BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN030J06

Length=403
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001183608.1|  uncharacterized protein LOC100502202               213   2e-67   
gb|AAO41895.1|  putative casein kinase                                  217   3e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAM91528.1|  putative casein kinase                                  217   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    225   2e-66   Sesamum indicum [beniseed]
emb|CDP14324.1|  unnamed protein product                                225   2e-66   Coffea canephora [robusta coffee]
gb|ABR25333.1|  protein kinase family protein                           208   4e-66   Oryza sativa Indica Group [Indian rice]
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                   220   5e-66   Citrus sinensis [apfelsine]
gb|EPS68531.1|  hypothetical protein M569_06230                         223   6e-66   Genlisea aurea
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    223   9e-66   Nicotiana tomentosiformis
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    223   9e-66   Nicotiana sylvestris
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    223   9e-66   Nicotiana sylvestris
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    223   1e-65   Nicotiana tomentosiformis
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg             221   3e-65   Citrus clementina [clementine]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...    221   4e-65   Citrus sinensis [apfelsine]
ref|XP_002525432.1|  casein kinase, putative                            221   4e-65   Ricinus communis
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    221   5e-65   Sesamum indicum [beniseed]
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555    221   5e-65   Populus euphratica
gb|KDP39706.1|  hypothetical protein JCGZ_02726                         221   6e-65   Jatropha curcas
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    221   6e-65   Solanum lycopersicum
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                220   7e-65   Erythranthe guttata [common monkey flower]
ref|XP_002325416.1|  kinase family protein                              221   7e-65   
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807    220   8e-65   Fragaria vesca subsp. vesca
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    220   1e-64   Solanum tuberosum [potatoes]
ref|XP_010088042.1|  Casein kinase I isoform delta                      219   2e-64   
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    219   2e-64   Cucumis sativus [cucumbers]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    219   2e-64   Cucumis melo [Oriental melon]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268    219   3e-64   Eucalyptus grandis [rose gum]
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                   214   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    219   3e-64   
ref|XP_007030718.1|  Kinase family protein                              218   5e-64   Theobroma cacao [chocolate]
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...    218   6e-64   Glycine max [soybeans]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             217   9e-64   Prunus persica
emb|CBI29940.3|  unnamed protein product                                215   9e-64   Vitis vinifera
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210    217   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg             217   1e-63   Eutrema salsugineum [saltwater cress]
gb|KJB45108.1|  hypothetical protein B456_007G289500                    217   1e-63   Gossypium raimondii
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...    217   2e-63   Cicer arietinum [garbanzo]
emb|CDY38493.1|  BnaA10g16650D                                          216   2e-63   Brassica napus [oilseed rape]
ref|NP_197320.1|  protein kinase                                        216   2e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25451.1|  BnaC09g39660D                                          216   2e-63   Brassica napus [oilseed rape]
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147    216   2e-63   Camelina sativa [gold-of-pleasure]
ref|NP_187044.1|  protein kinase family protein                         216   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208    215   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg             216   2e-63   Capsella rubella
ref|XP_002884421.1|  kinase family protein                              216   3e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    216   3e-63   Vitis vinifera
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...    216   3e-63   Tarenaya hassleriana [spider flower]
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...    216   3e-63   
ref|XP_003624626.1|  Casein kinase I isoform alpha                      216   4e-63   Medicago truncatula
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859    215   5e-63   Brassica rapa
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             215   5e-63   Phaseolus vulgaris [French bean]
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977    215   5e-63   Prunus mume [ume]
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...    215   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873    215   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499    215   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...    215   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002873876.1|  kinase family protein                              215   6e-63   
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg             215   7e-63   Eutrema salsugineum [saltwater cress]
gb|KHG27523.1|  hypothetical protein F383_15264                         215   7e-63   Gossypium arboreum [tree cotton]
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg             214   7e-63   Capsella rubella
gb|ADE75678.1|  unknown                                                 204   9e-63   Picea sitchensis
gb|KJB82579.1|  hypothetical protein B456_013G203000                    214   1e-62   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                    214   1e-62   Gossypium raimondii
gb|KHG17118.1|  Casein kinase I isoform delta                           214   1e-62   Gossypium arboreum [tree cotton]
gb|KHG04306.1|  Casein kinase I-like protein                            214   1e-62   Gossypium arboreum [tree cotton]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151    214   1e-62   
emb|CDY42890.1|  BnaC05g47610D                                          214   1e-62   Brassica napus [oilseed rape]
emb|CDY29971.1|  BnaC01g40370D                                          214   2e-62   Brassica napus [oilseed rape]
emb|CDY51243.1|  BnaA03g06950D                                          213   2e-62   Brassica napus [oilseed rape]
emb|CDX70801.1|  BnaC03g08850D                                          213   2e-62   
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881    213   2e-62   Brassica rapa
gb|KJB80963.1|  hypothetical protein B456_013G123300                    213   2e-62   Gossypium raimondii
gb|KJB80965.1|  hypothetical protein B456_013G123300                    213   2e-62   Gossypium raimondii
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226    213   3e-62   Brassica rapa
emb|CDY21155.1|  BnaA01g33860D                                          213   3e-62   Brassica napus [oilseed rape]
ref|NP_001044393.1|  Os01g0772600                                       213   3e-62   
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100    213   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200    213   4e-62   Brassica rapa
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...    213   6e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295    212   7e-62   Brachypodium distachyon [annual false brome]
emb|CDY02641.1|  BnaC02g07940D                                          211   9e-62   
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016    211   2e-61   Elaeis guineensis
emb|CDY53253.1|  BnaA02g04010D                                          212   2e-61   Brassica napus [oilseed rape]
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164    211   2e-61   Brassica rapa
gb|ABF99312.1|  protein kinase family protein, putative, expressed      207   2e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71557.1|  hypothetical protein OsI_03913                          210   3e-61   Oryza sativa Indica Group [Indian rice]
dbj|BAJ90552.1|  predicted protein                                      210   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...    211   3e-61   
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...    210   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369    210   4e-61   Phoenix dactylifera
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174    210   4e-61   Setaria italica
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684    210   5e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...    210   6e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869    209   8e-61   Oryza brachyantha
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...    209   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...    208   2e-60   Camelina sativa [gold-of-pleasure]
gb|EAY92152.1|  hypothetical protein OsI_13865                          208   2e-60   Oryza sativa Indica Group [Indian rice]
gb|ADE77861.1|  unknown                                                 196   2e-60   Picea sitchensis
dbj|BAN15568.1|  heading date 16                                        208   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051531.1|  Os03g0793500                                       208   2e-60   
emb|CDY50866.1|  BnaA05g37270D                                          209   2e-60   Brassica napus [oilseed rape]
ref|NP_001058996.1|  Os07g0171300                                       208   3e-60   
gb|AAP80674.1|  casein kinase-like protein                              192   7e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...    207   8e-60   Setaria italica
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...    207   8e-60   Setaria italica
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1          206   9e-60   Zea mays [maize]
dbj|BAJ93086.1|  predicted protein                                      206   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152463.1|  ATP binding protein                                206   1e-59   Zea mays [maize]
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940    206   1e-59   
gb|KHF98002.1|  hypothetical protein F383_12939                         205   1e-59   Gossypium arboreum [tree cotton]
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500    206   2e-59   Oryza brachyantha
ref|NP_001152101.1|  LOC100285738                                       205   2e-59   Zea mays [maize]
gb|KJB46016.1|  hypothetical protein B456_007G343500                    205   2e-59   Gossypium raimondii
gb|ACN36158.1|  unknown                                                 205   2e-59   Zea mays [maize]
