BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN030J07

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHI85710.1|  stress-induced protein 5                                320   1e-108   Capsicum annuum
gb|ABH08753.1|  ubiquitin                                               320   6e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85643.1|  unknown                                                 321   7e-108   Medicago truncatula
ref|NP_567286.1|  ubiquitin 11                                          320   9e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78180.1|  putative polyubiquitin                                  320   9e-108   Gossypium herbaceum [Arabian cotton]
gb|ABH08755.1|  ubiquitin                                               320   9e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ACZ69386.1|  polyubiquitin UBQ14                                     319   1e-107   Cucumis sativus [cucumbers]
gb|AAZ32851.1|  pentameric polyubiquitin                                318   1e-107   Medicago sativa [alfalfa]
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    318   1e-107   Hordeum vulgare [barley]
ref|XP_007693173.1|  hypothetical protein COCMIDRAFT_109160             318   1e-107   Bipolaris oryzae ATCC 44560
gb|AFC36452.1|  ubiquitin                                               319   1e-107   Anoectochilus roxburghii
gb|AFJ04519.1|  ubiquitin                                               318   2e-107   Vernicia fordii [tung oil tree]
pir||PS0380  ubiquitin precursor - rice (fragment)                      318   2e-107
gb|ABR25718.1|  polyubiquitin containing 7 ubiquitin monomers           318   2e-107   Oryza sativa Indica Group [Indian rice]
gb|ACJ85618.1|  unknown                                                 319   2e-107   Medicago truncatula
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             322   3e-107   
ref|XP_003626479.1|  Ubiquitin-like protein                             321   3e-107   
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             319   4e-107   Brachypodium distachyon [annual false brome]
gb|EEC81189.1|  hypothetical protein OsI_24195                          318   4e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    320   5e-107   
gb|AIZ74335.1|  polyubiquitin 3                                         319   5e-107   Pinus massoniana [Chinese red pine]
gb|AGV54749.1|  ubiquitin 11                                            320   6e-107   Phaseolus vulgaris [French bean]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             318   6e-107   Elaeis guineensis
gb|AAF31707.1|AF221858_1  polyubiquitin                                 318   7e-107   Euphorbia esula [wolf's milk]
gb|AAB36546.1|  polyubiquitin                                           318   7e-107   Phaseolus vulgaris [French bean]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             320   7e-107   Brachypodium distachyon [annual false brome]
gb|AET06143.1|  ubiquitin                                               318   7e-107   Papaver somniferum
ref|XP_002317213.1|  polyubiquitin family protein                       318   7e-107   Populus trichocarpa [western balsam poplar]
gb|ABH08754.1|  ubiquitin                                               318   7e-107   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC57955.1|  polyubiquitin                                          318   7e-107   Tripolium pannonicum [sea starwort]
gb|AAM64530.1|  ubiquitin homolog                                       318   8e-107   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                318   8e-107   Erythranthe guttata [common monkey flower]
gb|ACT82769.1|  polyubiquitin                                           317   8e-107   Nicotiana tabacum [American tobacco]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    318   8e-107   Gossypium raimondii
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      318   8e-107   Setaria italica
gb|KJB36627.1|  hypothetical protein B456_006G167800                    318   9e-107   Gossypium raimondii
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   318   9e-107   Camelina sativa [gold-of-pleasure]
gb|AAP31578.1|  ubiquitin                                               318   9e-107   Hevea brasiliensis [jebe]
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             319   9e-107   
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   318   9e-107   Citrus sinensis [apfelsine]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             318   9e-107   Citrus clementina [clementine]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             318   9e-107   
gb|ABD96088.1|  polyubiquitin                                           319   9e-107   Malus domestica [apple tree]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      321   1e-106   Brassica rapa
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      320   1e-106   Camelina sativa [gold-of-pleasure]
emb|CAH59739.1|  polyubiquitin                                          318   1e-106   Plantago major [cart-track plant]
emb|CAA48140.1|  ubiquitin                                              320   1e-106   Antirrhinum majus [garden snapdragon]
gb|EPS72031.1|  polyubiquitin                                           319   1e-106   Genlisea aurea
gb|ABK94002.1|  unknown                                                 320   1e-106   Populus trichocarpa [western balsam poplar]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      320   1e-106   Camelina sativa [gold-of-pleasure]
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           320   1e-106   Nicotiana tomentosiformis
gb|AEZ49160.1|  polyubiquitin                                           320   1e-106   Wolffia australiana
ref|NP_849292.1|  polyubiquitin 14                                      320   1e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAR32784.1|  polyubiquitin                                           317   1e-106   Clusia minor [cupey de monte]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    320   1e-106   Gossypium raimondii
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      320   1e-106   Camelina sativa [gold-of-pleasure]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   317   1e-106   Citrus sinensis [apfelsine]
emb|CBY46745.1|  polyubiquitin 10 protein                               320   1e-106   Lepidium appelianum [hairy whitetop]
gb|AAO43307.1|  putative polyubiquitin                                  318   1e-106   Arabidopsis thaliana [mouse-ear cress]
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           316   2e-106   Oryza sativa Indica Group [Indian rice]
gb|AFK41706.1|  unknown                                                 317   2e-106   Medicago truncatula
gb|AFK43392.1|  unknown                                                 317   2e-106   Medicago truncatula
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          317   3e-106   Sorghum bicolor [broomcorn]
gb|AFY06654.1|  polyubiquitin                                           318   3e-106   Carica papaya [mamon]
gb|AAC35858.1|  polyubiquitin                                           318   3e-106   Capsicum chinense [bonnet pepper]
ref|XP_003590494.1|  Ubiquitin                                          320   3e-106   
gb|AES89866.2|  polyubiquitin 3                                         319   3e-106   Medicago truncatula
gb|AES89865.2|  polyubiquitin 3                                         318   3e-106   Medicago truncatula
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             319   3e-106   
emb|CBI22349.3|  unnamed protein product                                319   4e-106   Vitis vinifera
ref|XP_003627152.1|  Ubiquitin                                          318   4e-106   
emb|CAC94926.1|  putative ubiquitin                                     317   4e-106   Pleurotus sp. 'Florida' [Florida oyster mushroom]
gb|AAQ84316.1|  fiber polyubiquitin                                     316   4e-106   Gossypium barbadense [Egyptian cotton]
gb|ABY60454.1|  putative polyubiquitin                                  318   4e-106   Adonis aestivalis var. palaestina
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    316   4e-106   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             316   5e-106   Citrus clementina [clementine]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             316   5e-106   
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            317   5e-106   Phaseolus vulgaris [French bean]
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  316   6e-106   Piloderma croceum F 1598
gb|AAK68824.1|  Unknown protein                                         316   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   316   6e-106   Brassica rapa
ref|XP_719867.1|  hypothetical protein CaO19.6771                       316   6e-106   Candida albicans SC5314
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 316   6e-106   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          316   6e-106   Yamadazyma tenuis ATCC 10573
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             318   7e-106   
gb|KIR83632.1|  polyubiquitin                                           315   7e-106   Cryptococcus gattii VGIV IND107
gb|AAO42469.1|  putative polyubiquitin                                  318   7e-106   Arabidopsis lyrata [lyrate rockcress]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    321   7e-106   Nicotiana sylvestris
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   316   7e-106   Piloderma croceum F 1598
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  316   7e-106   Hypholoma sublateritium FD-334 SS-4
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      318   8e-106   Oryza brachyantha
ref|XP_007014924.1|  Polyubiquitin 3                                    318   8e-106   Theobroma cacao [chocolate]
ref|XP_011110054.1|  hypothetical protein H072_4094                     315   8e-106   
gb|ACD31680.1|  ubiquitin                                               318   8e-106   Gossypium hirsutum [American cotton]
emb|CAA40323.1|  polyubiquitin protein                                  319   8e-106   Helianthus annuus
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           318   8e-106   Nelumbo nucifera [Indian lotus]
ref|XP_007512209.1|  polyubiquitin                                      320   8e-106   Bathycoccus prasinos
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          318   8e-106   Sorghum bicolor [broomcorn]
dbj|BAJ85978.1|  predicted protein                                      318   8e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             318   8e-106   Citrus clementina [clementine]
gb|AAO43308.1|  putative polyubiquitin                                  316   9e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           318   9e-106   Brassica rapa
emb|CAH59740.1|  polyubiquitin                                          318   9e-106   Plantago major [cart-track plant]
prf||1604470A  poly-ubiquitin                                           317   9e-106
gb|KJB62487.1|  hypothetical protein B456_009G418900                    318   9e-106   Gossypium raimondii
ref|NP_851029.1|  polyubiquitin 3                                       318   9e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             318   9e-106   Citrus clementina [clementine]
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  315   9e-106   Paxillus rubicundulus Ve08.2h10
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                318   9e-106   Erythranthe guttata [common monkey flower]
ref|XP_007339454.1|  ubiquitin                                          318   1e-105   
