbjct  1    MEELSDKTAGGVLLPRSAVKFERYLVGE-------AGELKAGTKVLFTDMSAYEVDLGTD  53

Query  261  ERHVFCK  281
             +H FC+
Sbjct  54   TQHYFCR  60



>gb|KJB24926.1| hypothetical protein B456_004G168100 [Gossypium raimondii]
Length=82

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFER  149
            KWEPTKVVPQADRVLIRL+ELPEKSAGG+LLPKSAVKFER
Sbjct  43   KWEPTKVVPQADRVLIRLQELPEKSAGGVLLPKSAVKFER  82



>ref|NP_001167648.1| hypothetical protein [Zea mays]
 gb|ACF80219.1| unknown [Zea mays]
 gb|AFW87809.2| hypothetical protein ZEAMMB73_436274 [Zea mays]
Length=92

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 2/50 (4%)
 Frame = +3

Query  30   KWEPTK--VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILS  173
            K++P K  V PQ DRVL+RL+++PEKSAGG+LLPKSAVKFERYLMGE+ S
Sbjct  43   KYDPAKGQVAPQNDRVLVRLQQIPEKSAGGVLLPKSAVKFERYLMGEVRS  92



>gb|KHG00544.1| Nitrogenase iron-molybdenum cofactor biosynthesis nifE [Gossypium 
arboreum]
Length=84

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 10/73 (14%)
 Frame = +3

Query  90   LPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVNLGTEERH  269
            +P KS GG+LLPKS VKFERYL+ EI+SVG  V +VE  KK          V+LGT+ RH
Sbjct  22   IPSKSIGGVLLPKSIVKFERYLIMEIVSVGVEVGKVEPRKK----------VDLGTDTRH  71

Query  270  VFCKEGDLLAVVE  308
            VFCKE  LLA V+
Sbjct  72   VFCKESYLLAEVD  84



>ref|XP_007146624.1| hypothetical protein PHAVU_006G055900g [Phaseolus vulgaris]
 gb|ESW18618.1| hypothetical protein PHAVU_006G055900g [Phaseolus vulgaris]
Length=91

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +3

Query  30   KWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGE  164
            KWEPTKVVPQAD VLIR+EEL +K+AGG+LL +S VKFERYL+GE
Sbjct  42   KWEPTKVVPQAD-VLIRMEELSDKTAGGVLLSRSVVKFERYLVGE  85



>ref|XP_004173645.1| PREDICTED: 10 kDa chaperonin-like, partial [Cucumis sativus]
Length=53

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  162  EILSVGTGVSEVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            +ILS G    ++  GKKVLFSD++AYEV+LGT+ +HVFCK  DLLAVVE
Sbjct  5    QILSTGADAGDLGQGKKVLFSDISAYEVDLGTDAKHVFCKASDLLAVVE  53



>ref|WP_019490874.1| molecular chaperone GroES [Calothrix sp. PCC 7103]
Length=103

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 12/93 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DR+L+++ E  EK+AGGI LP +A   E+  +GE++ VG+G           EV+ G
Sbjct  13   PLGDRILVKISEAEEKTAGGIFLPDTA--KEKQQVGEVVEVGSGKRNDDGSYQQLEVKVG  70

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
             KVL+S     ++ LG+E+ +V  +E D+LAVV
Sbjct  71   DKVLYSKYGGTDIKLGSED-YVLLREQDILAVV  102



>ref|XP_010687539.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687540.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=254

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 70/132 (53%), Gaps = 15/132 (11%)
 Frame = +3

Query  27   PKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS-----  191
            PK+  T + P ADRVLI+++E  EK++GGILLP +A+   +Y  GE+++VG G +     
Sbjct  57   PKY--TTITPLADRVLIKIKEAEEKTSGGILLPSTALSKPQY--GEVVAVGEGRTIGKSK  112

Query  192  ---EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE--*IAHLQRQCRHAIFRV  356
                V+TG +V++S     E+       H+  KE D++ ++E   I  L+      + +V
Sbjct  113  IEIGVKTGSQVVYSKYAGTELEF-NGSNHLLMKEDDIVGILETDDIKELKPMNERVLIKV  171

Query  357  VSVSSCTCAGSL  392
                  T  G L
Sbjct  172  AEAEQTTAGGLL  183



>gb|KIE07029.1| chaperonin [Tolypothrix bouteillei VB521301]
Length=103

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+AGGILLP SA   E+  +GEI++VG G           +
Sbjct  9    STVKPLGDRVFIKVSESEEKTAGGILLPDSA--KEKPQVGEIVAVGLGKRNDDGTRQTID  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            +  G KVL++     +V LGTEE +V   E D+LAVV
Sbjct  67   IAVGDKVLYAKYAGTDVKLGTEE-YVLLSEKDILAVV  102



>ref|WP_006516274.1| Co-chaperonin GroES [Leptolyngbya sp. PCC 7375]
 gb|EKV01886.1| Co-chaperonin GroES [Leptolyngbya sp. PCC 7375]
Length=103

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRVLI++    EK+AGGILLP +A   E+  +GEI +VG G           +
Sbjct  9    SSVTPLGDRVLIKVSASEEKTAGGILLPDTA--KEKPQVGEITAVGPGKRGDDGSRQAPD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            VE G KVL+S     ++ LG E+ +V   E D+LAVV
Sbjct  67   VEVGNKVLYSKYAGTDIKLGGED-YVLLSEKDILAVV  102



>ref|WP_006910546.1| molecular chaperone GroES [Cyanobium sp. PCC 7001]
 gb|EDY38643.1| chaperonin GroS [Cyanobium sp. PCC 7001]
Length=103

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRIFIKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNEDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LGT+E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAVV  102



>ref|WP_006854300.1| molecular chaperone GroES [Synechococcus sp. WH 8016]
 gb|EHA60379.1| 10 kDa chaperonin [Synechococcus sp. WH 8016]
Length=103

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G S         E
Sbjct  9    STVKPLGDRVFVKISESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKSNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_035829454.1| chaperonin [Cyanobium sp. CACIAM 14]
 gb|KEF43116.1| chaperonin [Cyanobium sp. CACIAM 14]
Length=103

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFIKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LGT+E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAVV  102



>ref|WP_017321739.1| molecular chaperone GroES [cyanobacterium PCC 7702]
Length=103

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 60/97 (62%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P +DRVLI++ E  EK+AGGILLP +A   E+  +GEI++VG G           E
Sbjct  9    STVKPLSDRVLIKVGEAEEKTAGGILLPDTA--KEKPQVGEIVAVGPGKWNEDGSRQKME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ +GTE+ +V   E D+LA++
Sbjct  67   VKVGDKVLYSKYAGTDIKIGTED-YVLLSEKDILAIL  102



>gb|AAA27313.1| chaperonin [Synechococcus sp.]
Length=103

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++ E  EK+AGGI+LP +A   E+  +GEI++VG G S         E
Sbjct  9    STVTPLGDRVFVKVAEAEEKTAGGIILPDNA--KEKPQVGEIVAVGPGKSNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG ++ +V   E D+LAVV
Sbjct  67   VKIGDKVLYSKYAGTDIKLGNDD-YVLLSEKDILAVV  102



>ref|WP_009629538.1| 10 kDa chaperonin [Pseudanabaena biceps]
 gb|ELS30408.1| 10 kDa chaperonin [Pseudanabaena biceps PCC 7429]
Length=103

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            T V P ADRV I++    EK+AGGI LP++A   E+  +GEI +VG G           E
Sbjct  9    TTVKPLADRVFIKVSAKEEKTAGGIFLPETAK--EKPQVGEIAAVGPGKLDDKGERQALE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTDE-YVLLAEKDILAIV  102



>ref|WP_015202371.1| 10 kDa chaperonin [Crinalium epipsammum]
 gb|AFZ12249.1| 10 kDa chaperonin [Crinalium epipsammum PCC 9333]
Length=103

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P ADRV +++    EK+AGGILLP +A   E+  +GEI++ G G           E
Sbjct  9    STVKPLADRVFVKVSAAEEKTAGGILLPDNA--KEKPQVGEIVATGPGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   VNVGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>ref|WP_015184309.1| Co-chaperonin GroES [Microcoleus sp. PCC 7113]
 gb|AFZ20173.1| Co-chaperonin GroES [Microcoleus sp. PCC 7113]
Length=103

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI++VG G           E
Sbjct  9    STVKPLGDRVFVKVSAAEEKTAGGILLPDNA--KEKPQVGEIVAVGPGKRNDDGTRSEVE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>ref|WP_015110667.1| Co-chaperonin GroES [Cyanobium gracile]
 gb|AFY30234.1| Co-chaperonin GroES [Cyanobium gracile PCC 6307]
Length=103

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+AGGILLP +A   E+  +GE++ +G G           E
Sbjct  9    STVKPLGDRVFIKVSESEEKTAGGILLPDTA--KEKPQVGEVVQIGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LGT+E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAVV  102



>ref|WP_010310879.1| molecular chaperone GroES [Synechococcus sp. CB0101]
Length=103