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235    205   3e-59   Brachypodium distachyon [annual false brome]
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210    194   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...    204   7e-59   Tarenaya hassleriana [spider flower]
gb|AAC42254.1|  unknown protein                                         195   7e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146    204   7e-59   Oryza brachyantha
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...    204   8e-59   
ref|XP_006842223.1|  hypothetical protein AMTR_s00078p00181940          203   1e-58   
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460          202   3e-58   Sorghum bicolor [broomcorn]
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...    202   4e-58   
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...    202   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...    201   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...    195   7e-58   Camelina sativa [gold-of-pleasure]
gb|EMS51431.1|  Casein kinase I isoform beta                            200   2e-57   Triticum urartu
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg                199   3e-57   Erythranthe guttata [common monkey flower]
emb|CDP13154.1|  unnamed protein product                                198   3e-57   Coffea canephora [robusta coffee]
ref|XP_006849555.1|  hypothetical protein AMTR_s00024p00176520          199   5e-57   Amborella trichopoda
ref|XP_008367866.1|  PREDICTED: casein kinase I                         196   5e-57   
ref|XP_002458472.1|  hypothetical protein SORBIDRAFT_03g034330          183   1e-56   
ref|XP_007024284.1|  Casein kinase I protein isoform 1                  198   1e-56   
gb|KHN37292.1|  Casein kinase I                                         196   1e-56   Glycine soja [wild soybean]
emb|CDY23629.1|  BnaC05g39650D                                          195   1e-56   Brassica napus [oilseed rape]
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784    197   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819    197   2e-56   Glycine max [soybeans]
ref|XP_001770883.1|  predicted protein                                  196   2e-56   
gb|KHN27094.1|  Casein kinase I                                         197   2e-56   Glycine soja [wild soybean]
ref|XP_001764211.1|  predicted protein                                  196   2e-56   
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg             197   2e-56   Citrus clementina [clementine]
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373    197   2e-56   Glycine max [soybeans]
gb|KDP33655.1|  hypothetical protein JCGZ_07226                         197   2e-56   Jatropha curcas
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg             197   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg             197   3e-56   Capsella rubella
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...    196   3e-56   
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...    196   3e-56   
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616    197   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...    196   3e-56   Glycine max [soybeans]
ref|XP_002882838.1|  kinase family protein                              197   3e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...    196   3e-56   Glycine max [soybeans]
gb|KHN24964.1|  Casein kinase I isoform alpha                           197   3e-56   Glycine soja [wild soybean]
gb|KJB56821.1|  hypothetical protein B456_009G137100                    197   3e-56   Gossypium raimondii
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106    196   3e-56   Brassica rapa
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                    196   3e-56   Arabis alpina [alpine rockcress]
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457    196   3e-56   
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...    196   4e-56   Camelina sativa [gold-of-pleasure]
emb|CDX97505.1|  BnaA05g25740D                                          196   4e-56   
ref|XP_006853659.1|  hypothetical protein AMTR_s00056p00104010          196   4e-56   Amborella trichopoda
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...    196   5e-56   
gb|KHN18151.1|  Casein kinase I like 2                                  193   5e-56   Glycine soja [wild soybean]
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                   193   5e-56   Citrus sinensis [apfelsine]
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...    196   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...    196   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586    196   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538    196   5e-56   Elaeis guineensis
emb|CDY55141.1|  BnaC01g44810D                                          195   6e-56   Brassica napus [oilseed rape]
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g             196   6e-56   Phaseolus vulgaris [French bean]
emb|CDY51730.1|  BnaA01g37130D                                          196   6e-56   Brassica napus [oilseed rape]
gb|ADE76410.1|  unknown                                                 192   6e-56   Picea sitchensis
gb|KHG14825.1|  hypothetical protein F383_08945                         196   6e-56   Gossypium arboreum [tree cotton]
ref|XP_002880706.1|  kinase family protein                              196   7e-56   
ref|NP_187977.1|  protein kinase family protein                         196   7e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CBI36074.3|  unnamed protein product                                194   8e-56   Vitis vinifera
emb|CDX75726.1|  BnaC03g38090D                                          195   8e-56   
emb|CAN77676.1|  hypothetical protein VITISV_013722                     196   9e-56   Vitis vinifera
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221    195   9e-56   Vitis vinifera
gb|KDP44321.1|  hypothetical protein JCGZ_19188                         195   1e-55   Jatropha curcas
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553    195   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g             195   1e-55   Phaseolus vulgaris [French bean]
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194    195   1e-55   Cucumis sativus [cucumbers]
ref|XP_004162011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    195   1e-55   
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...    195   1e-55   
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128    195   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...    195   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488    192   1e-55   
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg             195   1e-55   
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081    195   1e-55   
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938    188   1e-55   
ref|NP_973532.1|  protein kinase family protein                         195   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180147.2|  protein kinase family protein                         194   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003621013.1|  Casein kinase I isoform alpha                      194   2e-55   Medicago truncatula
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778    195   2e-55   
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845    194   2e-55   Prunus mume [ume]
gb|KHN39248.1|  Casein kinase I isoform delta-like                      194   2e-55   Glycine soja [wild soybean]
emb|CBI16476.3|  unnamed protein product                                193   2e-55   Vitis vinifera
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673    194   2e-55   Brassica rapa
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148    194   2e-55   
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211    194   2e-55   
gb|KJB21848.1|  hypothetical protein B456_004G018000                    194   2e-55   Gossypium raimondii
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...    194   2e-55   Cicer arietinum [garbanzo]
ref|XP_002516524.1|  casein kinase, putative                            194   2e-55   
gb|KDP34168.1|  hypothetical protein JCGZ_07739                         194   2e-55   Jatropha curcas
emb|CBI28086.3|  unnamed protein product                                194   2e-55   Vitis vinifera
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417    194   2e-55   Populus euphratica
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869    194   2e-55   Glycine max [soybeans]
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176    194   2e-55   Cucumis melo [Oriental melon]
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                       194   2e-55   
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043    194   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_007014775.1|  Kinase family protein isoform 2                    194   3e-55   
ref|XP_002531638.1|  casein kinase, putative                            194   3e-55   Ricinus communis
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855    194   3e-55   
emb|CAN69523.1|  hypothetical protein VITISV_040873                     194   3e-55   Vitis vinifera
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...    194   3e-55   Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg             194   3e-55   
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...    194   3e-55   Pyrus x bretschneideri [bai li]
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                   194   3e-55   Citrus sinensis [apfelsine]
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...    194   3e-55   
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076    194   3e-55   Pyrus x bretschneideri [bai li]
ref|XP_010093160.1|  Casein kinase I                                    194   3e-55   
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...    194   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like          192   3e-55   
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...    194   3e-55   Phoenix dactylifera
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...    194   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...    194   3e-55   Phoenix dactylifera
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531    194   3e-55   Brassica rapa
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...    194   4e-55   Phoenix dactylifera
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...    194   4e-55   Phoenix dactylifera
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956    194   4e-55   Vitis vinifera
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414    194   4e-55   Vitis vinifera
emb|CDX82524.1|  BnaA03g32970D                                          193   4e-55   
gb|KJB07481.1|  hypothetical protein B456_001G026300                    190   4e-55   Gossypium raimondii
gb|KHN10182.1|  Casein kinase I like 2                                  192   4e-55   Glycine soja [wild soybean]
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...    194   4e-55   Glycine max [soybeans]