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      318   1e-105   Citrus sinensis [apfelsine]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             318   1e-105   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         318   1e-105   Jatropha curcas
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    318   1e-105   Linum usitatissimum
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             318   1e-105   
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             318   1e-105   
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      321   1e-105   Nelumbo nucifera [Indian lotus]
emb|CBY46746.1|  polyubiquitin 10 protein                               321   1e-105   Lepidium campestre [bastard cress]
gb|AFW66439.1|  putative ubiquitin family protein                       318   1e-105   
emb|CDP08569.1|  unnamed protein product                                318   1e-105   Coffea canephora [robusta coffee]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             318   1e-105   
gb|AAF04147.1|  ubiquitin precursor                                     321   1e-105   Hevea brasiliensis [jebe]
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      318   1e-105   
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                321   1e-105   
gb|AAB68045.1|  polyubiquitin                                           321   1e-105   Fragaria x ananassa
ref|XP_001830230.1|  ubiquitin                                          318   1e-105   Coprinopsis cinerea okayama7#130
gb|AAB36545.1|  ubiquitin-like protein                                  322   1e-105   Phaseolus vulgaris [French bean]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     321   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           318   1e-105   Fragaria vesca subsp. vesca
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    318   1e-105   Phoenix dactylifera
emb|CDP05795.1|  unnamed protein product                                320   1e-105   Coffea canephora [robusta coffee]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      318   1e-105   Glycine max [soybeans]
ref|NP_849300.4|  polyubiquitin 10                                      320   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AAB95250.1|  ubiquitin                                               318   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         318   1e-105   Jatropha curcas
ref|XP_003082269.1|  polyubiquitin (ISS)                                317   1e-105   
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             318   1e-105   Citrus clementina [clementine]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    320   1e-105   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      320   1e-105   Nicotiana sylvestris
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                321   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      320   1e-105   Nicotiana tomentosiformis
gb|KJB13592.1|  hypothetical protein B456_002G083000                    320   1e-105   Gossypium raimondii
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      319   1e-105   Brachypodium distachyon [annual false brome]
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  315   1e-105   Pisolithus microcarpus 441
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        320   2e-105   
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         318   2e-105   
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   319   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           317   2e-105   Elaeis guineensis
gb|AFW66438.1|  putative ubiquitin family protein                       319   2e-105   
gb|KDB11907.1|  ubiquitin                                               317   2e-105   Ustilaginoidea virens
gb|AEW46688.1|  polyubiquitin                                           314   2e-105   Ulva linza
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             314   2e-105   Selaginella moellendorffii
gb|EWZ40370.1|  ubiquitin C                                             314   2e-105   Fusarium oxysporum Fo47
prf||1101405A  ubiquitin precursor                                      313   3e-105
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                317   3e-105   Serpula lacrymans var. lacrymans S7.3
emb|CDP08567.1|  unnamed protein product                                319   3e-105   Coffea canephora [robusta coffee]
gb|KJB62485.1|  hypothetical protein B456_009G418900                    317   3e-105   Gossypium raimondii
emb|CAA54603.1|  pentameric polyubiquitin                               318   3e-105   Nicotiana tabacum [American tobacco]
dbj|BAL61087.1|  polyubiquitin                                          314   3e-105   Dianthus caryophyllus [carnation]
ref|XP_001783045.1|  predicted protein                                  314   3e-105   
emb|CEF99839.1|  Ubiquitin conserved site                               318   3e-105   Ostreococcus tauri
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   317   3e-105   Amanita muscaria Koide BX008
gb|KEH31155.1|  polyubiquitin 3                                         319   3e-105   Medicago truncatula
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     314   3e-105   Rhodotorula toruloides
ref|NP_001148453.1|  LOC100282068                                       319   3e-105   Zea mays [maize]
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            317   3e-105   Phaseolus vulgaris [French bean]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                318   4e-105   
gb|KJB14874.1|  hypothetical protein B456_002G147600                    318   4e-105   Gossypium raimondii
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      317   4e-105   Populus euphratica
ref|XP_006372519.1|  polyubiquitin family protein                       317   4e-105   Populus trichocarpa [western balsam poplar]
gb|EGA57707.1|  Ubi4p                                                   314   4e-105   Saccharomyces cerevisiae FostersB
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             317   4e-105   Capsella rubella
emb|CCL99875.1|  predicted protein                                      317   4e-105   Fibroporia radiculosa
gb|AAO43309.1|  putative polyubiquitin                                  314   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  313   4e-105   Naumovozyma dairenensis CBS 421
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    313   5e-105   Candida albicans
gb|AHC00631.1|  polyubiquitin                                           317   5e-105   Ganoderma lucidum
gb|ADD52202.1|  ubiquitin                                               319   6e-105   Catharanthus roseus [chatas]
emb|CEP60563.1|  LALA0S01e13784g1_1                                     313   6e-105   Lachancea lanzarotensis
gb|AIY27743.1|  polyubiquitin Ubi10                                     317   6e-105   Betula luminifera [liang ye hua]
emb|CCT70325.1|  UBI4-Ubiquitin                                         315   6e-105   Fusarium fujikuroi IMI 58289
ref|XP_006381473.1|  polyubiquitin family protein                       316   6e-105   
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   316   6e-105   Sphaerobolus stellatus SS14
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              313   6e-105   Pseudocercospora fijiensis CIRAD86
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             320   6e-105   Phaseolus vulgaris [French bean]
gb|KIR29996.1|  polyubiquitin                                           316   7e-105   Cryptococcus gattii VGII LA55
gb|EKV18932.1|  hypothetical protein PDIP_25190                         313   7e-105   Penicillium digitatum Pd1
gb|KJB81824.1|  hypothetical protein B456_013G163500                    319   7e-105   Gossypium raimondii
gb|KFX48439.1|  Polyubiquitin                                           313   7e-105   Talaromyces marneffei PM1
ref|XP_001555417.1|  polyubiquitin                                      316   7e-105   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             316   7e-105   Exserohilum turcica Et28A
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    316   7e-105   Populus euphratica
gb|KIY45417.1|  ubiquitin                                               316   7e-105   Fistulina hepatica ATCC 64428
ref|XP_007763327.1|  polyubiquitin                                      316   7e-105   Coniophora puteana RWD-64-598 SS2
ref|XP_001931824.1|  ubiquitin                                          313   7e-105   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           320   7e-105   Eucalyptus grandis [rose gum]
gb|KIR63773.1|  polyubiquitin                                           316   7e-105   Cryptococcus gattii CA1873
gb|EPX74297.1|  ubiquitin                                               313   7e-105   Schizosaccharomyces octosporus yFS286
ref|XP_002419618.1|  ubiquitin, putative                                316   7e-105   Candida dubliniensis CD36
ref|XP_003030030.1|  polyubiquitin                                      316   7e-105   Schizophyllum commune H4-8
ref|XP_001828882.1|  ubiquitin C                                        316   8e-105   Coprinopsis cinerea okayama7#130
gb|ADP05114.1|  polyubiquitin 10                                        313   8e-105   Aponogeton madagascariensis [laceleaf]
ref|XP_002508175.1|  ubiquitin                                          318   8e-105   Micromonas commoda
gb|KIY53974.1|  polyubiquitin                                           316   8e-105   Fistulina hepatica ATCC 64428
ref|XP_001598085.1|  polyubiquitin                                      316   8e-105   Sclerotinia sclerotiorum 1980 UF-70
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  316   8e-105   Botryobasidium botryosum FD-172 SS1
ref|XP_002872109.1|  predicted protein                                  318   8e-105   
ref|NP_001105376.1|  polyubiquitin                                      318   8e-105   
ref|NP_001174480.1|  Os05g0504766                                       318   8e-105   
gb|AGV54228.1|  polyubiquitin-like protein                              318   8e-105   Phaseolus vulgaris [French bean]
gb|EFN76024.1|  Ubiquitin                                               313   8e-105   Harpegnathos saltator
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    313   9e-105   Parastagonospora nodorum SN15
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                318   9e-105   
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 316   9e-105   Scleroderma citrinum Foug A
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                318   9e-105   Erythranthe guttata [common monkey flower]
gb|ACS68205.1|  ubiquitin 10.2                                          318   9e-105   Brassica napus [oilseed rape]
gb|AAB95252.1|  ubiquitin                                               318   9e-105   Arabidopsis thaliana [mouse-ear cress]
gb|ABU40645.1|  polyubiquitin                                           318   9e-105   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      318   9e-105   Nelumbo nucifera [Indian lotus]
ref|XP_007864655.1|  ubiquitin                                          318   9e-105   Gloeophyllum trabeum ATCC 11539
ref|XP_001420612.1|  predicted protein                                  318   9e-105   Ostreococcus lucimarinus CCE9901
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      318   9e-105   Tarenaya hassleriana [spider flower]
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    318   9e-105   Camelina sativa [gold-of-pleasure]
ref|NP_568397.1|  ubiquitin 4                                           318   9e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             318   9e-105   
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      318   1e-104   Nicotiana tomentosiformis
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                321   1e-104   