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRIFIKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VSVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_011620192.1| molecular chaperone GroES [Synechococcus sp. CC9311]
 sp|Q0I7U2.1|CH10_SYNS3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus sp. CC9311]
 gb|ABI46142.1| chaperonin, 10 kDa [Synechococcus sp. CC9311]
Length=103

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G S         E
Sbjct  9    STVKPLGDRVFVKISESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKSNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VGIGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_012630460.1| molecular chaperone GroES [Cyanothece sp. PCC 7425]
 sp|B8HQ34.1|CH10_CYAP4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Cyanothece sp. PCC 7425]
 gb|ACL47431.1| chaperonin Cpn10 [Cyanothece sp. PCC 7425]
Length=103

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SE  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI++VG G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGILLPDTA--KEKPQVGEIVAVGPGKRNDDGSRQEPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGTEE +V   E D+LA+V
Sbjct  67   VKIGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAIV  102



>ref|WP_010315361.1| molecular chaperone GroES [Synechococcus sp. CB0205]
Length=103

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRIFIKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VSVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_009768318.1| Co-chaperonin GroES [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ67519.1| Co-chaperonin GroES [Oscillatoriales cyanobacterium JSC-12]
Length=103

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 12/93 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG  206
            P  DRV +++    EK+AGGILLP +A   E+  +GE++SVG G           EV+ G
Sbjct  13   PLGDRVFVKVSASEEKTAGGILLPDTA--KEKPQVGEVVSVGPGKRSDDGSRQEPEVKVG  70

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            +KVL+S     ++ LGT+E +V   E D+LA+V
Sbjct  71   QKVLYSKYAGTDIKLGTDE-YVLLSEKDILAIV  102



>ref|WP_036536397.1| chaperonin [Neosynechococcus sphagnicola]
 gb|KGF71570.1| chaperonin [Neosynechococcus sphagnicola sy1]
Length=103

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI +VG G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGILLPDTA--KEKPQVGEIAAVGPGKRNDDGTRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>ref|WP_023072995.1| co-chaperonin [Leptolyngbya sp. Heron Island J]
 gb|ESA36308.1| co-chaperonin [Leptolyngbya sp. Heron Island J]
Length=103

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRVLI++    EK+AGGILLP +A   E+  +GE+ +VG G           +
Sbjct  9    SSVTPLGDRVLIKVSASEEKTAGGILLPDTA--KEKPQVGEVTAVGPGKRGDDGSRQAPD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            VE G KVL+S     ++ LG ++ +V   E D+LAVV
Sbjct  67   VEVGNKVLYSKYAGTDIKLGGDD-YVLLSEKDILAVV  102



>ref|WP_011244098.1| MULTISPECIES: molecular chaperone GroES [Synechococcus]
 sp|P07889.1|CH10_SYNP6 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus elongatus PCC 6301]
 sp|P22880.2|CH10_SYNE7 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus elongatus PCC 7942]
 emb|CAA29361.1| unnamed protein product [Synechococcus elongatus PCC 6301]
 dbj|BAD79978.1| GroES protein [Synechococcus elongatus PCC 6301]
 gb|ABB58344.1| GroES protein, 10 kD chaperonin [Synechococcus elongatus PCC 
7942]
 gb|AJD57191.1| hypothetical protein M744_04720 [Synechococcus sp. UTEX 2973]
Length=103

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGI+LP +A   E+  +GEI++VG G           E
Sbjct  9    STVTPLGDRVFVKVAEAEEKTAGGIILPDNA--KEKPQVGEIVAVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG ++ +V   E D+LAVV
Sbjct  67   VKIGDKVLYSKYAGTDIKLGNDD-YVLLSEKDILAVV  102



>ref|WP_011316757.1| molecular chaperone GroES [Anabaena variabilis]
 gb|ABA25233.1| Chaperonin Cpn10 [Anabaena variabilis ATCC 29413]
Length=103

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 12/98 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DR+ I++ +  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRIFIKVAQAEEKTAGGILLPDTA--KEKPQIGEVVQVGPGKRNEDGSRQPME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            V+ G++VL+S     ++ LG+EE +V   E D+LA+VE
Sbjct  67   VKIGERVLYSRYAGTDIKLGSEE-YVLLSEKDVLAIVE  103



>ref|WP_017286920.1| molecular chaperone GroES [Leptolyngbya boryana]
Length=103

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGI+LP +A   E+  +GEI+SVG G           E
Sbjct  9    STVKPLGDRVFVKVSEAEEKTAGGIILPDNA--KEKPQVGEIVSVGNGKLNEKGERQPME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG ++ +V   E D+LAVV
Sbjct  67   VQVGNKVLYSKYAGTDIKLGGDD-YVLLSEKDILAVV  102



>ref|WP_017743712.1| molecular chaperone GroES [Scytonema hofmanni]
Length=103

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+ GGILLP SA   E+  +GEI++VG G           +
Sbjct  9    STVKPLGDRVFIKVSESEEKTTGGILLPDSA--KEKPQVGEIVAVGPGKLNDNGTHQAID  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            +  G +VL+S     ++ LGTEE +V   E D+LA+V
Sbjct  67   IAVGDRVLYSKYAGTDIKLGTEE-YVLLSEKDILAIV  102



>ref|WP_009790475.1| molecular chaperone GroES [Synechococcus sp. BL107]
 gb|EAU72445.1| co-chaperonin GroES [Synechococcus sp. BL107]
Length=103

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G S         E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKSNEDGSRQSPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LA+V
Sbjct  67   VGIGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAIV  102



>ref|WP_008312546.1| Co-chaperonin GroES [Leptolyngbya sp. PCC 6406]
Length=103

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = +3

Query  48   VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE  200
            V P  DRVLI++    E +AGGILLP +A   E+  +GEI +VG G           E++
Sbjct  11   VTPLGDRVLIKVSASEETTAGGILLPDTA--REKPQVGEITAVGPGKRNDDGTRQAPEIK  68

Query  201  TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
             G KVL+S     E+ LGT+E +V   E D+LA +
Sbjct  69   VGDKVLYSKYAGTEIKLGTDE-YVLLSEKDILAAL  102



>ref|WP_011820918.1| MULTISPECIES: molecular chaperone GroES [Prochlorococcus]
 sp|A2BYG2.1|CH10_PROM5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. MIT 
9515]
 gb|ABM72823.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. 
MIT 9515]
Length=103

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++ E  EK+AGGILLP SA   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSESEEKTAGGILLPDSA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_006043324.1| molecular chaperone GroES [Synechococcus sp. WH 7805]
 gb|EAR19769.1| co-chaperonin GroES [Synechococcus sp. WH 7805]
Length=103

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKPNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_011125740.1| MULTISPECIES: molecular chaperone GroES [Prochlorococcus]
 ref|NP_875981.1| Co-chaperonin GroES [Prochlorococcus marinus subsp. marinus str. 
CCMP1375]
 sp|Q7TV92.1|CH10_PROMA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAQ00634.1| Co-chaperonin GroES [Prochlorococcus marinus subsp. marinus str. 
CCMP1375]
Length=103

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRVFIKVSESEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_011133066.1| molecular chaperone GroES [Prochlorococcus marinus]
 sp|Q7TU43.1|CH10_PROMP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 emb|CAE19896.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 gb|KGF86688.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. EQPAC1]
Length=103

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++ E  EK+AGGILLP SA   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSESEEKTAGGILLPDSA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_017319771.1| molecular chaperone GroES [cyanobacterium PCC 7702]
Length=103

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE+++VG G           E
Sbjct  9    STVKPLGDRVFVKVHEAEEKTAGGILLPDTA--KEKPQVGEVIAVGPGKYNDDGSRQKME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGTE+ +V   E D+LA +
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTED-YVLLSEKDILATL  102



>ref|WP_011933892.1| molecular chaperone GroES [Synechococcus sp. WH 7803]
 sp|A5GNB0.1|CH10_SYNPW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus sp. WH 7803]
 emb|CAK24425.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Synechococcus 
sp. WH 7803]
Length=103

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKANEDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_043737222.1| chaperonin [Synechococcus sp. RCC307]
Length=103

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP +A   E+  +GE++ +G G           E
Sbjct  9    STVKPLGDRIFIKVSASDEKTAGGILLPDTA--QEKPQVGEVVQIGAGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VSVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_011433225.1| molecular chaperone GroES [Synechococcus sp. JA-2-3B'a(2-13)]
 sp|Q2JL42.1|CH10_SYNJB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD02580.1| chaperonin, 10 kDa [Synechococcus sp. JA-2-3B'a(2-13)]
Length=103

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 12/94 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DRVL+++ +  EK+AGGI LP +A   E+  +GE+++VG G           E++ G
Sbjct  13   PLGDRVLVKIAQQDEKTAGGIFLPDTA--KEKPQVGEVVAVGPGKRNDEGKLIPMELKAG  70

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             KVL+S     EV LG++E +V   E D+LA+V+
Sbjct  71   DKVLYSKYAGTEVKLGSDE-YVLLAERDILAIVQ  103



>ref|WP_011295315.1| molecular chaperone GroES [Prochlorococcus marinus]
 sp|Q46J69.1|CH10_PROMT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. NATL2A]
 sp|A2C4I3.1|CH10_PROM1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. NATL1A]
 gb|AAZ58459.1| Co-chaperonin GroES [Prochlorococcus marinus str. NATL2A]
 gb|ABM76393.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. 
NATL1A]
Length=103