ref|XP_004148393.1|  PREDICTED: uncharacterized protein LOC101218249    193   4e-55   
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757              182   4e-55   
ref|XP_007014774.1|  Casein kinase I protein isoform 1                  194   4e-55   
gb|KGN62809.1|  hypothetical protein Csa_2G373520                       193   5e-55   Cucumis sativus [cucumbers]
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596    193   5e-55   Tarenaya hassleriana [spider flower]
gb|KDP40868.1|  hypothetical protein JCGZ_24867                         193   5e-55   Jatropha curcas
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630    193   5e-55   Glycine max [soybeans]
ref|XP_004155952.1|  PREDICTED: uncharacterized protein LOC101230855    193   5e-55   
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like          192   5e-55   
gb|KGN45587.1|  hypothetical protein Csa_7G452910                       193   5e-55   Cucumis sativus [cucumbers]
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g             193   5e-55   
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...    193   5e-55   Glycine max [soybeans]
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213589    193   5e-55   Cucumis sativus [cucumbers]
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552             185   5e-55   Arabidopsis lyrata subsp. lyrata
dbj|BAG92829.1|  unnamed protein product                                192   5e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78673.1|  hypothetical protein OsI_18806                          192   5e-55   Oryza sativa Indica Group [Indian rice]
gb|AAT44311.1|  putative casein kinase                                  192   5e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660    193   6e-55   
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244    193   6e-55   Prunus mume [ume]
emb|CDY21505.1|  BnaC03g26920D                                          192   6e-55   Brassica napus [oilseed rape]
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792    193   6e-55   Phoenix dactylifera
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg             193   6e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...    193   6e-55   Elaeis guineensis
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                    192   7e-55   Arabis alpina [alpine rockcress]
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783    193   7e-55   Cucumis melo [Oriental melon]
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...    190   7e-55   Populus euphratica
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...    193   7e-55   
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg             193   7e-55   Citrus clementina [clementine]
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg             193   7e-55   Prunus persica
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375    193   8e-55   Populus euphratica
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg             193   8e-55   Prunus persica
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770    193   8e-55   Citrus sinensis [apfelsine]
dbj|BAD87518.1|  putative serine/threonine protein kinase               191   8e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127    192   8e-55   
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg             192   8e-55   Prunus persica
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343    193   9e-55   Fragaria vesca subsp. vesca
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441    192   9e-55   
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                    191   9e-55   Tarenaya hassleriana [spider flower]
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...    192   1e-54   
dbj|BAJ94407.1|  predicted protein                                      191   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...    192   1e-54   
gb|KJB21850.1|  hypothetical protein B456_004G018100                    192   1e-54   Gossypium raimondii
emb|CDM82151.1|  unnamed protein product                                191   1e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016    192   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765             191   1e-54   
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...    191   1e-54   
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482             191   1e-54   
emb|CBI20566.3|  unnamed protein product                                191   1e-54   
ref|NP_001054881.2|  Os05g0200500                                       192   1e-54   
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420    192   1e-54   
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334    191   1e-54   
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...    190   1e-54   
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...    192   1e-54   
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...    192   1e-54   
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189    191   1e-54   
ref|XP_007024285.1|  Kinase family protein isoform 2                    189   1e-54   
gb|EEE55368.1|  hypothetical protein OsJ_03423                          191   1e-54   
ref|XP_010102418.1|  Casein kinase I-2-like protein                     192   1e-54   
gb|KJB07483.1|  hypothetical protein B456_001G026300                    191   2e-54   
gb|EEC71464.1|  hypothetical protein OsI_03705                          192   2e-54   
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456    192   2e-54   
ref|NP_001044224.1|  Os01g0744300                                       192   2e-54   
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236    192   2e-54   
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...    192   2e-54   
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711    191   2e-54   
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...    191   2e-54   
emb|CDO97984.1|  unnamed protein product                                191   2e-54   
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726    191   2e-54   
ref|XP_007012164.1|  Casein kinase I protein                            192   2e-54   
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...    191   2e-54   
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g             192   2e-54   
gb|KHG03332.1|  hypothetical protein F383_28165                         191   2e-54   
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429    191   2e-54   
ref|XP_003592802.1|  Casein kinase-like protein                         191   2e-54   
emb|CDX76739.1|  BnaC08g33250D                                          190   3e-54   
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...    191   3e-54   
ref|XP_009117039.1|  PREDICTED: casein kinase I                         190   3e-54   
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062    191   3e-54   
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...    191   3e-54   
gb|ADI78885.1|  casein kinase I                                         191   3e-54   
gb|KJB07478.1|  hypothetical protein B456_001G026300                    191   3e-54   
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...    191   3e-54   
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...    191   3e-54   
emb|CDY11509.1|  BnaA09g40750D                                          189   3e-54   
ref|XP_002309535.1|  kinase family protein                              190   4e-54   
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...    190   4e-54   
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...    191   5e-54   
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...    191   5e-54   
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228    189   5e-54   
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...    190   5e-54   
gb|KJB54778.1|  hypothetical protein B456_009G048800                    189   5e-54   
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751    191   5e-54   
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...    190   5e-54   
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860    190   5e-54   
gb|KJB70401.1|  hypothetical protein B456_011G072100                    191   6e-54   
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068    190   6e-54   
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720    190   6e-54   
gb|KHG18897.1|  Casein kinase I                                         191   6e-54   
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g             190   6e-54   
ref|XP_002515975.1|  casein kinase, putative                            190   6e-54   
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003    190   7e-54   
gb|KJB54779.1|  hypothetical protein B456_009G048800                    189   7e-54   
gb|EMT25395.1|  Casein kinase I-2-like protein                          189   8e-54   
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149    189   9e-54   
emb|CDP08183.1|  unnamed protein product                                190   9e-54   
gb|KHG22911.1|  Casein kinase I                                         189   9e-54   
ref|XP_002304015.1|  kinase family protein                              190   9e-54   
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132    190   9e-54   
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125    190   9e-54   
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like      189   1e-53   
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263    189   1e-53   
dbj|BAD73224.1|  putative serine/threonine protein kinase               183   1e-53   
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359    189   1e-53   
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824    189   1e-53   
gb|AES58679.2|  casein kinase I-like protein                            189   1e-53   
ref|XP_007013209.1|  Kinase family protein isoform 5                    186   2e-53   
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864             187   2e-53   
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002             188   2e-53   
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757              182   2e-53   
dbj|BAJ99167.1|  predicted protein                                      189   2e-53   
emb|CDM84047.1|  unnamed protein product                                188   2e-53   
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332    189   2e-53   
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...    189   2e-53   
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...    189   2e-53   
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg                189   2e-53   
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043    189   2e-53   
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791              186   2e-53   
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378    189   2e-53   
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like      188   3e-53   
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g             188   3e-53   
gb|KHG27580.1|  Casein kinase I                                         188   3e-53   