ref|XP_007366816.1|  polyubiquitin                                      315   1e-104   Dichomitus squalens LYAD-421 SS1
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             318   1e-104   
gb|KJB62483.1|  hypothetical protein B456_009G418900                    318   1e-104   Gossypium raimondii
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         318   1e-104   Elaeis guineensis
ref|XP_005644220.1|  polyubiquitin                                      315   1e-104   Coccomyxa subellipsoidea C-169
gb|AAQ07453.1|  ubiquitin                                               318   1e-104   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             318   1e-104   Eutrema salsugineum [saltwater cress]
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    321   1e-104   Cucumis melo [Oriental melon]
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   321   1e-104   
gb|AAX40652.1|  polyubiquitin                                           318   1e-104   Oryza sativa Japonica Group [Japonica rice]
gb|AAY86773.1|  polyubiquitin                                           318   1e-104   Noccaea caerulescens
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                318   1e-104   Erythranthe guttata [common monkey flower]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    318   1e-104   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             318   1e-104   Capsella rubella
ref|NP_849299.4|  polyubiquitin 10                                      320   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    320   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         318   1e-104   Nicotiana tomentosiformis
emb|CAA25706.1|  unnamed protein product                                311   1e-104   Saccharomyces cerevisiae [brewer's yeast]
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    318   1e-104   Oryza sativa Japonica Group [Japonica rice]
gb|KJB62486.1|  hypothetical protein B456_009G418900                    318   1e-104   Gossypium raimondii
gb|KJB81827.1|  hypothetical protein B456_013G163500                    320   1e-104   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           320   1e-104   Nicotiana sylvestris
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         318   1e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002953480.1|  polyubiquitin                                      315   1e-104   Volvox carteri f. nagariensis
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  317   1e-104   Plicaturopsis crispa FD-325 SS-3
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    318   1e-104   Setaria italica
gb|KJB62482.1|  hypothetical protein B456_009G418900                    318   1e-104   Gossypium raimondii
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      318   1e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    318   1e-104   Camelina sativa [gold-of-pleasure]
emb|CAB81074.1|  polyubiquitin (ubq10)                                  320   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001053957.1|  Os04g0628100                                       318   1e-104   
gb|KJB13590.1|  hypothetical protein B456_002G083000                    320   1e-104   Gossypium raimondii
gb|EMS65864.1|  Polyubiquitin                                           318   2e-104   Triticum urartu
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                320   2e-104   Prunus mume [ume]
gb|AAZ42330.1|  ubiquitin protein 1                                     310   2e-104   Caenorhabditis remanei
dbj|GAK65396.1|  ubiquitin                                              316   2e-104   Moesziomyces antarcticus
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             318   2e-104   
emb|CCA70326.1|  related to UBI4-Ubiquitin                              311   2e-104   Serendipita indica DSM 11827
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      319   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    320   2e-104   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  312   2e-104   Trichophyton benhamiae CBS 112371
gb|EZF98642.1|  polyubiquitin                                           312   2e-104   Trichophyton rubrum MR1459
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   312   2e-104   Serendipita vermifera MAFF 305830
ref|XP_003052575.1|  predicted protein                                  315   2e-104   [Nectria] haematococca mpVI 77-13-4
emb|CCG34086.1|  Polyubiquitin                                          315   2e-104   uncultured eukaryote
gb|AFP44113.1|  ubiquitin                                               310   2e-104   Lycoris longituba
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          320   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   311   2e-104   Serendipita vermifera MAFF 305830
ref|XP_001764949.1|  predicted protein                                  315   2e-104   
ref|XP_001755431.1|  predicted protein                                  312   2e-104   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             315   3e-104   
emb|CAI83757.1|  Polyubiqutin 4                                         310   3e-104   Polyplastron multivesiculatum
gb|AAL91103.1|  ubiquitin                                               313   3e-104   
ref|XP_002551324.1|  ubiquitin                                          314   3e-104   
gb|EJW80596.1|  polyubiquitin                                           310   3e-104   
dbj|GAA27344.2|  polyubiquitin-A                                        313   3e-104   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      317   3e-104   
ref|XP_001755307.1|  predicted protein                                  314   3e-104   
gb|AAO43305.1|  putative polyubiquitin                                  315   4e-104   
gb|AAO43306.1|  putative polyubiquitin                                  315   4e-104   
ref|XP_002891806.1|  predicted protein                                  317   4e-104   
ref|XP_001777816.1|  predicted protein                                  317   4e-104   
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             311   4e-104   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                316   5e-104   
ref|XP_007049060.1|  Polyubiquitin 10                                   319   5e-104   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    311   5e-104   
ref|XP_006407638.1|  hypothetical protein EUTSA_v10022008mg             311   5e-104   
gb|KIW56414.1|  polyubiquitin                                           314   5e-104   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             315   5e-104   
dbj|BAP70433.1|  Ubiquitin                                              314   5e-104   
dbj|BAK61744.1|  ubiquitin                                              311   5e-104   
ref|XP_002839703.1|  hypothetical protein                               313   6e-104   
dbj|BAK61751.1|  ubiquitin                                              311   6e-104   
gb|AAV65292.1|  polyubiquitin                                           313   6e-104   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            312   6e-104   
gb|ACX46987.1|  ubiquitin                                               318   6e-104   
ref|XP_001227036.1|  polyubiquitin                                      313   6e-104   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     313   6e-104   
ref|XP_001210780.1|  ubiquitin                                          313   6e-104   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         311   6e-104   
ref|XP_010756991.1|  polyubiquitin                                      314   6e-104   
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    319   6e-104   
gb|KEZ40313.1|  Polyubiquitin                                           313   6e-104   
ref|XP_751791.1|  polyubiquitin UbiD/Ubi4                               314   6e-104   
ref|XP_001880135.1|  ubiquitin                                          316   6e-104   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         313   6e-104   
gb|KHJ77263.1|  ubiquitin family protein                                309   7e-104   
ref|XP_002494205.1|  Ubiquitin                                          313   7e-104   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          311   7e-104   
gb|EUC59758.1|  polyubiquitin                                           316   7e-104   
gb|EEH07231.1|  ubiquitin                                               313   7e-104   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           318   7e-104   
gb|EMS60894.1|  Polyubiquitin                                           318   7e-104   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    316   7e-104   
gb|AFR98116.1|  polyubiquitin                                           316   7e-104   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             316   7e-104   
gb|EEH20847.2|  polyubiquitin                                           314   7e-104   
dbj|BAK03691.1|  predicted protein                                      318   7e-104   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  316   7e-104   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  316   7e-104   
gb|EJU00136.1|  ubiquitin                                               316   7e-104   
ref|XP_003196661.1|  ATP-dependent protein binding protein              316   7e-104   
emb|CAA40324.1|  hexaubiquitin protein                                  318   7e-104   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             316   8e-104   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 316   8e-104   
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         318   8e-104   
gb|AAB95251.1|  ubiquitin                                               318   8e-104   
ref|NP_001045980.1|  Os02g0161900                                       318   8e-104   
dbj|GAA55031.1|  ubiquitin C                                            310   8e-104   
gb|AAA82978.1|  polyubiquitin                                           316   8e-104   
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                318   8e-104   
gb|AAD03343.1|  ubiquitin                                               318   8e-104   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    316   8e-104   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  313   8e-104   
ref|XP_002888365.1|  polyubiquitin                                      318   9e-104   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      318   9e-104   
gb|AAY33920.2|  polyubiquitin                                           316   9e-104   
gb|EEQ88150.1|  ubiquitin                                               313   9e-104   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          321   9e-104   
dbj|BAJ91912.1|  predicted protein                                      318   9e-104   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           321   9e-104   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  316   9e-104   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        310   9e-104   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  316   9e-104   
gb|KIY97628.1|  ubiquitin C                                             313   9e-104   
dbj|BAK02501.1|  predicted protein                                      318   9e-104   
ref|XP_004341200.1|  polyubiquitin, putative                            310   9e-104   
ref|XP_003627151.1|  Ubiquitin                                          321   9e-104   
ref|XP_659604.1|  hypothetical protein AN2000.2                         313   9e-104   
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           318   9e-104   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         313   9e-104   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     310   1e-103   