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKRNEDGSRQSPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VSVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_011359322.1| molecular chaperone GroES [Synechococcus sp. CC9902]
 sp|Q3AZK4.1|CH10_SYNS9 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus sp. CC9902]
 gb|ABB25473.1| Co-chaperonin GroES [Synechococcus sp. CC9902]
Length=103

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKPNEDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LA+V
Sbjct  67   VGIGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAIV  102



>ref|WP_028952752.1| chaperonin [Synechococcus sp. CC9616]
Length=103

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ +G G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQIGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGSDE-YVLLTEKDILAVV  102



>ref|WP_012196108.1| molecular chaperone GroES [Prochlorococcus marinus]
 sp|A9BCC5.1|CH10_PROM4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. MIT 
9211]
 gb|ABX09487.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. 
MIT 9211]
Length=103

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKRNEDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_012596120.1| MULTISPECIES: molecular chaperone GroES [Cyanothece]
 sp|Q8L373.2|CH10_CYAP8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Cyanothece sp. PCC 8801]
 gb|ACK66854.1| chaperonin Cpn10 [Cyanothece sp. PCC 8801]
 gb|ACV02079.1| chaperonin Cpn10 [Cyanothece sp. PCC 8802]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 12/98 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SE  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI++VG G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGILLPDTA--KEKPQIGEIVTVGPGKRNDDGSRSEPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            V+ G KVL+S     ++ LG E+ +V   E D+LAVV+
Sbjct  67   VKVGDKVLYSKYAGTDIKLGGED-YVLLSEKDILAVVD  103



>ref|WP_008310159.1| Co-chaperonin GroES [Leptolyngbya sp. PCC 6406]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+L+++ +  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRILVQVSDAEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSVQTIE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT++ +V  +E D+LA +
Sbjct  67   VKIGDKVLYSKYAGTDIKLGTDD-YVLLRESDVLATL  102



>gb|AHF64577.1| GroES [Synechococcus sp. WH 8109]
Length=129

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  35   STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAPE  92

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  93   VGVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  128



>ref|WP_036905521.1| MULTISPECIES: chaperonin [Prochlorococcus]
 gb|AIQ97981.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0801]
 gb|KGG20953.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. PAC1]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKRNEDGSRQSPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            +  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   ISVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_035987600.1| chaperonin [Leptolyngbya sp. KIOST-1]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+L+++    EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRILVKVSAAEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRSDDGAFQTVE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT++ +V  +E D+LA +
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTDD-YVLLRESDILAAL  102



>ref|WP_009348469.1| molecular chaperone GroES [Alloprevotella rava]
 gb|EHG20979.1| chaperonin [Alloprevotella rava F0323]
Length=91

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = +3

Query  48   VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVE----TGKKV  215
            + P ADRVL++ +E  EK+AGGI++P +A K ER + G++L+VG G  + E     G KV
Sbjct  3    IQPLADRVLVQPQEAEEKTAGGIIIPDTA-KKERPIEGKVLAVGQGTKDEEMVLKVGDKV  61

Query  216  LFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            L+   +  EV L   E  +  ++ D+LAVV+
Sbjct  62   LYGKYSGTEVELDG-ENFLIMRQSDVLAVVK  91



>ref|WP_017298743.1| molecular chaperone GroES [Nodosilinea nodulosa]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+L+++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRILVKVSEAEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSFQAME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG+++ +V  +E D+LA +
Sbjct  67   VKVGDKVLYSKYAGTDIKLGSDD-YVLLRETDVLAAL  102



>ref|WP_011130818.1| MULTISPECIES: molecular chaperone GroES [Prochlorococcus]
 sp|Q7TUS3.1|CH10_PROMM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. MIT 
9313]
 emb|CAE21625.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. 
MIT 9313]
 gb|KGG27793.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0701]
 gb|KGG29551.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0702]
 gb|KGG36046.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0703]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ L T+E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLSTDE-YVLLSEKDILAVV  102



>emb|CAK28763.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Synechococcus 
sp. RCC307]
Length=122

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP +A   E+  +GE++ +G G           E
Sbjct  28   STVKPLGDRIFIKVSASDEKTAGGILLPDTA--QEKPQVGEVVQIGAGKRNDDGSRQAPE  85

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct  86   VSVGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  121



>ref|WP_022694835.1| molecular chaperone GroES [Ponticaulis koreensis]
Length=96

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EV  197
            K  P  DRVL+R  +  EK+ GGI++P +A   E+   GE+++VGTGV          +V
Sbjct  2    KFRPLHDRVLVRRVQEEEKTKGGIIIPDTA--KEKPQEGEVVAVGTGVRGDDGSLVALDV  59

Query  198  ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            + G +VLF   +  EVN+G EE  +  KE D+L VVE
Sbjct  60   KAGDRVLFGKWSGTEVNVGGEE-LLIMKESDILGVVE  95



>ref|WP_025923511.1| chaperonin [Prochlorococcus sp. scB243_495D8]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP SA   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDSA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGADE-YVLLSEKDILAVV  102



>ref|WP_007101657.1| molecular chaperone GroES [Synechococcus sp. RS9917]
 gb|EAQ69453.1| Co-chaperonin GroES [Synechococcus sp. RS9917]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_010476538.1| molecular chaperone GroES [Acaryochloris sp. CCMEE 5410]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGIL+P +A   E+  +GE++SVG G+          +
Sbjct  9    STVSPLGDRVFLKVNRAEEKTAGGILMPDTA--QEKSQVGEVVSVGPGLRSGNGSYAPID  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G +VL++  +  ++ LG E+ +V  K  D+LA+V
Sbjct  67   VQVGDQVLYAKYSGTDIKLGNED-YVLTKAQDILAIV  102



>ref|WP_015186660.1| 10 kDa chaperonin [Gloeocapsa sp. PCC 7428]
 gb|AFZ28783.1| 10 kDa chaperonin [Gloeocapsa sp. PCC 7428]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P ADRV +++    EK+AGG+ LP +A   E+  +GE++++G G           E
Sbjct  9    STVKPLADRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEVVAIGPGRRSDDGSRQEME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++ G KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   IKVGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>gb|AAM20895.1|AF373777_1 putative chaperonin protein [Cyanothece sp. PCC 8801]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 12/98 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SE  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI++VG G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGILLPDTA--KEKPQIGEIVTVGPGKRNDDGSRSEPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            V+ G KVL+S     ++ LG E+ +V   E D+LA+V+
Sbjct  67   VKVGDKVLYSKYAGTDIKLGGED-YVLLSEKDILAIVD  103



>ref|WP_002744529.1| 10 kDa chaperonin [Microcystis aeruginosa]
 emb|CAO88452.1| groS [Microcystis aeruginosa PCC 7806]
 gb|ELS47551.1| 10 kDa chaperonin [Microcystis aeruginosa DIANCHI905]
 dbj|GAL92330.1| heat shock protein 60 family co-chaperone GroES [Microcystis 
aeruginosa NIES-44]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            T V P  DRV +++    E++AGGI LP +A   E+  +GE+++VGTG           E
Sbjct  9    TTVKPLGDRVFVKVSPSEERTAGGIFLPDAA--QEKPQIGEVVTVGTGKRNDDGSRTPVE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG EE +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGGEE-YVLLSEKDILAVV  102



>ref|WP_011430254.1| molecular chaperone GroES [Synechococcus sp. JA-3-3Ab]
 sp|Q2JUN8.1|CH10_SYNJA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus sp. JA-3-3Ab]
 gb|ABC99576.1| chaperonin, 10 kDa [Synechococcus sp. JA-3-3Ab]
Length=103

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (61%), Gaps = 12/94 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DRVL+++ +  EK+AGGI LP +A   E+  +GE+++VG G           E++ G
Sbjct  13   PLGDRVLVKIAQQDEKTAGGIFLPDTA--KEKPQVGEVVAVGPGKRNDEGKLIPMELKAG  70

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             +VL+S     EV LG++E +V   E D+LA+V+
Sbjct  71   DRVLYSKYAGTEVKLGSDE-YVLLAERDILAIVQ  103



>ref|WP_008180318.1| molecular chaperone GroES [Moorea producens]
 gb|EGJ34449.1| Co-chaperonin GroES/HSP10 [Moorea producens 3L]
Length=103

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI++ G G           E
Sbjct  9    STVKPLGDRVFVKVSAAEEKTAGGILLPDNA--KEKPQVGEIVATGPGKRNDDGSHAALE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG EE +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDIKLGNEE-YVLLSEKDILAVV  102



>ref|WP_015223060.1| chaperonin Cpn10 [Cyanobacterium stanieri]
 gb|AFZ47744.1| Chaperonin Cpn10 [Cyanobacterium stanieri PCC 7202]
Length=103

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGI LP +A   E+  +GE+++VG G           E
Sbjct  9    STVKPLGDRVFVKVSEAEEKTAGGIYLPDNA--KEKPQIGEVVTVGDGKVNDQGVRTAVE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG ++ +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDIKLGNDD-YVLLSEKDILAVV  102