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                    187   3e-53   
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197    188   3e-53   
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790          187   3e-53   
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912    188   3e-53   
ref|NP_187043.1|  protein kinase-related protein                        180   3e-53   
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270          187   3e-53   
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g             185   4e-53   
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757              182   4e-53   
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336    188   4e-53   
gb|EMS66552.1|  Casein kinase I-like protein 2                          187   4e-53   
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g             188   4e-53   
gb|EMS55588.1|  Casein kinase I-like protein 2                          187   4e-53   
gb|AET01488.2|  casein kinase I-like protein                            188   4e-53   
ref|NP_001169571.1|  hypothetical protein                               187   4e-53   
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445    187   4e-53   
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1    187   5e-53   
ref|XP_010098134.1|  Casein kinase I-2-like protein                     188   5e-53   
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718    186   6e-53   
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237    187   7e-53   
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947    187   7e-53   
ref|XP_008226475.1|  PREDICTED: protein kinase 3                        187   7e-53   
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090    187   7e-53   
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                   187   8e-53   
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    187   9e-53   
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...    186   1e-52   
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2              186   1e-52   
ref|XP_003627012.1|  Casein kinase-like protein                         187   1e-52   
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg             186   1e-52   
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...    186   1e-52   
ref|XP_007013205.1|  Kinase family protein isoform 1                    186   2e-52   
dbj|BAJ99119.1|  predicted protein                                      183   2e-52   
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922    186   2e-52   
dbj|BAK02283.1|  predicted protein                                      185   3e-52   
gb|EMT06030.1|  Casein kinase I-2-like protein                          185   3e-52   
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...    183   3e-52   
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...    182   3e-52   
gb|KJB82881.1|  hypothetical protein B456_013G219500                    184   3e-52   
gb|ACO87665.1|  protein kinase                                          185   4e-52   
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435    185   4e-52   
gb|KEH36077.1|  casein kinase I-like protein                            185   5e-52   
ref|NP_001141429.1|  uncharacterized protein LOC100273539               182   6e-52   
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026    184   6e-52   
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg             184   6e-52   
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...    184   7e-52   
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902    184   7e-52   
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...    184   7e-52   
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like          184   8e-52   
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3         184   9e-52   
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like    184   9e-52   
gb|EMS54400.1|  Casein kinase I-like protein 2                          184   1e-51   
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999    183   1e-51   
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                    182   2e-51   
gb|EMT27276.1|  Casein kinase I-2-like protein                          183   2e-51   
ref|NP_001042306.1|  Os01g0198200                                       183   2e-51   
dbj|BAD73223.1|  putative serine/threonine protein kinase               183   2e-51   
gb|EEC70115.1|  hypothetical protein OsI_00774                          183   2e-51   
gb|EEE54054.1|  hypothetical protein OsJ_00747                          183   2e-51   
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...    183   3e-51   
gb|EPS63371.1|  hypothetical protein M569_11412                         175   3e-51   
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...    183   3e-51   
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg                182   4e-51   
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...    181   5e-51   
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...    182   5e-51   
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...    182   5e-51   
ref|XP_003057011.1|  Serine/Threonine protein kinase                    182   6e-51   
ref|XP_003588428.1|  Casein kinase I isoform alpha                      182   6e-51   
gb|KJB27133.1|  hypothetical protein B456_004G279600                    182   7e-51   
ref|XP_002502422.1|  predicted protein                                  181   9e-51   
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695             177   9e-51   
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546              181   9e-51   
gb|KIY93350.1|  hypothetical protein MNEG_14612                         168   1e-50   
emb|CEG01140.1|  Serine/threonine-protein kinase, active site           179   2e-50   
ref|XP_003075213.1|  protein kinase family protein (ISS)                179   3e-50   
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase       179   3e-50   
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324              179   3e-50   
ref|XP_002882289.1|  hypothetical protein ARALYDRAFT_340491             172   4e-50   
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1         179   8e-50   
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3         179   8e-50   
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2         179   9e-50   
ref|XP_001416335.1|  predicted protein                                  176   3e-49   
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like    175   1e-48   
gb|KJB82582.1|  hypothetical protein B456_013G203000                    176   1e-48   
ref|XP_002514324.1|  casein kinase, putative                            175   1e-48   
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase       174   2e-48   
gb|AIS72786.1|  casein kinase-like protein                              161   5e-48   
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg             165   1e-47   
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3         171   5e-47   
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like    171   6e-47   
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like    169   1e-46   
gb|EMT06466.1|  Casein kinase I isoform alpha                           169   2e-46   
gb|EMS55265.1|  Casein kinase I isoform alpha                           169   2e-46   
gb|KDD76924.1|  hypothetical protein H632_c65p1                         168   5e-46   
gb|KHG22741.1|  Casein kinase I isoform delta                           167   6e-46   
gb|KJB54170.1|  hypothetical protein B456_009G024100                    167   8e-46   
ref|XP_007514232.1|  predicted protein                                  166   1e-45   
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600          165   5e-45   
gb|KJB54173.1|  hypothetical protein B456_009G024100                    164   7e-45   
tpg|DAA35739.1|  TPA: putative homeodomain-like transcription fac...    163   6e-44   
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein         160   1e-43   
ref|XP_010088832.1|  Casein kinase I isoform alpha                      161   1e-43   
gb|KDD72198.1|  hypothetical protein H632_c3713p0                       154   3e-43   
ref|XP_011400089.1|  Casein kinase I-like protein 2                     159   3e-43   
ref|XP_007014776.1|  Kinase family protein isoform 3                    160   3e-43   
gb|EPS62497.1|  hypothetical protein M569_12290                         158   1e-42   
ref|XP_010915572.1|  PREDICTED: uncharacterized protein LOC105040...    156   1e-41   
ref|XP_010915562.1|  PREDICTED: uncharacterized protein LOC105040...    156   1e-41   
ref|XP_010915554.1|  PREDICTED: uncharacterized protein LOC105040...    156   2e-41   
gb|EMT07061.1|  Casein kinase I-2-like protein                          157   2e-41   
ref|XP_010915546.1|  PREDICTED: uncharacterized protein LOC105040...    156   2e-41   
emb|CAN74986.1|  hypothetical protein VITISV_008771                     159   2e-41   
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                    151   3e-41   
gb|KJB07477.1|  hypothetical protein B456_001G026300                    154   5e-41   
ref|XP_004963352.1|  PREDICTED: probable casein kinase I homolog ...    150   9e-40   
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    149   1e-39   
ref|XP_001695320.1|  serine/threonine protein kinase, transcripti...    149   3e-39   
gb|KJB46017.1|  hypothetical protein B456_007G343500                    150   3e-39   
gb|AFW85111.1|  hypothetical protein ZEAMMB73_338907                    145   6e-39   
ref|XP_002958584.1|  histone kinase                                     148   7e-39   
gb|EMT12651.1|  Casein kinase I-2-like protein                          149   7e-39   
ref|XP_010229461.1|  PREDICTED: casein kinase I isoform alpha-like      147   9e-39   
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392    147   1e-38   
tpg|DAA56574.1|  TPA: hypothetical protein ZEAMMB73_926529              134   1e-34   
gb|AEO89321.1|  serine/threonine protein kinase                         137   2e-34   
gb|KJB54177.1|  hypothetical protein B456_009G024100                    136   2e-34   
gb|AEW08952.1|  hypothetical protein CL2426Contig1_01                   125   4e-34   
ref|XP_008452134.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   2e-33   
ref|XP_009387621.1|  PREDICTED: uncharacterized protein LOC103974494    122   1e-32   
gb|EMT25758.1|  Casein kinase I isoform delta-like protein              127   5e-31   
ref|XP_010051243.1|  PREDICTED: uncharacterized protein LOC104439944    117   1e-30   
ref|XP_005648473.1|  kinase-like protein                                126   1e-30   
ref|XP_007024286.1|  Casein kinase I protein isoform 3                  121   2e-29   
ref|XP_010103948.1|  hypothetical protein L484_020200                   116   8e-29   
ref|XP_010090282.1|  hypothetical protein L484_001313                   116   8e-29   
ref|XP_010051247.1|  PREDICTED: uncharacterized protein LOC104439948    112   9e-29   
ref|XP_010051239.1|  PREDICTED: casein kinase I homolog hhp1-like       119   1e-28   