ref|XP_003608276.1|  Ubiquitin                                          321   1e-103   
gb|ETN78467.1|  ubiquitin family protein                                310   1e-103   
gb|KDR10312.1|  Ubiquitin                                               310   1e-103   
sp|P62972.2|UBIQP_XENLA  RecName: Full=Polyubiquitin; Contains: R...    308   1e-103   
gb|AIS40894.1|  polyubiquitin                                           318   1e-103   
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          318   1e-103   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             318   1e-103   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          310   1e-103   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      318   1e-103   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             318   1e-103   
emb|CAA52290.1|  polyubiquitin                                          315   1e-103   
gb|ABD32351.2|  Ubiquitin                                               321   1e-103   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           318   1e-103   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           318   1e-103   
ref|XP_002791169.1|  ubiquitin                                          313   1e-103   
ref|XP_009983603.1|  PREDICTED: polyubiquitin isoform X14               308   1e-103   
gb|AAO43310.1|  putative polyubiquitin                                  311   1e-103   
tpd|FAA00317.1|  TPA: polyubiquitin                                     313   1e-103   
ref|XP_008816966.1|  polyubiquitin                                      313   1e-103   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         314   1e-103   
gb|ACN40936.1|  unknown                                                 318   1e-103   
emb|CAI83758.1|  Polyubiqutin 5                                         310   1e-103   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           318   1e-103   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      313   1e-103   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      318   1e-103   
gb|AAC16012.1|  polyubiquitin                                           318   1e-103   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    313   1e-103   
gb|AAA30720.1|  polyubiquitin                                           307   1e-103   
gb|ABF66639.1|  ubiquitin                                               313   1e-103   
ref|XP_007808982.1|  ubiquitin                                          314   1e-103   
gb|AGT38457.1|  polyubiquitin                                           318   2e-103   
ref|XP_002888394.1|  hexaubiquitin protein                              318   2e-103   
emb|CCO30833.1|  Polyubiquitin                                          316   2e-103   
ref|XP_009099257.1|  PREDICTED: polyubiquitin                           308   2e-103   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  312   2e-103   
gb|AFW70219.1|  polyubiquitin-like protein                              319   2e-103   
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         310   2e-103   
ref|XP_004946726.1|  PREDICTED: polyubiquitin-C-like isoform X8         310   2e-103   
gb|EWS74283.1|  polyubiquitin                                           309   2e-103   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    310   2e-103   
ref|XP_002171731.1|  ubiquitin                                          315   2e-103   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    318   2e-103   
ref|XP_005831810.1|  ubiquitin                                          309   2e-103   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    314   2e-103   
gb|ADD24466.1|  Ubiquitin                                               309   2e-103   
ref|XP_004365491.1|  polyubiquitin 5                                    309   2e-103   
ref|XP_001538486.1|  polyubiquitin                                      312   2e-103   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      317   2e-103   
ref|XP_001246797.1|  polyubiquitin                                      312   2e-103   
dbj|GAA87419.1|  polyubiquitin                                          312   3e-103   
gb|AFK47245.1|  unknown                                                 309   3e-103   
ref|XP_003607670.1|  Ubiquitin                                          320   3e-103   
gb|AAA31133.1|  poly-ubiquitin precursor                                310   3e-103   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             315   3e-103   
gb|AAL91109.1|  ubiquitin                                               312   3e-103   
gb|KFP50091.1|  Polyubiquitin-B                                         307   3e-103   
ref|XP_002842034.1|  hypothetical protein                               312   3e-103   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             315   3e-103   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              310   3e-103   
sp|P23324.2|UBIQP_EUPEU  RecName: Full=Polyubiquitin; Contains: R...    309   3e-103   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                319   3e-103   
dbj|BAL61084.1|  polyubiqutin                                           314   3e-103   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              310   3e-103   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              309   4e-103   
gb|AAV84266.1|  ubiquitin                                               307   4e-103   
gb|AAO43304.1|  putative polyubiquitin                                  312   4e-103   
gb|KFP74355.1|  Polyubiquitin                                           307   4e-103   
gb|EIE87024.1|  polyubiquitin                                           308   4e-103   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             310   5e-103   
ref|XP_008034069.1|  ubiquitin 10.1                                     317   5e-103   
ref|XP_958803.1|  ubiquitin                                             311   5e-103   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 310   5e-103   
ref|XP_667472.1|  ubiquitin B                                           308   5e-103   
gb|EJD76734.1|  polyubiquitin, variant 2                                312   5e-103   
gb|AAC67552.1|  polyubiquitin                                           314   5e-103   
ref|XP_002553736.1|  KLTH0E05852p                                       315   5e-103   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       309   5e-103   
ref|XP_005439794.1|  PREDICTED: polyubiquitin-B isoform X3              308   5e-103   
gb|ABV22331.1|  ubiquitin                                               311   5e-103   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         308   6e-103   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    319   6e-103   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              308   6e-103   
ref|XP_005620146.1|  PREDICTED: polyubiquitin-B isoform X1              308   6e-103   
emb|CAX72421.1|  ubiquitin C                                            308   6e-103   
ref|NP_564675.1|  ubiquitin-like                                        308   6e-103   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         308   6e-103   
ref|XP_011275993.1|  ubiquitin C                                        314   6e-103   
emb|CDI53149.1|  probable Polyubiquitin protein                         311   6e-103   
ref|XP_007307433.1|  polyubiquitin                                      316   6e-103   
ref|XP_010876509.1|  PREDICTED: polyubiquitin-B                         308   6e-103   
ref|NP_983342.1|  ACL062Cp                                              313   6e-103   
tpd|FAA00316.1|  TPA: polyubiquitin                                     313   6e-103   
tpd|FAA00319.1|  TPA: polyubiquitin                                     316   6e-103   
ref|XP_002099886.1|  GE16472                                            308   6e-103   
gb|ELR08709.1|  polyubiquitin                                           313   6e-103   
ref|XP_010298600.1|  PREDICTED: polyubiquitin-B isoform X2              308   6e-103   
ref|NP_001133175.1|  polyubiquitin                                      308   6e-103   
ref|XP_453980.1|  hypothetical protein                                  313   6e-103   
ref|NP_001190681.1|  ubiquitin 11                                       305   6e-103   
ref|XP_005620147.1|  PREDICTED: polyubiquitin-B isoform X2              308   6e-103   
ref|XP_004911740.1|  PREDICTED: polyubiquitin-C isoform X4              308   6e-103   
dbj|BAO38900.1|  ubiquitin                                              313   6e-103   
ref|NP_595409.1|  ubiquitin                                             313   6e-103   
gb|AAA28997.1|  ubiquitin                                               308   6e-103   
gb|AAC84175.1|  ubiquitin                                               308   6e-103   
dbj|BAE40351.1|  unnamed protein product                                310   7e-103   
ref|NP_013061.1|  ubiquitin                                             313   7e-103   
ref|XP_007861169.1|  polyubiquitin                                      316   7e-103   
gb|ABY55758.1|  ubiquitin                                               308   7e-103   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          308   7e-103   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    318   7e-103   
ref|NP_061828.1|  polyubiquitin-B precursor                             308   7e-103   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                318   7e-103   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      321   7e-103   
ref|XP_001610925.1|  polyubiquitin                                      308   7e-103   
ref|XP_010298601.1|  PREDICTED: polyubiquitin-B isoform X3              308   7e-103   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           318   7e-103   
gb|AFW66445.1|  ubiquitin2                                              318   7e-103   
ref|XP_567862.1|  ATP-dependent protein binding protein                 316   7e-103   
gb|AEH41483.1|  ubiquitin                                               311   7e-103   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         321   7e-103   
gb|EKC42613.1|  Ubiquitin                                               308   7e-103   
ref|XP_011388891.1|  putative ubiquitin                                 316   7e-103   
gb|KHN45015.1|  Polyubiquitin-A                                         321   7e-103   
ref|XP_003290908.1|  ubiquitin                                          308   8e-103   
ref|XP_010072703.1|  PREDICTED: polyubiquitin-B isoform X1              308   8e-103   
ref|XP_004276694.1|  PREDICTED: polyubiquitin-B-like                    308   8e-103   
ref|XP_008924878.1|  PREDICTED: polyubiquitin isoform X5                309   8e-103   
gb|AAX43350.1|  ubiquitin B                                             308   8e-103   
gb|KFP25549.1|  Polyubiquitin-B                                         308   8e-103   
emb|CAA51679.1|  ubiquitin                                              318   8e-103   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  313   8e-103   
gb|KFY77115.1|  hypothetical protein V499_03430                         313   8e-103   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           318   8e-103   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       313   8e-103   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      318   8e-103   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           318   8e-103   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              308   8e-103   
ref|XP_001766873.1|  predicted protein                                  312   8e-103   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   316   8e-103   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      318   8e-103   