>ref|WP_039681375.1| molecular chaperone GroES [Terrisporobacter sp. 08-306576]
 gb|KHS55571.1| molecular chaperone GroES [Terrisporobacter sp. 08-306576]
Length=94

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVE  200
            K+ P ADRV+I+  E  EK+A GI+LP SA   E+  M +++ VG G          EVE
Sbjct  2    KIRPLADRVVIKKVEAEEKTASGIILPGSA--KEQPQMAQVIEVGPGGFVDGNEVKMEVE  59

Query  201  TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             G KV++S     EV + +EE ++  ++ D+LAV+E
Sbjct  60   VGDKVIYSKYAGNEVKIDSEE-YIILRQSDILAVIE  94



>ref|WP_018590021.1| co-chaperonin GroES [Terrisporobacter glycolicus]
Length=94

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVE  200
            K+ P ADRV+I+  E  EK+A GI+LP SA   E+  M +++ VG G          EVE
Sbjct  2    KIRPLADRVVIKKVEAEEKTASGIILPGSA--KEQPQMAQVIEVGPGGFVDGSEVKMEVE  59

Query  201  TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             G KV++S     EV + +EE ++  ++ D+LAV+E
Sbjct  60   VGDKVIYSKYAGNEVKIDSEE-YIILRQSDILAVIE  94



>ref|WP_015157756.1| Co-chaperonin GroES [Chamaesiphon minutus]
 gb|AFY91561.1| Co-chaperonin GroES [Chamaesiphon minutus PCC 6605]
Length=103

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SE  194
            + V P ADRV +++    EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLADRVFVKVSASEEKTAGGILLPDTA--KEKPQIGEVVQVGPGKRNDDGTRQEPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++ G KVL+S     +V LG +E +V   E D+LAVV
Sbjct  67   IKIGDKVLYSKYAGTDVKLGGDE-YVLLSEKDILAVV  102



>ref|WP_027846172.1| chaperonin [Mastigocoleus testarum]
Length=103

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++SVG G           +
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEVISVGDGKLKDDGSRMAMD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAVV  102



>ref|WP_009633920.1| Co-chaperonin GroES [Synechocystis sp. PCC 7509]
Length=103

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           E
Sbjct  9    STVKPLGDRVFVKVSAAEEKTAGGLYLPDNA--KEKPQVGEVVALGDGKRNDDGTRQQME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            VE G KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   VEIGHKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>ref|WP_035152189.1| chaperonin [Calothrix sp. 336/3]
 gb|KFB83078.1| chaperonin [Calothrix sp. 336/3]
Length=103

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 12/93 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG  206
            P  DRV I++    EK+AGGILLP   V  E+  +GEI++VG G           +++ G
Sbjct  13   PLGDRVFIKVGASEEKTAGGILLPD--VAKEKPQIGEIVAVGPGKRNDDGSRQTPDIKVG  70

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
             +VL+S     ++ LGTEE +V   E D+LA+V
Sbjct  71   DRVLYSKYAGTDIKLGTEE-YVLLSEKDILAIV  102



>ref|WP_026097753.1| chaperonin [Geitlerinema sp. PCC 7105]
Length=103

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 12/98 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P ADRV +++    EK+AGGILLP +A   E+  +GE++ VG G           +
Sbjct  9    STVKPLADRVFVKVSASEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAMD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            V  G KVL+S     ++ LG++E  V   E D+LA+V+
Sbjct  67   VNVGDKVLYSKYAGTDIKLGSDE-FVLLSEKDILAIVQ  103



>ref|WP_011365113.1| molecular chaperone GroES [Synechococcus sp. CC9605]
 sp|Q3AHM3.1|CH10_SYNSC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus sp. CC9605]
 gb|ABB35909.1| Co-chaperonin GroES [Synechococcus sp. CC9605]
Length=103

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G  VL+S     ++ LG++E +V   E D+LAVV
Sbjct  67   VGVGDNVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV  102



>ref|WP_004161432.1| molecular chaperone GroES [Microcystis aeruginosa]
 emb|CCI17290.1| 10kDa chaperonin (Protein Cpn10) (groES protein) [Microcystis 
aeruginosa PCC 9807]
Length=103

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            T V P  DRV +++    E++AGGI LP +A   E+  +GE+++VGTG           E
Sbjct  9    TTVKPLGDRVFVKVSPGEERTAGGIFLPDAA--QEKPQIGEVVTVGTGKRNDDGSRTPVE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG EE +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGGEE-YVLLSEKDILAVV  102



>ref|WP_036004425.1| chaperonin [Leptolyngbya sp. JSC-1]
Length=103

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGI LP +A   E+  +GE+ +VG G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGIFLPDTA--KEKPQVGEVAAVGPGRRNDDGSRQEME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGTEE +V   E D+LA+V
Sbjct  67   VKIGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAIV  102



>ref|WP_007683755.1| molecular chaperone GroES [Novosphingobium sp. AP12]
 gb|EJL26982.1| Co-chaperonin GroES [Novosphingobium sp. AP12]
Length=95

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 12/93 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DRVL+R  E  EK+AGGI++P SA   E+   GEI+SVGTG           +V+ G
Sbjct  5    PLHDRVLVRRVEAEEKTAGGIIIPDSA--KEKPAEGEIVSVGTGARAENGTITPLDVKVG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
             +VLF   +  EV +G E+  +  KE D+L V+
Sbjct  63   DRVLFGKWSGTEVKVGGED-LLIMKESDILGVI  94



>ref|WP_032520162.1| chaperonin [Prochlorococcus marinus]
 gb|KGG08847.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. SB]
Length=103

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP SA   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDSA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSVGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_038546438.1| chaperonin [Synechococcus sp. KORDI-100]
 gb|AII44354.1| molecular chaperone GroES [Synechococcus sp. KORDI-100]
Length=103

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ +G G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVVQIGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLGGDE-YVLLTEKDILAVV  102



>ref|WP_035999452.1| chaperonin [Leptolyngbya sp. JSC-1]
Length=103

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            T V P  DR+L+++ E  EK+AGGI+LP +A   E+  +GE++ VG G           +
Sbjct  9    TTVKPLGDRILVKVREAEEKTAGGIILPDTA--KEKPQVGEVVQVGPGKRNEDGSFQAID  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G  VL+S     ++ LG E+ +V  +E D+LA V
Sbjct  67   VQVGDNVLYSKYAGTDIKLGGED-YVLLREQDILATV  102



>ref|WP_011377073.1| MULTISPECIES: molecular chaperone GroES [Prochlorococcus]
 sp|Q318V5.1|CH10_PROM9 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. MIT 
9312]
 gb|ABB50590.1| groES protein [Prochlorococcus marinus str. MIT 9312]
 gb|KGF96157.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9201]
 gb|KGG01492.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9311]
Length=103

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP SA   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDSA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|YP_002048875.1| co-chaperonin GroES [Paulinella chromatophora]
 gb|ACB42665.1| co-chaperonin GroES [Paulinella chromatophora]
Length=103

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ +++ E  EK+AGGI LP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRIFVKISESEEKTAGGIFLPDTAQ--EKPQVGEVVQVGPGKRNDDGSRQSPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG+++ +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGSDD-YVLLSEKDILAVV  102



>ref|WP_002806275.1| MULTISPECIES: molecular chaperone GroES [Prochlorococcus]
 sp|A3PES5.1|CH10_PROM0 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. MIT 
9301]
 sp|A8G6T7.1|CH10_PROM2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. MIT 
9215]
 gb|ABO18250.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. 
MIT 9301]
 gb|ABV51318.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. 
MIT 9215]
 gb|EEE40004.1| chaperonin GroS [Prochlorococcus marinus str. MIT 9202]
 gb|AIQ95786.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0604]
 gb|KGG00063.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9314]
 gb|KGG02629.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9321]
 gb|KGG05264.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9322]
 gb|KGG10047.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9401]
Length=103

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP SA   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDSA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_006292354.1| MULTISPECIES: co-chaperonin GroES [Holospora]
 gb|ETZ04880.1| 10 kDa chaperonin [Holospora undulata HU1]
 dbj|GAJ46541.1| 10 kDa chaperonin [Holospora elegans E1]
Length=96

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            TK  P  DR+L++  E  EK+AGGIL+P +A   E+ + G +++VG G           E
Sbjct  2    TKFKPLGDRILVKRAEAEEKTAGGILIPDTAK--EKPIEGTVIAVGPGARDAQGNLMPLE  59

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++ G ++LF   +  EV L  E+ H+  KE D+  +V
Sbjct  60   IKVGDRILFGKWSGTEVKLAGED-HIVMKESDVFGIV  95



>ref|WP_011819052.1| molecular chaperone GroES [Prochlorococcus marinus]
 sp|A2BT11.1|CH10_PROMS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Prochlorococcus marinus str. AS9601]
 gb|ABM70922.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. 
AS9601]
Length=103

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP SA   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDSA--KEKPQVGEVAQVGPGKLNEDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_006101488.1| molecular chaperone GroES [Coleofasciculus chthonoplastes]
 gb|EDX75214.1| chaperonin GroS [Coleofasciculus chthonoplastes PCC 7420]
Length=103