>ref|NP_001183608.1| uncharacterized protein LOC100502202 [Zea mays]
 gb|ACR37739.1| unknown [Zea mays]
Length=162

 Score =   213 bits (541),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  55   FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  114

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV 
Sbjct  115  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVS  162



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  200  FHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  259

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  260  FILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  307



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  196  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  255

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  256  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  303



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/108 (98%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  598  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  657

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  658  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/108 (98%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  602  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  661

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  662  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  508  LYISCVASATNLWALIMDAGTGFSSQVYELSAVFLHK-DWIMEQWEKNYYISSIAGAANG  566

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  567  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  607



>gb|ABR25333.1| protein kinase family protein [Oryza sativa Indica Group]
Length=137

 Score =   208 bits (530),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  30   FHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAA  89

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  90   FILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  137



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  430  FHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  489

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  490  FILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  537



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  597  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            F+LSIPRRKMMDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  657  FVLSIPRRKMMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  704



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  607  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  666

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  667  FILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  513  LYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHK-DWIMEQWEKNYYISSIAGAANG  571

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  572  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  612



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   223 bits (567),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  661  FILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   223 bits (567),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  607  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  666

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  667  FILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  513  LYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHK-DWIMEQWEKNYYISSIAGAANG  571

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  572  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  612



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  661  FILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++ + +A + W ++M    G+S QV +L   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  507  LYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLHK-DWIMEQWEKNYYISSIAGAANG  565

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  566  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  597  FHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  657  FILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  704



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  601  FHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  661  FILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRNAGYS+QVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  598  FHVTSMTTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  657

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  658  FILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITSMAAT DQAA
Sbjct  598  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAA  657

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  658  FILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  600  FHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  660  FILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  707



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  598  FHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  657

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  658  FILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAGY+EQVVELDFLYP EGIHRRWE G+RITSMAATADQAA
Sbjct  602  FHVTSMTTAGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITSMAATADQAA  661

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  662  FILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  508  LYISCVASAANLWALIMDAGTGFSSQVYELSAAFLHK-DWIMEQWEKNYYISSIAGAANG  566

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  567  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  607



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRIT+MAATADQ A
Sbjct  599  FHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITAMAATADQGA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  659  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  706


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  505  LYISCVASASNLWALIMDAGTGFSSQVYELSAVFLHK-DWIMEQWEKNYYISSIAGAANG  563

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  564  SSLVI---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  604



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  613  FHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  672

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  FILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  720



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score =   220 bits (560),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 99/108 (92%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRITSMAAT+DQAA
Sbjct  585  FHVTSMTTAGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATSDQAA  644

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  645  FILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICFGRTVC  692


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++S+ +A + W ++M    G+S QV EL   FL+  + I  +W+  + I+S+A   + 
Sbjct  491  LYISSVASAANLWALIMDAGTGFSSQVYELSAVFLHK-DWIMEQWDKNFYISSIAGANNG  549

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  550  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  590



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRNAGY+EQVVELDFLYP EGIHRRWE G+RITSMAATADQAA
Sbjct  602  FHVTSMTTAGNRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITSMAATADQAA  661

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  662  FILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAGY+EQVVELDFLYP EGIH+RWE+GYRITSMAATADQAA
Sbjct  599  FHVTSMTTAGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHKRWENGYRITSMAATADQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  659  FILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  706



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRIT MAATADQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  661  FILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRIT MAATADQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  661  FILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+G+S+QVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  595  FHVTSMTTAGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  654

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  655  FILSIPKRKVMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  702



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  387  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  446

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  447  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  494



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRIT MAATADQAA
Sbjct  635  FHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAA  694

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  695  FILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  742



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+G+S+QVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  598  FHVTSMTTAGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  657

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  658  FILSIPKRKMMDETQETLRTSAFPSAHVKEKWAKNLYIASICYGRTVC  705



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYP EGIHRRWE+GYRITSMAAT+DQAA
Sbjct  602  FHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENGYRITSMAATSDQAA  661

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  662  FILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  709



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG RWGVVMSRNAGYS+QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  600  FHVTSMTTAGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  660  FILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GY++QVVELDFLYP EGIHRRWE GYRITSMAAT DQAA
Sbjct  486  FHVTSMTTAGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITSMAATNDQAA  545

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  546  FILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  593


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             H++ + ++ + W ++M    GYS QV EL   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  392  LHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHK-DWIMEQWEKNYYISSIAGAANG  450

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  451  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  491



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRNAG+S+QVVELDF+YP EGIHRRWESGYRITSMAATADQAA
Sbjct  600  FHVTSMTTAGNRWGVVMSRNAGFSDQVVELDFVYPSEGIHRRWESGYRITSMAATADQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  660  FILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+SEQVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  588  FHVTSMTTAGNRWGVVMSRNSGFSEQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  647

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  648  FILSIPKRKMMDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  695



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  599  FHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  659  FILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYP EGIHRRWE+ YRITSMAAT+DQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITSMAATSDQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  661  FILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  583  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  642

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  643  FILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  584  FHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  643

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  644  FILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  583  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  642

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  643  FILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  585  FHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  644

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  645  FILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  594  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  654  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  540  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  599

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  600  FILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  647



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  594  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  654  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  595  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  654

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  655  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  702



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GY++QVVELDFLYP EGIHRRWE GYRITSMAAT DQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITSMAATNDQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  661  FILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  708


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             H++ + ++ + W ++M    GYS QV EL   FL+  + I  +WE  Y I+S+A  A+ 
Sbjct  507  LHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHK-DWIMEQWEKNYYISSIAGAANG  565

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  566  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYS+QVVELDFLYP EGIHRRWE GYRITSMAATADQAA
Sbjct  596  FHVTSMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITSMAATADQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  656  FILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  703



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYS+QVVELDFLYP EGIHRRWE GYRITSMAATADQAA
Sbjct  597  FHVTSMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITSMAATADQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  657  FILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  704