>gb|AHI85710.1| stress-induced protein 5, partial [Capsicum annuum]
Length=169

 Score =   320 bits (821),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  9    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  68

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  69   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  128

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  129  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  169


 Score =   184 bits (467),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/93 (99%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +2

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  60

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  93



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   320 bits (821),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  59   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  118

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  119  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  178

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  179  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  219


 Score =   283 bits (725),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +2

Query  56   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  235
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  236  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  415
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  416  TLADYNIQKESTLHLVLRLRGGF  484
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   321 bits (822),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   320 bits (821),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   320 bits (819),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  44   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  103

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  104  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  163

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  164  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  204


 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/128 (99%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = +2

Query  101  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  280
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  281  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  460
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  461  VLRLRGGF  484
            VLRLRGG 
Sbjct  121  VLRLRGGM  128



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   320 bits (820),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  180

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  181  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  221


 Score =   287 bits (734),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +2

Query  50   TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  229
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  230  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  409
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  410  GRTLADYNIQKESTLHLVLRLRGGF  484
            GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGM  145



>gb|ACZ69386.1| polyubiquitin UBQ14 [Cucumis sativus]
Length=197

 Score =   319 bits (818),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  37   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  96

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  97   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  156

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  157  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  197


 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  122  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  301
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  1    KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  60

Query  302  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  61   VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  120

Query  482  F  484
             
Sbjct  121  M  121



>gb|AAZ32851.1| pentameric polyubiquitin [Medicago sativa]
Length=189

 Score =   318 bits (816),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  15   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  74

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  75   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  134

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  135  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  175


 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/99 (99%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +2

Query  188  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  367
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  368  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99


 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/99 (100%), Positives = 99/99 (100%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  91   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  150

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  298
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  151  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  189



>sp|P0CG83.1|UBIQP_HORVU RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Hordeum vulgare]
 emb|CAA27751.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   318 bits (814),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  11   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  70

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  71   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  130

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  131  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  170


 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  200  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  379
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  380  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  95



>ref|XP_007693173.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
 gb|EUC40302.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
Length=175

 Score =   318 bits (815),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  15   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  74

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  75   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  134

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  135  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  174


 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/99 (99%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +2

Query  188  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  367
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  368  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   319 bits (818),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  24   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  83

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  84   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  143

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  184


 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  100  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  159

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  346
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI+
Sbjct  160  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIR  214


 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/108 (99%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +2

Query  161  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  340
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  341  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  108



>gb|AFJ04519.1| ubiquitin, partial [Vernicia fordii]
Length=176

 Score =   318 bits (814),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  16   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  75

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  76   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  135

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  136  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  175


 Score =   199 bits (507),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +2

Query  185  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  364
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  1    RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  60

Query  365  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  100



>pir||PS0380 ubiquitin precursor - rice (fragment)
 dbj|BAA02241.1| poly-ubiquitin [Oryza sativa Japonica Group]
Length=189

 Score =   318 bits (815),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  29   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  88

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  89   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  148

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  149  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  189


 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  146  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  325
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  326  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  113



>gb|ABR25718.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=178

 Score =   318 bits (814),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  18   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  77

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  78   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  137

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  138  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  177


 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  358
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  1    DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  60

Query  359  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  102



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   319 bits (818),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  229


 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   322 bits (825),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   306 bits (785),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 118/118 (100%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  355
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   321 bits (822),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  117  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  176

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  177  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  236

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  237  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277


 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   319 bits (818),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  505
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   318 bits (816),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  63   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  122

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  123  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  182

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  183  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  222


 Score =   278 bits (710),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  65   TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  244
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  245  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  424
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  425  DYNIQKESTLHLVLRLRGGF  484
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   320 bits (819),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (779),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  340
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   319 bits (817),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  58   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  117

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  118  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  177

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  178  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  218


 Score =   281 bits (719),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  238
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  239  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  418
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  419  LADYNIQKESTLHLVLRLRGGF  484
            LADYNIQKESTLHLVLRLRGG 
Sbjct  121  LADYNIQKESTLHLVLRLRGGM  142


 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/111 (99%), Positives = 111/111 (100%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  134  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  193

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  334
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  194  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   320 bits (820),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  109  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  168

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  169  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  228

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  229  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269


 Score =   302 bits (773),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  100

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  101  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  193



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   318 bits (816),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   318 bits (814),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  55   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  114

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  115  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  174

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  175  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  214


 Score =   276 bits (707),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  68   LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  247
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  248  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  427
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  428  YNIQKESTLHLVLRLRGGF  484
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   318 bits (814),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  55   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  114

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  115  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  174

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  175  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  215


 Score =   276 bits (706),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  68   LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  247
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  248  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  427
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  428  YNIQKESTLHLVLRLRGGF  484
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   320 bits (819),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  93   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  152

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  153  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  212

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  505
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  213  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   305 bits (781),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  8    LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  187
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  188  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  367
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  79   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138

Query  368  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  177



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   318 bits (815),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   318 bits (815),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   318 bits (814),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  59   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  118

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  119  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  178