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI++ G G           E
Sbjct  9    STVKPLGDRVFLKVSAAEEKTAGGILLPDNA--KEKPQVGEIVATGPGKRNDDGSRSELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG EE +V   E D+LAVV
Sbjct  67   VKIGDKVLYSKYAGTDIKLGNEE-YVLLSEKDILAVV  102



>ref|WP_021769306.1| MULTISPECIES: hypothetical protein [Leptotrichia]
 gb|ERL27317.1| hypothetical protein HMPREF9108_00060 [Leptotrichia sp. oral 
taxon 225 str. F0581]
Length=87

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 2/85 (2%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVN  233
            P  +R+LI+  E  E +  GI+LP +A K E+ ++GE+L+VG+ V EV+ G KV+F   +
Sbjct  5    PLGERILIKQTEQEEVTKSGIVLPGTASK-EKPIIGEVLAVGSKVEEVKAGDKVIFEKYS  63

Query  234  AYEVNLGTEERHVFCKEGDLLAVVE  308
              EV  G EE ++  ++ ++LA+VE
Sbjct  64   GTEVKDG-EESYLILEKDNVLAIVE  87



>ref|WP_037220858.1| chaperonin [Richelia intracellularis]
 emb|CDN13813.1| Heat shock protein 60 family co-chaperone GroES [Richelia intracellularis]
Length=103

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++SVG G           +
Sbjct  9    STVKPLGDRVFVKVNASEEKTAGGLYLPDTA--KEKPQVGEVVSVGAGKLKDDDSRQTMD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAIV  102



>ref|WP_016877281.1| molecular chaperone GroES [Chlorogloeopsis fritschii]
Length=103

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P +DRVLI++ E  EK+ GGILLP +A   E+  +GE+++VG G           +
Sbjct  9    STVKPLSDRVLIKVGESEEKTPGGILLPDTA--KEKPQVGEVVAVGAGKWNEDASRQPMQ  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G+KVL+S     ++ +GTE+ +V   E D+LA +
Sbjct  67   VKVGEKVLYSKYAGTDIKIGTED-YVLLSEKDILATL  102



>ref|WP_039337607.1| molecular chaperone GroES [Novosphingobium subterraneum]
 gb|KHS42970.1| molecular chaperone GroES [Novosphingobium subterraneum]
Length=104

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 12/103 (12%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG  206
            P  DRVL+R  E  EK+AGGI++P SA   E+ + GE+++VG G  +         V+ G
Sbjct  5    PLHDRVLVRRIEAEEKTAGGIIIPDSA--KEKPMEGEVVTVGPGARDDTGKLVELAVKAG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE*IAHLQRQC  335
             +VLF   +  EV +  E+  +  KE D+L ++E  A L++  
Sbjct  63   DRVLFGKWSGTEVRINGED-LLIMKESDILGIIEATAELKKAA  104



>ref|WP_018123706.1| molecular chaperone GroES [Desulfovibrio oxyclinae]
Length=95

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------V  197
            K+ P  DRVL++  E+ EK+AGGI++P SA   E+ + GE+++ G G  +         V
Sbjct  2    KLKPLNDRVLVKRLEMEEKTAGGIIIPDSA--KEKPMKGEVVAAGPGKLDDAGKRVELTV  59

Query  198  ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            +TG  VLF+     EV +   E H+  +E D+LAVVE
Sbjct  60   KTGDTVLFAKYAGTEVKIDGNE-HLVMREDDILAVVE  95



>ref|WP_020642390.1| chaperonin [Amycolatopsis balhimycina]
Length=110

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  63   DRVLIRL--EELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNA  236
            DRVL+RL  EE   +S+GGI++P +A    R   G++L VG  V  V+TG +VLF+  + 
Sbjct  17   DRVLVRLSPEEGERRSSGGIVIPATAQVARRLSWGDVLGVGNSVRNVKTGDRVLFNPEDQ  76

Query  237  YEVNLGTEERHVFCKEGDLLAV  302
            +EV +   E H+  +E D+ AV
Sbjct  77   FEVEI-QGEGHLVMRERDIHAV  97



>ref|WP_037308521.1| molecular chaperone GroES [Ruegeria halocynthiae]
Length=95

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 12/94 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG  206
            P  DRVL+R  E  EK+AGG+++P SA   E+   GE++S G G  +         V+ G
Sbjct  5    PLHDRVLVRRTESDEKTAGGLIIPDSA--KEKPSEGEVVSTGEGARKDSGELIAMAVKAG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             K+LF   +  EVN+G EE  +  KE D++ ++E
Sbjct  63   DKILFGKWSGTEVNVGGEEL-LMMKESDIMGIIE  95



>ref|WP_034902662.1| molecular chaperone GroES [Campylobacter sp. MIT 97-5078]
 gb|KGI57301.1| molecular chaperone GroES [Campylobacter sp. MIT 97-5078]
Length=86

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVN  233
            P   RVL++  E    +A GI++P +A   E+ LMGEI++V   +S+V+TG KVLF+   
Sbjct  5    PLGKRVLVKRVEETNTTASGIIIPDNAK--EKPLMGEIIAVSQELSDVKTGDKVLFAKYG  62

Query  234  AYEVNLGTEERHVFCKEGDLLAVVE  308
              EV LGTEE  V   + D+L +V+
Sbjct  63   GTEVKLGTEEYLVLNID-DVLGIVK  86



>ref|WP_021745275.1| MULTISPECIES: chaperonin GroS [Leptotrichia]
 gb|ERK48446.1| chaperonin GroS [Leptotrichia sp. oral taxon 879 str. F0557]
Length=87

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 2/85 (2%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVN  233
            P  +RVLI+  E  E +  GI+LP +A K E+ ++GE+L+VG+ + EV+ G KV+F   +
Sbjct  5    PLGERVLIKQTEQEEVTKSGIVLPGTASK-EKPIIGEVLAVGSKIEEVKVGDKVIFEKYS  63

Query  234  AYEVNLGTEERHVFCKEGDLLAVVE  308
              EV  G EE ++  ++ ++LA+VE
Sbjct  64   GTEVKDG-EESYLILEKDNVLAIVE  87



>ref|WP_034957313.1| molecular chaperone GroES [Erythrobacter longus]
 gb|KEO91085.1| molecular chaperone GroES [Erythrobacter longus]
Length=104

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 12/103 (12%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG  206
            P  DRVL+R  E  EK+AGGI++P +A   E+ + GE+++VG G  +         VE G
Sbjct  5    PLHDRVLVRRIEAEEKTAGGIIIPDTA--KEKPMEGEVVAVGPGTRDESGKLIELGVEPG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE*IAHLQRQC  335
            +++LF   +  EV +  E+  +  KE D+L ++E  A L++  
Sbjct  63   QRILFGKWSGTEVRIDGEDL-LIMKESDILGIIETTAELKKAA  104



>ref|WP_017299961.1| molecular chaperone GroES [Nodosilinea nodulosa]
Length=103

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P ADRVLI++    E +AGGILLP +A   E+  +GEI +VG G +         E
Sbjct  9    SSVKPLADRVLIKVSASEETTAGGILLPDTA--KEKPQVGEITAVGPGKTDDKGSRQAME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG +E  V   E D+LAV+
Sbjct  67   VKIGDKVLYSKYAGTDIKLGGDE-FVLLSEKDILAVL  102



>ref|WP_006194609.1| molecular chaperone GroES [Nodularia spumigena]
 gb|EAW46837.1| Chaperonin [Nodularia spumigena CCY9414]
 gb|AHJ31494.1| Heat shock protein 60 family co-chaperone GroES [Nodularia spumigena 
CCY9414]
Length=103

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           +
Sbjct  9    STVKPLGDRVFVKVSAPEEKTAGGLFLPDNAQ--EKPQVGEVVALGPGKRNDDGSRQELD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++TG KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   IKTGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>ref|WP_035986961.1| chaperonin [Leptolyngbya sp. KIOST-1]
Length=103

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P ADRVLI++    E +AGGILLP +A   E+  +GEI +VG G +         E
Sbjct  9    SSVKPLADRVLIKVSASEETTAGGILLPDTA--KEKPQVGEITAVGPGKADDKGSRQAME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG +E  V   E D+LAV+
Sbjct  67   VKVGDKVLYSKYAGTDIKLGGDE-FVLLSEKDILAVL  102



>ref|WP_039713348.1| MULTISPECIES: chaperonin [Cyanobacteria]
 gb|KIF21002.1| chaperonin [Scytonema millei VB511283]
Length=103

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GEI+++G G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEIVAIGPGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     +V LGT+E +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDVKLGTDE-YVLLSEKDILAVV  102



>ref|WP_011127384.1| molecular chaperone GroES [Synechococcus sp. WH 8102]
 sp|Q7TTX2.1|CH10_SYNPX RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Synechococcus sp. WH 8102]
 emb|CAE07028.1| GroES chaperonin [Synechococcus sp. WH 8102]
Length=103

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFIKVSESEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E  V   E D+LA+V
Sbjct  67   VGVGDKVLYSKYAGTDIKLGGDE-FVLLTEKDILAIV  102



>ref|WP_006804030.1| molecular chaperone GroES [Leptotrichia hofstadii]
 gb|EEX75443.1| chaperonin GroS [Leptotrichia hofstadii F0254]
Length=87