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYP EGIHRRWE+ YRITSMAAT DQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITSMAATNDQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  661  FILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FH+TSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  584  FHLTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  643

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  644  FILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  691



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYS+QVVE+DFLYP EGIHRRWE+GYRITSMAAT+DQAA
Sbjct  601  FHVTSMTTAGSRWGVVMSRNSGYSDQVVEIDFLYPSEGIHRRWENGYRITSMAATSDQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  661  FILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  708



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG RWGVVMSRNAGYS+QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  600  FHVTSMTTAGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  660  FILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICHGRTVC  707



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITSMAATADQAA
Sbjct  594  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  654  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  585  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  644

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  645  FILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITSMAATADQAA
Sbjct  594  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  654  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITSMAATADQAA
Sbjct  593  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAA  652

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  653  LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  700



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  584  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  643

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  644  FILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  594  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  654  LILSIPKRKISDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  701



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  599  FHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATGDQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  659  FILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  585  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  644

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  645  FILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>gb|ADE75678.1| unknown [Picea sitchensis]
Length=260

 Score =   204 bits (519),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRWE+GYRIT+ AAT DQAA
Sbjct  153  FYVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGYRITATAATCDQAA  212

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS+P+RK+ DETQETLRTSAFPSTHVKEKWSKNLYIA++CYGRTV
Sbjct  213  FILSVPKRKLTDETQETLRTSAFPSTHVKEKWSKNLYIAAVCYGRTV  259



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  599  FHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  659  FILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  706



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  600  FHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  660  FILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  707



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTA SRWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  599  FHVTSMTTAASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  659  FILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYP EGIHRRWESGYRITSMAATADQAA
Sbjct  599  FHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            F+LSIP+RKMMDETQETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  659  FVLSIPKRKMMDETQETLRTSAFPSTHVKEKWAKNLYLASVCYGRTVC  706



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  607  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSTAATHDQAA  666

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  667  FILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  713



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  593  FHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  652

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTH+KEKW+KNLYIASICYGRTVC
Sbjct  653  LILSIPKRKLTDETQETLRTSAFPSTHIKEKWAKNLYIASICYGRTVC  700



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  596  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  656  LILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  703



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWE+GYRITSMAATADQAA
Sbjct  577  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAA  636

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  637  FILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWE+GYRITSMAATADQAA
Sbjct  577  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAA  636

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  637  FILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYP +GIHRRWE+GYRITSMAATADQAA
Sbjct  569  FHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAA  628

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  629  FILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  676



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYP EGIHRRWE+GYRITSMAAT DQAA
Sbjct  599  FHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  659  FILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  706



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYP EGIHRRWE+GYRITSMAAT DQAA
Sbjct  600  FHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  660  FILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  707



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  597  FHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  657  LILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  597  FHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  657  LILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score =   213 bits (542),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  591  FHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  650

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  651  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG RWGVVMSRN+GYS+QVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  607  FHVTSMTTAGGRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAA  666

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  667  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  714



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  588  FHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  647

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  648  LILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  695



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTA SRWGVVMSRNAG+++QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  606  FHVTSMTTAASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAA  665

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            F+LSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  666  FVLSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  713



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  591  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  650

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  651  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  579  FHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  638

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  639  FILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  686



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT MTTAGSRWGVVMSRN+GYS+QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  611  FHVTCMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAA  670

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  671  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  718



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYP +GIHRRWESGYRITSMAATADQAA
Sbjct  655  FHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAA  714

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  715  FILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  762



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYP +GIHRRWE+GYRITSMAATADQAA
Sbjct  577  FHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAA  636

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  637  FILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  415  FHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAA  474

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  475  FILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  522



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  540  FHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  599

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  600  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  646



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  587  FHVTSMTTAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  646

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  647  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  693



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  705  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  764

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  765  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  811



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWG+VMSRN+GYS+QVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  609  FHVTSMTTAGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAA  668

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  669  FILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  716



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT MTTAGSRWGVVMSRN+GYS+QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  611  FHVTCMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAA  670

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  671  FILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  718



>ref|XP_004970128.1| PREDICTED: uncharacterized protein LOC101772174 [Setaria italica]
Length=697

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  590  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  649

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC+GRTV
Sbjct  650  FILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICFGRTV  696



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYS+QVVELDFLYP EGIH+RWESGYRITS AAT DQAA
Sbjct  601  FHVTSMATAGNRWGVVMSRNSGYSDQVVELDFLYPSEGIHKRWESGYRITSTAATVDQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  661  FILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  707



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWG+VMSRN+GYS+QVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  644  FHVTSMTTAGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAA  703

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  704  FILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  751



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  594  FHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  654  FILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  700



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 1/108 (1%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITSMAATADQAA
Sbjct  594  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  654  LILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  700



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 1/108 (1%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITSMAATADQAA
Sbjct  593  FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAA  652

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  653  LILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  699



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  600  FHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  660  FILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>gb|ADE77861.1| unknown [Picea sitchensis]
Length=186

 Score =   196 bits (497),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM +AGSRWGVVMSRNAG+++QVVELDFLYP EGIHRRW+ GYRIT+ AAT DQAA
Sbjct  79   FYVTSMASAGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDHGYRITATAATWDQAA  138

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  139  FVLSVPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  185



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  600  FHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  660  FILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  600  FHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  660  FILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYP EGIHRRWESG+RITSMAATADQAA
Sbjct  592  FHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAA  651

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTV
Sbjct  652  LILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTV  698



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score =   208 bits (529),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 94/108 (87%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  592  FHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSIAATNDQAA  651

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  652  FILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  699



>gb|AAP80674.1| casein kinase-like protein [Triticum aestivum]
Length=114

 Score =   192 bits (487),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRW VVMSRNAG+S+QVVELDFLYP EGIH+RW++GYRIT+ AAT DQAA
Sbjct  7    FYVTSMATAGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHQRWDNGYRITATAATLDQAA  66

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGR  317
            FILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGR
Sbjct  67   FILSIPRRKPNDETQETLRTSAFPSQHVKEKWSKNLYLASICYGR  111



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  600  FHVTSMATAGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  660  FILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  707



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  625  FHVTSMATAGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAA  684

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  685  FILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  732



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score =   206 bits (525),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  597  FHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  657  FILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRNAGYS+QVVELDFLYP EG+HRRWESGYRITS A T DQAA
Sbjct  600  FHVTSMGTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWESGYRITSSAGTPDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK +DETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  660  FILSIPKRKPLDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  707



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  597  FHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  657  FILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRNAGYS+QVVELDFLYP EG+HRRWE+GYRITS A T DQAA
Sbjct  602  FHVTSMGTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWETGYRITSSAGTPDQAA  661

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  662  FILSIPKRKPMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  709



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  561  FYVTSMTTAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAA  620

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  621  FILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  667



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  595  FHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAA  654

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  655  FILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  702



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  597  FHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  657  FILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  604  FYVTSMTTAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAA  663

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  664  FILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  710