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  179  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  218


 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +2

Query  56   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  235
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  236  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  415
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  416  TLADYNIQKESTLHLVLRLRGGF  484
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   318 bits (815),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (775),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   318 bits (815),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (769),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   318 bits (815),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGM  256
            GRTLADYNIQKESTLHLVLRLRGG+
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGV  229



>gb|ACT82769.1| polyubiquitin [Nicotiana tabacum]
Length=188

 Score =   317 bits (811),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  15   LVLRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  74

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  75   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  134

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  135  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  175


 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  91   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  150

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  295
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  151  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  188


 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  188  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  367
            TL DYNIQKESTLHLVLRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLPDYNIQKESTLHLVLRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  368  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   318 bits (815),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (773),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   318 bits (815),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   318 bits (814),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   318 bits (815),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   318 bits (815),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   319 bits (818),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (778),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  328
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   318 bits (814),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   318 bits (814),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   318 bits (814),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   319 bits (818),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  110  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  169

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  170  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  229

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  230  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  34   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  93

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  94   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  153

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  154  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   236 bits (603),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  310
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  311  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   321 bits (822),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   318 bits (814),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/88 (97%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIF  265
            GRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGLTGF  232



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  136  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  195

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  196  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  255

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  256  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  60   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  119

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  120  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  179

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  53   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  232
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  233  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  412
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  413  RTLADYNIQKESTLHLVLRLRGGF  484
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  114  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  173

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  174  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  233

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  234  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  38   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  97

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  98   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  157

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  158  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  198


 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  119  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  298
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  299  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  478
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  479  GF  484
            G 
Sbjct  121  GM  122



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   315 bits (806),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
             RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  ERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLED RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGM  153



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  89   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  148

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  149  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  208

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  209  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   308 bits (788),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +2

Query  11   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  190
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  191  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  370
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  371  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  136  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   228 bits (582),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  165  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  224

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  352
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  225  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAR32784.1| polyubiquitin [Clusia minor]
Length=223

 Score =   317 bits (813),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  21   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  80

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  81   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  140

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  181


 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  349
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  60

Query  350  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  105


 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  97   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  156

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL-EVESSDTIDNVKAKIQDKEG  358
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK      V +   +  VKAKIQDKEG
Sbjct  157  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKDHHFWXVRTPIPLIMVKAKIQDKEG  216

Query  359  IP  364
            IP
Sbjct  217  IP  218



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   317 bits (813),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  148  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  207

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  208  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  267

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  268  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  72   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  131

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  132  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  191

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  192  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  232


 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  17   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  196
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  197  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  376
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  377  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  156



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   318 bits (815),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  13   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  72

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  73   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  132

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  133  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  89   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  148

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  149  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  208

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  209  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/97 (99%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  373
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  374  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>gb|ABR25697.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=201

 Score =   316 bits (810),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  41   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  100

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  101  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  160

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  161  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  200


 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  110  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  289
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  1    KIQDKEGIPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  60

Query  290  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  469
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
Sbjct  61   ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  120

Query  470  LRGGF  484
            LRGG 
Sbjct  121  LRGGM  125



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   317 bits (813),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   317 bits (813),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   317 bits (811),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   318 bits (814),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  104  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  163

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  164  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  223

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  224  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   315 bits (808),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  28   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  87

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  88   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  147

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  188


 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +2

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  112



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   318 bits (815),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  105  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  164

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  165  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  224

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  225  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   317 bits (813),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  29   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  88

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  89   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  148

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  149  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  189


 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  146  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  325
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  326  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  113



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   305 bits (780),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   319 bits (818),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  305


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   318 bits (815),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  301
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   295 bits (755),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKES  448
            PPDQQRLIFAGKQLEDGRTLADYNIQKE+
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKEN  293



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   319 bits (817),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  96   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  155

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  156  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  215

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  256


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  87

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  88   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  147

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  180


 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/120 (99%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  172  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  231

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  232  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   318 bits (814),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 126/161 (78%), Gaps = 35/161 (22%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT                      
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT----------------------  242

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
                         LEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  243  -------------LEDGRTLADYNIQKESTLHLVLRLRGGF  270



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   317 bits (812),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  50   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  109

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  110  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  169

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  170  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  210


 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  262
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  263  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  442
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  443  ESTLHLVLRLRGGF  484
            ESTLHLVLRLRGG 
Sbjct  121  ESTLHLVLRLRGGM  134


 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  126  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  185

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  340
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  186  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   316 bits (810),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTL LVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   318 bits (815),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  4    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  63

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  64   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  123

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  124  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164


 Score =   318 bits (815),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  80   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  139

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  140  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  199

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  240


 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%), Gaps = 0/126 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  156  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  215

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  216  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  275

Query  362  PPDQQR  379
            PPDQQR
Sbjct  276  PPDQQR  281


 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/88 (99%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +2

Query  221  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  400
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  401  LEDGRTLADYNIQKESTLHLVLRLRGGF  484
            LEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGM  88



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   316 bits (810),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   316 bits (810),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   316 bits (810),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            P DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  189  PLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   317 bits (813),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/125 (99%), Positives = 125/125 (100%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQ  376
            PPDQQ
Sbjct  265  PPDQQ  269



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   316 bits (809),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   316 bits (809),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   302 bits (773),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   316 bits (809),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE I
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   316 bits (809),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   298 bits (763),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   316 bits (809),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   316 bits (809),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   318 bits (816),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (810),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  478
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303


 Score =   303 bits (777),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   315 bits (808),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  58   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  117

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  118  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  177

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  178  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  238
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  239  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  418
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  419  LADYNIQKESTLHLVLRLRGGF  484
            L+DYNIQKESTLHLVLRLRGG 
Sbjct  121  LSDYNIQKESTLHLVLRLRGGM  142



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   318 bits (814),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  60   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  119

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  120  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  179

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 152/160 (95%), Gaps = 8/160 (5%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  136  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  195

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGI
Sbjct  196  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGI  247

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  248  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  287


 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  53   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  232
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  233  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  412
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  413  RTLADYNIQKESTLHLVLRLRGGF  484
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   321 bits (823),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  217  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  276

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  277  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  336

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  337  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377


 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  65   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  124

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  125  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  184

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  185  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  225


 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  141  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  200

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  201  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  260

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  261  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  301


 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +2

Query  38   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  217
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  218  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  397
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  398  QLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   168 bits (425),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGM  256
            GRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGV  229



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   318 bits (816),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   318 bits (816),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   315 bits (808),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   318 bits (816),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   319 bits (818),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   319 bits (818),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   304 bits (779),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  343
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   318 bits (816),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   320 bits (820),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  120  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  179

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  180  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  239

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  240  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  280


 Score =   320 bits (820),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  196  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  255

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  256  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  315

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  316  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 152/204 (75%), Gaps = 51/204 (25%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  130
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  131  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  232
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  233  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  412
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  413  RTLADYNIQKESTLHLVLRLRGGF  484
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGM  204



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   318 bits (815),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   318 bits (815),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   318 bits (815),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   316 bits (810),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  13   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  72

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE I
Sbjct  73   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWI  132

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  133  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLED
Sbjct  89   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLED  148

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  149  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  208

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  209  PPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/97 (99%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  373
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  374  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>prf||1604470A poly-ubiquitin
Length=272

 Score =   317 bits (812),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  36   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  95

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  96   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  155

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  156  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  196


 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  112  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  171

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  172  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  231

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  232  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +2

Query  128  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  307
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  308  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  120



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   317 bits (813),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   315 bits (808),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGM  256
            GRTLADYNIQKESTLHLVLRLRGG+
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGV  305



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   318 bits (816),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/88 (99%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIF  265
            GRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIL  308



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  110  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  169

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  170  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  229

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  230  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   317 bits (811),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  34   LVLRLRGGMQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  93

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  94   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  153

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  154  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   236 bits (603),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  310
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  311  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118


 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  186  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  245

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  246  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/161 (94%), Positives = 153/161 (95%), Gaps = 8/161 (5%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGI  256