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 56/85 (66%), Gaps = 2/85 (2%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVN  233
            P  +R+LI+  E  E +  GI+LP +A K E+ ++GE+L+VG+ + EV+ G KV+F   +
Sbjct  5    PLGERILIKQTEQEEVTKSGIVLPGTASK-EKPIIGEVLAVGSKIEEVKAGDKVIFEKYS  63

Query  234  AYEVNLGTEERHVFCKEGDLLAVVE  308
              EV  G EE ++  ++ ++LA+VE
Sbjct  64   GTEVKDG-EESYLILEKDNVLAIVE  87



>ref|WP_008829924.1| MULTISPECIES: molecular chaperone GroES [Sphingomonadaceae]
 gb|EJU12747.1| co-chaperonin GroES [Sphingomonas sp. LH128]
 gb|EZP77081.1| Co-chaperonin GroES [Novosphingobium resinovorum]
Length=104

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 59/103 (57%), Gaps = 12/103 (12%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG  206
            P  DRVL+R  E  EK++GGI++P +A   E+   GE+L+VG G  +         V+TG
Sbjct  5    PLHDRVLVRRIEAEEKTSGGIIIPDTA--KEKPQEGEVLAVGPGTRDENGKLTDTTVKTG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE*IAHLQRQC  335
             +VLF   +  EV +  E+  +  KE D+L ++E +A L++  
Sbjct  63   DRVLFGKWSGSEVRIDGED-LLIMKESDILGIIEPVAELKQAA  104



>ref|WP_015217477.1| 10 kDa chaperonin [Anabaena cylindrica]
 gb|AFZ60865.1| 10 kDa chaperonin [Anabaena cylindrica PCC 7122]
Length=103

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           E
Sbjct  9    STVKPLGDRVFVKVTAAEEKTAGGLYLPDTA--KEKPQVGEVVALGPGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++ G+KVL+S     +V LGTEE +V   E D+LAVV
Sbjct  67   IQVGEKVLYSKYAGTDVKLGTEE-YVLLSEKDILAVV  102



>ref|WP_010997805.1| MULTISPECIES: molecular chaperone GroES [Nostocaceae]
 sp|Q8YQZ9.1|CH10_NOSS1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Nostoc sp. PCC 7120]
 dbj|BAB75360.1| chaperonin GroES [Nostoc sp. PCC 7120]
 gb|ABA23233.1| Chaperonin Cpn10 [Anabaena variabilis ATCC 29413]
 gb|ACM48254.1| GroES [Nostoc sp. PCC 7120]
Length=103

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEVVALGAGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     +V LGTEE +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDVKLGTEE-YVLLSEKDILAVV  102



>ref|WP_020876316.1| 10 kDa chaperonin [Desulfococcus multivorans]
 gb|EPR40402.1| 10 kDa chaperonin [Desulfococcus multivorans DSM 2059]
Length=95

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV  197
            KV P  DRVL++  E  +K+ GGI++P +A   E+   GEI++VG G           +V
Sbjct  2    KVRPLNDRVLVKRVEAEQKTVGGIIIPDTAK--EKPQEGEIVAVGPGRLNDDGTRTALDV  59

Query  198  ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            + G +VLFS     E+  G EE  +F +E D+LAV E
Sbjct  60   KVGDRVLFSKYAGTEIRTGGEE-QIFMRESDILAVFE  95



>ref|WP_015147152.1| Co-chaperonin GroES [Oscillatoria acuminata]
 gb|AFY80502.1| Co-chaperonin GroES [Oscillatoria acuminata PCC 6304]
Length=103

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGILLP +A   E+  +GEI ++G G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGILLPDTA--KEKPQVGEIAAIGPGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E  V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTDE-FVLLAEKDILAIV  102



>ref|WP_041740016.1| chaperonin [Calothrix parietina]
Length=103

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++SVG G           +
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEVVSVGDGKIKDDGGRQSMD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E +V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAVV  102



>ref|WP_017326109.1| molecular chaperone GroES [Synechococcus sp. PCC 7336]
Length=103

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 12/94 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DRV I++ E  E++ GGI LP +A   E+  +GEI++VG G           +V+TG
Sbjct  13   PLGDRVFIKIAERDERTTGGIYLPDAA--QEKPQVGEIVAVGPGKRNDSGELVPLDVKTG  70

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             KVL+S     EV LG +E  V   E D+LA+VE
Sbjct  71   DKVLYSKYAGTEVKLGDDE-CVLLAERDILAIVE  103



>ref|WP_016925061.1| molecular chaperone GroES [Prochlorothrix hollandica]
Length=103

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++ E  +++AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEQQTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSHSPIE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG++E +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDIKLGSDE-YVLLTEKDILAIV  102



>ref|WP_019491741.1| molecular chaperone GroES [Calothrix sp. PCC 7103]
Length=104

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++    EK+AGG+ LP +A   E+  +GE+++VG G           +
Sbjct  10   STVKPLGDRVFIKVNAAEEKTAGGLYLPDNA--QEKPQVGEVVAVGDGKYKDDGNRVAMD  67

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E ++   E D+LAVV
Sbjct  68   VKVGDKVLYSKYAGTDIKLGTDE-YILLSEKDILAVV  103



>gb|AFY86130.1| Chaperonin Cpn10 [Chroococcidiopsis thermalis PCC 7203]
Length=111

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GEI+++G G           E
Sbjct  17   STVKPLGDRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEIVAIGPGKRNDDGSRQELE  74

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     +V LGT+E +V   E D+LAVV
Sbjct  75   VKVGDKVLYSKYAGTDVKLGTDE-YVLLSEKDILAVV  110



>ref|WP_012167682.1| molecular chaperone GroES [Acaryochloris marina]
 gb|ABW32702.1| chaperonin GroES [Acaryochloris marina MBIC11017]
Length=103

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGIL+P +A   E+  +G+++SVG G+          +
Sbjct  9    STVSPLGDRVFLKVNRAEEKTAGGILMPDTA--QEKSQVGKVVSVGPGLRSGNGSYAPID  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G +VL++  +  ++ LG E+ +V  K  D+LA+V
Sbjct  67   VQVGDQVLYAKYSGTDIKLGNED-YVLTKAQDILAIV  102



>gb|ABM77255.1| Hypothetical protein P9303_05031 [Prochlorococcus marinus str. 
MIT 9303]
Length=166

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  72   STVKPLGDRVFVKVSESEEKTAGGILLPDTAK--EKPQVGEVVQVGPGKRNDDGSRQAPE  129

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            V  G KVL+S     ++ L T+E +V   E D+LAVV 
Sbjct  130  VGVGDKVLYSKYAGTDIKLSTDE-YVLLSEKDILAVVN  166



>ref|WP_011613645.1| molecular chaperone GroES [Trichodesmium erythraeum]
 sp|Q10WQ5.1|CH10_TRIEI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Trichodesmium erythraeum IMS101]
 gb|ABG53319.1| chaperonin Cpn10 [Trichodesmium erythraeum IMS101]
Length=103

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  +RV +++ E  EK+AGGILLP SA   E+  +GE++S G G           E
Sbjct  9    STVKPLGERVFVKVSESEEKTAGGILLPDSA--KEKPQVGEVVSAGPGKRNDDGTRAEME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG +E +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDIKLGGDE-YVLLAEKDILAIV  102



>ref|WP_006171952.1| molecular chaperone GroES [Synechococcus sp. WH 5701]
 gb|EAQ76148.1| co-chaperonin GroES [Synechococcus sp. WH 5701]
Length=103

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 12/98 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ +  EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFIKVSDSDEKTAGGILLPDTAQ--EKPQVGEVVQVGPGKRSDDGTRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            V  G KVL+S     ++ LG  E  V   E D+LA+V 
Sbjct  67   VSVGDKVLYSKYAGTDIKLGGNE-FVLLSEKDILAIVN  103



>ref|WP_032524979.1| chaperonin [Prochlorococcus marinus]
 gb|KGF85500.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. GP2]
Length=103

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDTA--KEKPQIGEVAQVGPGKLNEDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_018499646.1| molecular chaperone GroES [Leptotrichia wadei]
 gb|ERK48194.1| chaperonin GroS [Leptotrichia wadei F0279]
Length=87

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 56/85 (66%), Gaps = 2/85 (2%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVN  233
            P  +RVLI+  E  E +  GI+LP +A K E+ ++GE+L++G+ + EV+ G KV+F   +
Sbjct  5    PLGERVLIKQTEQEEVTKSGIVLPGTASK-EKPIIGEVLAIGSKIEEVKVGDKVIFEKYS  63

Query  234  AYEVNLGTEERHVFCKEGDLLAVVE  308
              EV  G EE ++  ++ ++LA+VE
Sbjct  64   GTEVKDG-EESYLILEKDNVLAIVE  87



>ref|WP_036900502.1| chaperonin [Prochlorococcus sp. MIT 0601]
 gb|KGG13463.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0601]
Length=103

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++ E  EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRVFVKVSESEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKRNEDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ +G +E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKIGGDE-YVLLSEKDILAVV  102



>gb|AFZ04388.1| 10 kDa chaperonin [Calothrix sp. PCC 6303]
Length=111

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++SVG G           +
Sbjct  17   STVKPLGDRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEVVSVGDGKIKDDGGRQSMD  74