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 55/104 (53%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
              ++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y ITS+A   + 
Sbjct  510  LFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHK-DWIMEQWEKNYYITSVAGANNG  568

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            ++ ++     K    TQ++ + S +FP   + +KW +  Y+ S+
Sbjct  569  SSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSM  609



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYP EGIHRRWESGYRITS AAT DQAA
Sbjct  597  FHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  657  FILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score =   205 bits (521),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRWE GYRITS AAT DQAA
Sbjct  595  FHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWEQGYRITSSAATIDQAA  654

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  655  FILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  702



>ref|XP_010472589.1| PREDICTED: uncharacterized protein LOC104752210 [Camelina sativa]
Length=257

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  150  FYVTSMATAGSKWGIVMSRGACFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAA  209

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  210  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  256



>ref|XP_010552201.1| PREDICTED: serine/threonine-protein kinase ste20-like [Tarenaya 
hassleriana]
Length=702

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYP EGIHRRW SGYRITS AATADQ A
Sbjct  595  FHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWNSGYRITSTAATADQTA  654

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             +LSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+ASICYGRTV
Sbjct  655  LVLSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASICYGRTV  701



>gb|AAC42254.1| unknown protein [Arabidopsis thaliana]
Length=282

 Score =   195 bits (495),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QV+ELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  175  FYVTSMATAGSKWGIVMSRGASFSDQVIELDFLYPSEGIHRRWENGYRITSVAATWDQAA  234

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  235  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  281



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN GYS QVVELDFLYP EGIHRRWE+GYRITS AAT DQAA
Sbjct  619  FHVTSMATAGNRWGVVMSRNTGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAA  678

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FIL++P+RK +DETQETLRTS+FPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  679  FILTMPKRKPVDETQETLRTSSFPSTHVKEKWSKNLYIASICYGRTVC  726



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 2/108 (2%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTA SRWGVVMSRNAG+++QVVELDFLYP EGIHRRWESGYRITSMAAT DQAA
Sbjct  606  FHVTSMTTAASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAA  665

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            F+LSIP+RK MDETQETLRTSAFPSTH  EKW+KNLYIASICYGRTVC
Sbjct  666  FVLSIPKRKTMDETQETLRTSAFPSTH--EKWAKNLYIASICYGRTVC  711



>ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
 gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSMTT+G+RWGVVMSRNAG+S+QVVELDFLYP EGIHRRWE+G+RITS AAT DQAA
Sbjct  598  FYVTSMTTSGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGFRITSTAATVDQAA  657

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS+P+RKM DETQETLRTSAFPSTHVKEKWSKNLYIAS+CYGRTV
Sbjct  658  FILSVPKRKMSDETQETLRTSAFPSTHVKEKWSKNLYIASVCYGRTV  704



>ref|XP_002466312.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
 gb|EER93310.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
Length=707

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGV++SRNAGYS QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  600  FHVTSMATAGNRWGVIVSRNAGYSTQVVELDFLYPSEGIHRRWETGYRITSIAATPDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQE LRTSAFPS+HVKEKW KNLYI+S+CYGRTVC
Sbjct  660  FILSIPKRKPMDETQEILRTSAFPSSHVKEKWVKNLYISSVCYGRTVC  707



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GY+ QVVELDFLYP EGIH RWE+GYRITS AAT DQAA
Sbjct  599  FHVTSMATAGNRWGVVMSRNSGYATQVVELDFLYPSEGIHHRWETGYRITSTAATPDQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            FILSIP+RK MDETQETLRTSAFPS HVKEKW KNLYI+SICYGRTVC
Sbjct  659  FILSIPKRKPMDETQETLRTSAFPSNHVKEKWVKNLYISSICYGRTVC  706



>ref|XP_010534909.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  596  FHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  656  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702



>ref|XP_010542444.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYP EGIH+RW+SG+RITS AAT DQAA
Sbjct  596  FHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHKRWDSGFRITSTAATTDQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  656  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702



>ref|XP_010500967.1| PREDICTED: uncharacterized protein LOC104778257 isoform X2 [Camelina 
sativa]
Length=390

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  283  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  342

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  343  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  389



>gb|EMS51431.1| Casein kinase I isoform beta [Triticum urartu]
Length=695

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQ+VELDFLYP EGIHRRWE GYRITS AAT DQAA
Sbjct  588  FHVTSMATAGNRWGVVMSRNSGYSEQIVELDFLYPSEGIHRRWEHGYRITSSAATGDQAA  647

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  648  FILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  694



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 1/109 (1%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMT+AGSRWGVVMSRN+GYSEQVVE+DF+YP EGIHRRWESGYRITSMAAT DQ+A
Sbjct  579  FHVTSMTSAGSRWGVVMSRNSGYSEQVVEVDFVYPSEGIHRRWESGYRITSMAATTDQSA  638

Query  183  FILSIPRRK-MMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
            F+LSIPRRK MMDE QETLRTSAFPS+HVK KWS+NLYIAS+C+G TVC
Sbjct  639  FVLSIPRRKLMMDEAQETLRTSAFPSSHVKAKWSRNLYIASMCHGPTVC  687



>emb|CDP13154.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RW VVMSRN+G+S+QVVELDFLYP EGIH+RW+SGYRIT+ AAT DQAA
Sbjct  494  FHVTSMATAGTRWAVVMSRNSGFSDQVVELDFLYPSEGIHKRWDSGYRITATAATWDQAA  553

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILS+PRRK++DETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  554  LILSVPRRKLLDETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRTVC  601



>ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  600  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATFDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTSAFPS+HVKEKWSKNLY+ASICYGRTV
Sbjct  660  LILSVPKRKPGDETQETLRTSAFPSSHVKEKWSKNLYLASICYGRTV  706



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  433  FHVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAA  492

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  493  FVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  539



>ref|XP_002458472.1| hypothetical protein SORBIDRAFT_03g034330 [Sorghum bicolor]
 gb|EES03592.1| hypothetical protein SORBIDRAFT_03g034330 [Sorghum bicolor]
Length=103

 Score =   183 bits (465),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  18   MTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAAFILSI  197
            M TAGSRW VVMSRNAG+S+QVVELDFLYP EGIH+RW+SGYRIT+ AAT DQAAF+LS+
Sbjct  1    MATAGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHKRWDSGYRITATAATWDQAAFVLSV  60

Query  198  PRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            PRR+  DETQETLRT+AFPS HVK+KWSKNLY+AS+CYGRTV
Sbjct  61   PRRRPTDETQETLRTTAFPSQHVKDKWSKNLYLASVCYGRTV  102



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYP EGIHRRW+ GYRIT+ AAT DQAA
Sbjct  620  FHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAA  679

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  680  FVLSVPRRKPMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  726



>gb|KHN37292.1| Casein kinase I [Glycine soja]
Length=590

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIH+RW+ GYRIT+ AAT DQ+A
Sbjct  483  FHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSA  542

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  543  LILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  590



>emb|CDY23629.1| BnaC05g39650D [Brassica napus]
Length=525

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EG+HRRW+ GYRITS AAT DQAA
Sbjct  418  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAA  477

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  478  LILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  524



>ref|XP_009382978.1| PREDICTED: uncharacterized protein LOC103970784 [Musa acuminata 
subsp. malaccensis]
Length=721