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  297



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAF04147.1| ubiquitin precursor [Hevea brasiliensis]
Length=381

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/161 (95%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  L  
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGSSLRM  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
               LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  VAPLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL VESSDTIDNVKAKIQDKEGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (758),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/161 (94%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITL VESSDTIDNVKAKIQDKEGIPPDQQR IFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAG  L     LADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGSSLRMVAPLADYNIQKESTLHLVLRLRGGM  229



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  151  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  210

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  211  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  270

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  17   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  196
            R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  80   RSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  139

Query  197  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  376
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  140  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  199

Query  377  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  200  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  235


 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA---  196
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  197  ---DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  367
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  368  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  159



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            P DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   316 bits (809),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   313 bits (803),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  247  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  306

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  307  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  366

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  367  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  95   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  154

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  155  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  214

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  215  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  255


 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  171  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  230

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  231  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  290

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  291  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  331


 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = +2

Query  71   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  250
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  251  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  430
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  431  NIQKESTLHLVLRLRGGF  484
            NIQKESTLHLVLRLRGG 
Sbjct  162  NIQKESTLHLVLRLRGGM  179



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGM  153



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   317 bits (811),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   316 bits (810),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGM  153



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  45   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  104

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  105  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  164

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  165  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  205


 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/137 (100%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  121  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  180

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  181  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  240

Query  362  PPDQQRLIFAGKQLEDG  412
            PPDQQRLIFAGKQLEDG
Sbjct  241  PPDQQRLIFAGKQLEDG  257


 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  125  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  304
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  305  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  241  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  300

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  301  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  360

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  361  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401


 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  89   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  148

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  149  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  208

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  209  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  165  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  224

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  225  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  284

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  285  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  325


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  23   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  202
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  20   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  79

Query  203  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  382
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  80   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  383  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            G TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGI
Sbjct  129  GCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/87 (97%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQI  262
            GRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGFRM  383



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  105  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  164

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  165  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  224

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  225  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  265


 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  181  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  240

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  241  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  300

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  189



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   315 bits (808),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  87   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  146

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  147  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  206

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  207  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   315 bits (808),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  11   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  70

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  71   GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  130

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  131  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  171


 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  200  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  379
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  380  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  95



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  21   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  80

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  81   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  140

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  181


 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  97   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  156

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  157  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  216

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  217  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  257


 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  173  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  232

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  233  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  292

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  293  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +2

Query  209  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  388
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  389  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  105



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  190  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  249

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  250  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  309

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  310  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 160/206 (78%), Gaps = 45/206 (22%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYN---------------------------------------------IQKESTL  226
            GRTLADYN                                             IQKESTL
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTL  188

Query  227  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  406
            HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  189  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  248

Query  407  DGRTLADYNIQKESTLHLVLRLRGGF  484
            DGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  249  DGRTLADYNIQKESTLHLVLRLRGGM  274



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   317 bits (813),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  190  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  249

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  250  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  309

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  310  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 160/206 (78%), Gaps = 45/206 (22%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYN---------------------------------------------IQKESTL  226
            GRTLADYN                                             IQKESTL
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTL  188

Query  227  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  406
            HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  189  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  248

Query  407  DGRTLADYNIQKESTLHLVLRLRGGF  484
            DGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  249  DGRTLADYNIQKESTLHLVLRLRGGM  274



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   317 bits (813),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   314 bits (805),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  475
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226


 Score =   304 bits (778),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   314 bits (805),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   314 bits (805),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>prf||1101405A ubiquitin precursor
Length=191

 Score =   313 bits (801),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  31   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  90

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  91   GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  150

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  151  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  190


 Score =   226 bits (575),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  140  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  319
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  1    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  60

Query  320  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            IDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  61   IDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  115



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   317 bits (813),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  466
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVF  299


 Score =   302 bits (773),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  122  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  241

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  242  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  282


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  113

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  173

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  174  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  206


 Score =   290 bits (743),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  198  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  257

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  258  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  317

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNI   +   L  + R  F
Sbjct  318  PPDQQRLIFAGKQLEDGRTLADYNITPLTMSRLRSKTRRAF  358



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   317 bits (812),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/121 (100%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  P  364
            P
Sbjct  341  P  341



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   314 bits (804),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   314 bits (804),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  103  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  162

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  163  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  222

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  223  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  179  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  238

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  239  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  298

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  299  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   317 bits (812),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   314 bits (804),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/160 (98%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGM  153



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   317 bits (811),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  103  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  162

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  163  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  222

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  223  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  179  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  238

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  239  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  298

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  299  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   310 bits (793),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  17   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  196
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  197  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  376
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  377  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  152  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   318 bits (815),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  34   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  93

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  94   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  153

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  154  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   318 bits (815),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  110  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  169

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  170  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  229

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  230  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   315 bits (808),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  186  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  245

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  246  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  478
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  306  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 117/153 (76%), Gaps = 35/153 (23%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118



>ref|XP_011038259.1| PREDICTED: polyubiquitin-like [Populus euphratica]
 ref|XP_011038263.1| PREDICTED: polyubiquitin-like [Populus euphratica]
Length=305

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLE+
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEE  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   314 bits (804),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EGA57707.1| Ubi4p [Saccharomyces cerevisiae FostersB]
Length=248

 Score =   314 bits (805),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/161 (97%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  313
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (810),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  152  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  211

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  212  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  271

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312


 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  76   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  135

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  136  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  195

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  236


 Score =   301 bits (772),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  160



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   314 bits (805),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  13   LVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  72

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE I
Sbjct  73   GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWI  132

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  133  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLED
Sbjct  89   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLED  148

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  149  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  208

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQ+RLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG 
Sbjct  209  PPDQKRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/97 (98%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  373
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  374  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   313 bits (803),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/161 (97%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>sp|P0CG73.1|UBI1P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Candida albicans]
 gb|AAA84868.1| ubiquitin precursor [Candida albicans]
Length=229

 Score =   313 bits (803),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/161 (97%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRSRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   296 bits (757),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRSRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   317 bits (811),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  159  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  218

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  219  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  278

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  279  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319


 Score =   317 bits (811),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  83   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  142

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  143  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  202

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  203  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  243


 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  193
            L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  11   LAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  70

Query  194  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  373
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  71   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  130

Query  374  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  131  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  167



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLI AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   313 bits (803),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   296 bits (758),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGM  153



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   313 bits (803),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/161 (97%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229


 Score =   298 bits (763),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   317 bits (812),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  143  LVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLED  202

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  203  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  262

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  263  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  303


 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  67   LVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  126

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGI
Sbjct  127  GRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGI  186

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  187  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  227


 Score =   276 bits (705),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 144/153 (94%), Gaps = 2/153 (1%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  151


 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  219  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  278

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  337
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  279  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   315 bits (808),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  45   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  104

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  105  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  164

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  165  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  205


 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  121  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  180

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  181  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  240

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  241  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 128/153 (84%), Gaps = 24/153 (16%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   316 bits (810),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   316 bits (810),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (810),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   313 bits (802),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (764),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   320 bits (821),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  269  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  328

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  329  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  388

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  389  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429


 Score =   318 bits (814),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  117  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  176

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  177  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  236

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  277


 Score =   318 bits (814),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  193  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  252

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  253  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  312

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  313  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  353


 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   316 bits (810),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (810),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/91 (99%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKT  274
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  281  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311



>gb|EKV18932.1| hypothetical protein PDIP_25190 [Penicillium digitatum Pd1]
Length=233

 Score =   313 bits (803),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  73   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  132

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  133  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  192

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  193  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  232


 Score =   283 bits (725),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  32   IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  211
            I +  +TGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQ
Sbjct  7    IPLSLVTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  66

Query  212  KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  391
            KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFA
Sbjct  67   KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFA  126

Query  392  GKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            GKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  127  GKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  157



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   319 bits (817),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   319 bits (817),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 150/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTL  454
            PPDQQRLIFAGKQLEDGRTLADYNIQKE+ L
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKENPL  371