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E +V   E D+LAVV
Sbjct  75   VKVGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAVV  110



>ref|WP_014323845.1| molecular chaperone GroES [Desulfovibrio desulfuricans]
 gb|EGB16421.1| Chaperonin Cpn10 [Desulfovibrio desulfuricans ND132]
Length=95

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------V  197
            K+ P  DRVL++  E  EK+AGGI +P SA   E+ + GE+++VG G  +         V
Sbjct  2    KLKPLNDRVLVKRLETEEKTAGGIYIPDSA--KEKPMKGEVVAVGPGKLDEDGKRVKPTV  59

Query  198  ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            +TG  VLF+     E+++  EE H+  +E D+LA+VE
Sbjct  60   KTGDIVLFAKYAGSEISIDGEE-HLVMREDDILAIVE  95



>ref|WP_021232879.1| molecular chaperone GroES [Novosphingobium lindaniclasticum]
 gb|EQB18458.1| molecular chaperone GroES [Novosphingobium lindaniclasticum LE124]
Length=95

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 12/93 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DRVL+R  E  EK+AGGI++P SA   E+   GEI++VGTG           +V+ G
Sbjct  5    PLHDRVLVRRVEAEEKTAGGIIIPDSA--KEKPAEGEIVAVGTGARVENGTITPLDVKVG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
             +VLF   +  EV +G E+  +  KE D+L V+
Sbjct  63   DRVLFGKWSGTEVKVGGED-LLIMKESDILGVI  94



>ref|WP_015172923.1| chaperonin Cpn10 [Geitlerinema sp. PCC 7407]
 gb|AFY67359.1| Chaperonin Cpn10 [Geitlerinema sp. PCC 7407]
Length=103

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGGILLP++A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGDRVFVKVAASEEKTAGGILLPETA--KEKPQVGEVMQVGPGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG EE  V   E D+LAVV
Sbjct  67   VKVGDKVLYSKYAGTDIKLGGEE-FVLLSEKDILAVV  102



>ref|WP_015225431.1| chaperonin Cpn10 [Halothece sp. PCC 7418]
 gb|AFZ43555.1| Chaperonin Cpn10 [Halothece sp. PCC 7418]
Length=103

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SE  194
            + V P ADRV +++    EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLADRVFVKISPQEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGSRTEPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G +VL+S     ++ LG ++ +V   E D+LA+V
Sbjct  67   VKVGDQVLYSKYAGTDIKLGQDD-YVLLSEKDILAIV  102



>ref|WP_032527362.1| chaperonin [Prochlorococcus marinus]
 gb|KGF97157.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9302]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_028082734.1| chaperonin [Dolichospermum circinale]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV I++    EK+AGG+ LP +A   E+  +GEI +VG G           +
Sbjct  9    STVKPLGDRVFIKVSAPQEKTAGGLYLPDNAQ--EKPQVGEIAAVGPGKRNDDGSRQPMD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            +  G KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   INIGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>ref|WP_032513302.1| chaperonin [Prochlorococcus marinus]
 gb|KGF91192.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9107]
 gb|KGF92552.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9116]
 gb|KGF93794.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
marinus str. MIT 9123]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ I++    EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRIFIKVSASEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKLNDDGSRQTPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct  67   VSIGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV  102



>ref|WP_013191733.1| molecular chaperone GroES [Trichormus azollae]
 gb|ADI64717.1| Chaperonin Cpn10 ['Nostoc azollae' 0708]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           E
Sbjct  9    STVKPLGDRVFVKVTAAEEKTAGGLYLPDTA--KEKPQVGEVVALGPGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++ G KVL+S     +V LGTEE +V   E D+LAVV
Sbjct  67   IKAGDKVLYSKYAGTDVKLGTEE-YVLLSEKDILAVV  102



>ref|WP_009756748.1| MULTISPECIES: molecular chaperone GroES [Fischerella]
 gb|EHC14987.1| 10 kDa chaperonin [Fischerella sp. JSC-11]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DR+ +++ +  EK+AGGILLP +A   E+  +GE++ +G G           E
Sbjct  9    STVKPLGDRLFVKVAQAEEKTAGGILLPDTA--KEKPQVGEVVQIGPGKRDESGNRIPME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     +V LG+E+ +V   E D+LA+V
Sbjct  67   VSVGDKVLYSKYAGTDVKLGSED-YVLLSEKDVLAIV  102



>ref|WP_031933947.1| molecular chaperone GroES [Candidatus Hepatobacter penaei]
Length=102

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EV  197
            K+ P ADRVL++  E  EK+ GGI++P +A   E+ + G++++VGTG           E+
Sbjct  5    KLRPLADRVLVKRVEAEEKTKGGIIIPDNAK--EKPMEGDVVAVGTGARSEGGQIIPLEL  62

Query  198  ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAV  302
            + G +VLF   +  EV L  +E  +  KE D++ V
Sbjct  63   KVGDRVLFGKWSGTEVKLNGDEEFMIMKESDVMGV  97



>ref|WP_012407590.1| molecular chaperone GroES [Nostoc punctiforme]
 sp|B2IT70.1|CH10_NOSP7 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein; 
AltName: Full=Protein Cpn10 [Nostoc punctiforme PCC 73102]
 gb|ACC79568.1| chaperonin Cpn10 [Nostoc punctiforme PCC 73102]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P +DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           E
Sbjct  9    STVKPLSDRVFVKVNASEEKTAGGLYLPDTA--KEKPQVGEVVALGPGKRNEDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++ G KVL+S     ++ LGTEE +V   E D+LAVV
Sbjct  67   IKVGDKVLYSKYAGTDIKLGTEE-YVLLSEKDILAVV  102



>ref|WP_015142262.1| Co-chaperonin GroES [Pleurocapsa minor]
 gb|AFY75954.1| Co-chaperonin GroES [Pleurocapsa sp. PCC 7327]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SE  194
            + V P  DRV +++    E++AGGILLP +A   E+  +GE+++VG G           E
Sbjct  9    STVKPLGDRVFVKVSPSEERTAGGILLPDTA--KEKPQIGEVVAVGPGKRNDDGSRSEPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     +V LG E+ +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDVKLGGED-YVLLSEKDILAIV  102



>ref|WP_022660630.1| molecular chaperone GroES [Desulfovibrio longus]
Length=95

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EV  197
            K+ P +DRVL++  E+ E++AGGI++P SA   E+ + GE+++ G G +          V
Sbjct  2    KLKPLSDRVLVKRLEMEERTAGGIIIPDSA--KEKPMRGEVVAAGPGKAGDDGKVVPMTV  59

Query  198  ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            + G  VLF+     E+ L  EE H+  +E D+LA+VE
Sbjct  60   KAGDVVLFAKYAGTEIKLDGEE-HLVMREEDILAIVE  95



>ref|WP_013230909.1| chaperonin [Amycolatopsis mediterranei]
 ref|YP_003771293.1| chaperonin GroES [Amycolatopsis mediterranei U32]
 gb|ADJ50891.1| chaperonin GroES [Amycolatopsis mediterranei U32]
 gb|AEK47904.1| chaperonin GroES [Amycolatopsis mediterranei S699]
 gb|AFO82597.1| chaperonin GroES [Amycolatopsis mediterranei S699]
 gb|AGT89726.1| chaperonin GroES [Amycolatopsis mediterranei RB]
 gb|KDO12115.1| chaperonin [Amycolatopsis mediterranei]
 gb|KDU91322.1| chaperonin [Amycolatopsis mediterranei]
Length=110

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +3

Query  63   DRVLIRL--EELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNA  236
            DRVL+RL  EE   +S+GGI++P +A    R   G++L VG  V  V+TG +VLF+  + 
Sbjct  17   DRVLVRLSPEEGERRSSGGIVIPATAQVARRLAWGDVLGVGNSVRNVKTGDRVLFNPEDQ  76

Query  237  YEVNLGTEERHVFCKEGDLLAV  302
             EV +   E H+  +E D+ AV
Sbjct  77   LEVEI-QGEGHLVMRERDIHAV  97



>ref|WP_024124016.1| heat shock protein 60 family co-chaperone GroES [Thermosynechococcus 
sp. NK55a]
 gb|AHB87599.1| heat shock protein 60 family co-chaperone GroES [Thermosynechococcus 
sp. NK55a]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DR+ +++ E  E++AGGILLP +A   E+  +GE+ +VG G           +
Sbjct  9    STVKPLGDRIFVKVAESEERTAGGILLPDNA--REKPQVGEVTAVGPGKLTEDGKRQPMD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     EV LG E+ +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTEVKLGGED-YVLLSEKDILAIV  102



>ref|WP_015130973.1| MULTISPECIES: 10 kDa chaperonin [Nostocales]
 gb|AFY35177.1| 10 kDa chaperonin [Calothrix sp. PCC 7507]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           E
Sbjct  9    STVKPLGDRVFVKVSASEEKTAGGLYLPDTA--KEKPQVGEVVALGPGKRNDDGSRQELE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            ++ G KVL+S     +V LGTEE +V   E D+LAVV
Sbjct  67   IKVGDKVLYSKYAGTDVKLGTEE-YVLLSEKDILAVV  102