>gb|KFX48439.1| Polyubiquitin [Talaromyces marneffei PM1]
Length=218

 Score =   313 bits (801),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  58   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  117

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  118  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  177

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  178  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 141/153 (92%), Gaps = 11/153 (7%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLE           +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLE-----------SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  49

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  50   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  109

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  110  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  142



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEE  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   315 bits (806),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGM  153



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   313 bits (802),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  265  LVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLED  324

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  325  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  384

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  385  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425


 Score =   318 bits (815),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  113  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  172

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  173  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  232

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  233  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  273


 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  189  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  248

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGI
Sbjct  249  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGI  308

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  309  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  349


 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +2

Query  14   LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  193
            LR  MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  41   LRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  100

Query  194  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  373
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  101  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  160

Query  374  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  161  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  197



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   313 bits (802),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002419618.1| ubiquitin, putative [Candida dubliniensis CD36]
 sp|P0CG74.1|UBI4P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Candida albicans]
 emb|CAA90901.1| polyubiquitin [Candida albicans]
 emb|CAX43214.1| ubiquitin, putative [Candida dubliniensis CD36]
 gb|KGU10731.1| polyubiquitin [Candida albicans L26]
Length=305

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   313 bits (802),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/161 (97%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (763),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   316 bits (809),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   316 bits (809),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   316 bits (809),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|ADP05114.1| polyubiquitin 10 [Aponogeton madagascariensis]
Length=221

 Score =   313 bits (801),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 157/159 (99%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTG+T TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  63   LVLRLRGGMQIFVKTLTGETTTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  122

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  123  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  182

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  478
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  183  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  221


 Score =   286 bits (732),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  47   LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  226
            LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  2    LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  61

Query  227  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  406
            HLVLRLRGGMQIFVKTLTG+T TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  62   HLVLRLRGGMQIFVKTLTGETTTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  121

Query  407  DGRTLADYNIQKESTLHLVLRLRGGF  484
            DGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  DGRTLADYNIQKESTLHLVLRLRGGM  147



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   316 bits (809),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   313 bits (803),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   316 bits (809),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   314 bits (805),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   316 bits (809),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  70   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  129

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  130  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  189

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  190  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  230


 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  146  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  205

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  206  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  265

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  266  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  306


 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  222  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  281

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  282  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGV  341

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  342  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381


 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  154



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGM  305


 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   313 bits (802),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   313 bits (802),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   298 bits (763),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGM  153



>gb|EFN76024.1| Ubiquitin [Harpegnathos saltator]
Length=229

 Score =   313 bits (801),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/161 (96%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   292 bits (748),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFV+TL GKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVRTLAGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   313 bits (802),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  71   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  130

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  131  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  190

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  191  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  231


 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  147  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  206

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  207  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  266

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  267  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  307


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  223  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  282

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  283  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  342

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  343  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  155



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   316 bits (809),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGM  256
            GRTLADYNIQKESTLHLVLRLRGG+
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGV  381



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380


 Score =   316 bits (809),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007864655.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ57585.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|KIP08465.1| hypothetical protein PHLGIDRAFT_18910 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=381

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  341  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  381


 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010324326.1| PREDICTED: polyubiquitin isoform X1 [Solanum lycopersicum]
Length=457

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  416

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  417  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            P DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_005644220.1| polyubiquitin [Coccomyxa subellipsoidea C-169]
 gb|EIE19676.1| polyubiquitin [Coccomyxa subellipsoidea C-169]
Length=305

 Score =   315 bits (808),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/161 (97%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (810),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008441422.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Cucumis melo]
Length=457

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  416

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  417  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003542730.1| PREDICTED: polyubiquitin 10-like [Glycine max]
 gb|KHN09976.1| Polyubiquitin 10 [Glycine soja]
Length=457

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  416

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  417  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRL+FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_849299.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_849301.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002872749.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004145098.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004153450.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004248312.1| PREDICTED: polyubiquitin [Solanum lycopersicum]
 ref|XP_006360086.1| PREDICTED: polyubiquitin-like isoform X1 [Solanum tuberosum]
 ref|XP_006289516.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 ref|XP_006393349.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 ref|XP_006452179.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452180.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452185.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006452187.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006475213.1| PREDICTED: polyubiquitin 10-like [Citrus sinensis]
 ref|XP_007154502.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 ref|XP_007211602.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008371127.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009357406.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009340939.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009594377.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792248.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010023555.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
 ref|XP_010538672.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 ref|XP_010694241.1| PREDICTED: polyubiquitin [Beta vulgaris subsp. vulgaris]
 ref|XP_010644404.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644405.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644406.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011097919.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CG85.1|UBI1P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Nicotiana sylvestris]
 sp|Q8H159.2|UBQ10_ARATH RecName: Full=Polyubiquitin 10; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA34123.1| hexameric polyubiquitin [Nicotiana sylvestris]
 gb|AAA68878.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAD03341.1| ubiquitin [Pisum sativum]
 gb|AAD03342.1| ubiquitin [Pisum sativum]
 gb|AAM98141.1| polyubiquitin UBQ10 [Arabidopsis thaliana]
 gb|ABK92469.1| unknown [Populus trichocarpa]
 emb|CAN64480.1| hypothetical protein VITISV_002813 [Vitis vinifera]
 gb|ACS68204.1| ubiquitin 10.1 [Brassica napus]
 gb|EFH49008.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ34175.1| unnamed protein product [Thellungiella halophila]
 gb|AEE82500.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82502.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12801.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA22414.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 emb|CCQ25958.1| polyubiquitin 10 [Coffea arabica]
 gb|ESQ30635.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 gb|ESR65419.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65420.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65425.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESR65427.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESW26496.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 gb|EYU19215.1| hypothetical protein MIMGU_mgv1a004313mg [Erythranthe guttata]
 gb|KDO52958.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52959.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52960.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KEH18409.1| polyubiquitin 3 [Medicago truncatula]
 gb|KEH18410.1| polyubiquitin 3 [Medicago truncatula]
 gb|KGN49132.1| hypothetical protein Csa_6G514925 [Cucumis sativus]
 gb|KHN15480.1| Polyubiquitin 10 [Glycine soja]
 gb|AJA36490.1| ubiquitin [Prunus persica]
 gb|KJB62627.1| hypothetical protein B456_009G426900 [Gossypium raimondii]
 gb|KJB62631.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 gb|KJB62632.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
Length=457

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  416

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  417  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010431529.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Camelina 
sativa]
Length=457

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  416

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  417  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   316 bits (809),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (809),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA25706.1| unnamed protein product [Saccharomyces cerevisiae]
Length=191

 Score =   311 bits (797),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  31   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  90

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGI
Sbjct  91   GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI  150

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAG QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  151  PPDQQRLIFAGNQLEDGRTLSDYNIQKESTLHLVLRLRGG  190


 Score =   226 bits (575),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  140  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  319
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  1    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  60

Query  320  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            IDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  61   IDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  115



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62486.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=383

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  223  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  282

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  283  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  342

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  343  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 160/163 (98%), Gaps = 2/163 (1%)
 Frame = +2

Query  2    LVLRLRGGMQIF--VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  175
            LVLRLRGGMQIF  VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQL
Sbjct  145  LVLRLRGGMQIFIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL  204

Query  176  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  355
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  205  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  264

Query  356  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  307


 Score =   311 bits (796),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 160/163 (98%), Gaps = 2/163 (1%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQ--IFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  355
            GRTLADYNIQKESTLHLVLRLRGGMQ  IFVKTLTGKTITLEVESSDTIDNVK+KIQDKE
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE  188

Query  356  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  231


 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB81827.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=457

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  416

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  417  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009784905.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009784906.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
Length=457

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  297  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  356

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  357  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  416

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  417  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/161 (99%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  128

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  129  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  188

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  189  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  264

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  265  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   316 bits (809),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  2    LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  181
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  221  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  280

Query  182  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  361
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGI
Sbjct  281  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGI  340

Query  362  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  481
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  341  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +2

Query  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  205
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  206  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  385
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  386  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  484
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160