>ref|WP_019501756.1| molecular chaperone GroES [Pseudanabaena sp. PCC 6802]
Length=103

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+AGGI LP +A   E+  +GEI +VG G           E
Sbjct  9    STVKPLGDRVFIKISEKEEKTAGGIFLPDTAK--EKPQVGEIAAVGPGKLDDKGVRQPLE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG ++ +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDLKLGNDD-YVLLAEKDILAIV  102



>ref|WP_025747014.1| molecular chaperone GroES [Caldicoprobacter oshimai]
Length=94

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 11/96 (11%)
 Frame = +3

Query  45   KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVE  200
            K+ P  DRV+I+  E  E + GGI+LP SA   E+  M E+++VG G          EV+
Sbjct  2    KLRPLGDRVVIKALETEETTKGGIVLPSSA--KEKPQMAEVIAVGPGGMVDGKEVKMEVK  59

Query  201  TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             G KV++S     EV L  EE ++  ++ D+LAVVE
Sbjct  60   VGDKVIYSKYAGTEVKLDNEE-YIIVRQSDILAVVE  94



>ref|WP_008996322.1| molecular chaperone GroES [Novosphingobium sp. Rr 2-17]
 gb|EIZ78086.1| chaperonin GroES [Novosphingobium sp. Rr 2-17]
Length=95

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 12/93 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DRVL+R  E  EK+AGGI++P SA   E+   GEI++VGTG           +V  G
Sbjct  5    PLHDRVLVRRVEAEEKTAGGIIIPDSA--KEKPAEGEIVAVGTGTRSETGTITPLDVAVG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
             +VLF   +  EV +G E+  +  KE D+L V+
Sbjct  63   DRVLFGKWSGTEVKVGGED-LLIMKESDILGVI  94



>ref|WP_043569699.1| chaperonin [Actinopolyspora erythraea]
 gb|KGI82689.1| chaperonin [Actinopolyspora erythraea]
Length=106

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  63   DRVLIRLEELP--EKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNA  236
            DRV++R+ E     +S+GGI++P +A   +R L GE+  VG+ V  V+TG +VLF+    
Sbjct  13   DRVMVRVSEESGERRSSGGIVIPATAQVAKRLLWGEVFGVGSHVRSVQTGDQVLFNPEEQ  72

Query  237  YEVNLGTEERHVFCKEGDLLAV  302
            YEV +   E +V  +E DL AV
Sbjct  73   YEVEV-RGEIYVVLRERDLHAV  93



>ref|WP_026894497.1| molecular chaperone GroES [Clostridiisalibacter paucivorans]
Length=93

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 10/92 (11%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-------SEVETGKK  212
            P  DRV+I+  E+ EK+  GI+LP SA   E+  M E+L++G+ +        E++ G K
Sbjct  5    PLGDRVVIKKVEVEEKTKSGIVLPNSA--KEQPTMAEVLAIGSAILEDEKKSKELKVGDK  62

Query  213  VLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            V+FS  +  EV +  EE +   K  D+LAVVE
Sbjct  63   VIFSKYSGTEVKMDDEE-YTILKLNDILAVVE  93



>ref|WP_043560528.1| molecular chaperone GroES [Saccharibacter sp. AM169]
 emb|CDG34088.1| Heat shock protein 60 family co-chaperone GroES [Saccharibacter 
sp. AM169]
Length=96

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            TK  P  DRV++R  +  EK+AGGI++P++A   E+ + GE+L+VG+G           +
Sbjct  2    TKFRPLHDRVVVRRLDGEEKTAGGIIIPETA--KEKPMEGEVLAVGSGARNEQGQVVPLD  59

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G +VLF   +  EV +G E+  +  KE D+L +V
Sbjct  60   VKAGDRVLFGKWSGTEVKIGGED-LLIMKESDILGIV  95



>ref|WP_027403125.1| chaperonin [Aphanizomenon flos-aquae]
 gb|KHG41184.1| chaperonin [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=103

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 12/98 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++    EK+AGG+ LP +A   E+  +GEI +VG G           +
Sbjct  9    STVKPLGDRVFIKVSAPQEKTAGGLYLPDNAQ--EKPQVGEIAAVGPGKRNDDGTRQTMD  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
            +  G KVL+S     ++ LGT+E +V   E D+LA+V 
Sbjct  67   INVGDKVLYSKYAGTDIKLGTDE-YVLLSEKDILAIVN  103



>ref|WP_036919118.1| MULTISPECIES: chaperonin [Prochlorococcus]
 gb|KGG14803.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0602]
 gb|KGG15763.1| Heat shock protein 60 family co-chaperone GroES [Prochlorococcus 
sp. MIT 0603]
Length=103

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE  194
            + V P  DRV I++ E  EK+AGGILLP +A   E+  +GE+  VG G           E
Sbjct  9    STVKPLGDRVFIKVSESEEKTAGGILLPDTA--KEKPQVGEVAQVGPGKRNEDGSRQAPE  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V  G KVL+S     ++ L  +E +V   E D+LAVV
Sbjct  67   VGVGDKVLYSKYAGTDIKLAGDE-YVLLSEKDILAVV  102



>ref|WP_008757222.1| molecular chaperone GroES [Rhodobacteraceae bacterium KLH11]
 gb|EEE38048.1| chaperonin GroS [Rhodobacteraceae bacterium KLH11]
Length=95

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 12/94 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG  206
            P  DRVL+R  E  EK+AGG+++P SA   E+   GE+++ G G  +         V+ G
Sbjct  5    PLHDRVLVRRTESDEKTAGGLIIPDSA--KEKPSEGEVVATGEGARKDSGELIAMAVKAG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             K+LF   +  EVN+G EE  +  KE D++ ++E
Sbjct  63   DKILFGKWSGTEVNVGGEEL-LMMKESDIMGIIE  95



>ref|WP_003058043.1| chaperonin GroES [Amycolatopsis vancoresmycina]
 gb|EOD69991.1| chaperonin GroES [Amycolatopsis vancoresmycina DSM 44592]
Length=110

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +3

Query  63   DRVLIRL--EELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNA  236
            DRVL+RL  EE   +S+GGI++P +A    R   G++L VG  V  V+TG +VLF+  + 
Sbjct  17   DRVLVRLSPEEGERRSSGGIVIPATAQVARRLAWGDVLGVGNSVRNVKTGDRVLFNPEDQ  76

Query  237  YEVNLGTEERHVFCKEGDLLAV  302
             EV +   E H+  +E D+ AV
Sbjct  77   LEVEI-QGEGHLVMRERDIHAV  97



>ref|WP_009787538.1| MULTISPECIES: molecular chaperone GroES [Lyngbya]
 gb|EAW33875.1| co-chaperonin GroES [Lyngbya sp. PCC 8106]
 gb|ERT04815.1| 10 kDa chaperonin [Lyngbya aestuarii BL J]
Length=103

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  +RV +++ E  EK+AGGILLP++A   E+  +GEI++ G G           E
Sbjct  9    STVKPLGERVFVKVSESEEKTAGGILLPETA--KEKPQIGEIVATGPGKRNDDGSRAEME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG +E +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDIKLGGDE-YVLLAEKDILAIV  102



>ref|WP_031549416.1| molecular chaperone GroES [Parvularcula oceani]
Length=95

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 12/94 (13%)
 Frame = +3

Query  54   PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG  206
            P  DRVL+R  E  EK+AGGI++P +A   E+   GE+++VG+G           +V+ G
Sbjct  5    PLHDRVLVRRTEEDEKTAGGIIIPDTA--KEKPQQGEVVAVGSGTRSDTGEVTPLDVKEG  62

Query  207  KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE  308
             ++LF   +  EV LG E+  +  KE D+L +V+
Sbjct  63   DRILFGKWSGTEVKLGGED-LLIMKESDILGIVD  95



>ref|WP_017717870.1| molecular chaperone GroES [Oscillatoria sp. PCC 10802]
Length=103

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  +RV +++    EK+AGGILLP +A   E+  +GE++ VG G           E
Sbjct  9    STVKPLGERVFVKVSASEEKTAGGILLPDTA--KEKPQVGEVVQVGPGKRNDDGTRQEME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LG+EE +V   E D+LA+V
Sbjct  67   VKIGDKVLYSKYAGTDIKLGSEE-YVLLSEKDILAIV  102



>ref|WP_006633072.1| MULTISPECIES: molecular chaperone GroES [Oscillatoriales]
 gb|EGK87516.1| 10 kDa chaperonin [Microcoleus vaginatus FGP-2]
 gb|AFZ05179.1| 10 kDa chaperonin [Oscillatoria nigro-viridis PCC 7112]
Length=103

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  42   TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E  194
            + V P  +RV +++    EK+AGGILLP +A   E+  +GE+ +VG G           E
Sbjct  9    STVKPLGERVFVKVSASEEKTAGGILLPDTA--KEKPQVGEVAAVGPGKRNDDGSRTEME  66

Query  195  VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV  305
            V+ G KVL+S     ++ LGT+E +V   E D+LA+V
Sbjct  67   VKVGDKVLYSKYAGTDIKLGTDE-YVLLAEKDILAIV  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880