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITSM AT DQAA
Sbjct  614  FHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSMGATWDQAA  673

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  674  LILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  720



>ref|XP_003536792.1| PREDICTED: uncharacterized protein LOC100783819 [Glycine max]
Length=672

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIH+RW+ GYRIT+ AAT DQ+A
Sbjct  565  FHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSA  624

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  625  LILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  672



>ref|XP_001770883.1| predicted protein [Physcomitrella patens]
 gb|EDQ64213.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  496  FYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  555

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  556  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>gb|KHN27094.1| Casein kinase I [Glycine soja]
Length=657

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIH+RW+ GYRIT+ AAT DQ+A
Sbjct  550  FHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSA  609

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  610  LILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  657



>ref|XP_001764211.1| predicted protein [Physcomitrella patens]
 gb|EDQ71052.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  496  FYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  555

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  556  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>ref|XP_006445886.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 ref|XP_006492686.1| PREDICTED: uncharacterized protein LOC102618306 [Citrus sinensis]
 gb|ESR59126.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 gb|KDO62936.1| hypothetical protein CISIN_1g048600mg [Citrus sinensis]
Length=707

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+SEQVVELDFLYP EGIHRRW+ GYRITS AAT DQAA
Sbjct  600  FHVTSMATAGSRWGVVMSRNAGFSEQVVELDFLYPSEGIHRRWDGGYRITSTAATCDQAA  659

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  660  LILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  706



>ref|XP_003556554.1| PREDICTED: uncharacterized protein LOC100807373 [Glycine max]
Length=669

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIH+RW+ GYRIT+ AAT DQ+A
Sbjct  562  FHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSA  621

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  622  LILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  669



>gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F VTSMTTAGS+WG+VMSRNAGY  QVVELDFLYP EGIHRRWESGYRITS AATADQAA
Sbjct  557  FSVTSMTTAGSKWGIVMSRNAGYPNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAA  616

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS P+RK  D  QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  617  FILSAPKRKSSDVAQETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  663


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 56/104 (54%), Gaps = 7/104 (7%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPCEGIHRRWESGYRITSMAATADQ  176
             +++ + ++ + W ++M    G++ QV EL   FL+  E I  +W+  Y ITS+A TA+ 
Sbjct  463  LYISCVASSANLWAIIMDAGTGFTSQVHELSPIFLHK-EWIMEQWDKNYYITSVAGTANG  521

Query  177  AAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  305
            +A ++     K    TQ++ + S  FP   + +KW +   + S+
Sbjct  522  SALVV---MSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSM  562



>ref|XP_006407187.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
 gb|ESQ48640.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
Length=703

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  596  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  656  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>ref|XP_006297084.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
 gb|EOA29982.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
Length=704

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  597  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  657  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  703



>ref|XP_010936996.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITSMAAT DQAA
Sbjct  493  FHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAA  552

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  553  LILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  599



>ref|XP_010936995.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X1 [Elaeis 
guineensis]
Length=601

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITSMAAT DQAA
Sbjct  494  FHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAA  553

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  554  LILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  600



>ref|XP_010465212.1| PREDICTED: uncharacterized protein LOC104745616 [Camelina sativa]
Length=714

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  607  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  666

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  667  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  713



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRIT+ AAT DQ+A
Sbjct  565  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSA  624

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  625  LILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>ref|XP_002882838.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59097.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  596  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  656  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRIT+ AAT DQ+A
Sbjct  565  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSA  624

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  625  LILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRIT+ AAT DQ+A
Sbjct  601  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  661  LILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  708



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  612  FHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  671

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  672  FVLSVPRRRPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>ref|XP_009146466.1| PREDICTED: uncharacterized protein LOC103870106 [Brassica rapa]
Length=689

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EG+HRRW+ GYRITS AAT DQAA
Sbjct  582  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAA  641

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  642  LILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  688



>gb|KFK38714.1| hypothetical protein AALP_AA3G150500 [Arabis alpina]
Length=700

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  593  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  652

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  653  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  699



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M TAGSRW +VMSR AG+SEQVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  570  FHVTAMATAGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAA  629

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  630  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>ref|XP_010500960.1| PREDICTED: uncharacterized protein LOC104778257 isoform X1 [Camelina 
sativa]
Length=711

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  604  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  663

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  664  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  710



>emb|CDX97505.1| BnaA05g25740D [Brassica napus]
Length=653

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EG+HRRW+ GYRITS AAT DQAA
Sbjct  546  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAA  605

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  606  LILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  652



>ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F VTSM TAGSRWGVVMSRNAG+++QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  596  FFVTSMATAGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PR+K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  656  FVLSVPRKKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  702



>ref|XP_010487127.1| PREDICTED: serine/threonine-protein kinase STE20-like [Camelina 
sativa]
Length=717

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  610  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  669

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  670  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  716



>gb|KHN18151.1| Casein kinase I like 2 [Glycine soja]
Length=486

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  379  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAA  438

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  439  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  485



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  405  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  464

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  465  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  511



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRWGVVMSR+AG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  586  FYVTSMATAGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  645

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  646  FVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  692



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRWGVVMSR+AG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  590  FYVTSMATAGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  649

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  650  FVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  696



>ref|XP_010257513.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257516.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257517.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
Length=726

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  619  FHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  678

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  679  LILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRTV  725



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW VVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  576  FYVTAMATAGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  635

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLYIASICYGRTV
Sbjct  636  FVLSVPRRKPADETQETLRTSAFPSQHVKEKWSKNLYIASICYGRTV  682



>emb|CDY55141.1| BnaC01g44810D [Brassica napus]
Length=632

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EG+HRRW+ G+RITS AAT DQAA
Sbjct  525  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAA  584

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  585  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  631



>ref|XP_007135639.1| hypothetical protein PHAVU_010G145900g [Phaseolus vulgaris]
 gb|ESW07633.1| hypothetical protein PHAVU_010G145900g [Phaseolus vulgaris]
Length=711

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM T+G RWGVVMSR AGYS+QV+ELDFLYP EGIH+RW+SGYRITS AAT DQAA
Sbjct  604  FYVTSMATSGPRWGVVMSRGAGYSDQVIELDFLYPSEGIHKRWDSGYRITSTAATWDQAA  663

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  664  FVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  710


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 56/103 (54%), Gaps = 3/103 (3%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPCEGIHRRWESGYRITSMAATADQA  179
             +++S+ ++ + W ++M    G++ QV EL  F    E I  +WE GY I+++A  A+ +
Sbjct  510  LYISSVASSQNVWALIMDAGTGFAGQVYELSPFFLHKEWIVEQWELGYYISAIAGAANGS  569

Query  180  AFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  308
            + ++     + + ++ +   + +FP   + +KW +  Y+ S+ 
Sbjct  570  SLVVMSKGTQFVQQSYKV--SDSFPFKWINKKWREGFYVTSMA  610



>emb|CDY51730.1| BnaA01g37130D [Brassica napus]
Length=684

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EG+HRRW+ G+RITS AAT DQAA
Sbjct  577  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAA  636

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  637  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  683



>gb|ADE76410.1| unknown [Picea sitchensis]
Length=444

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM+TA SRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+ G+RIT+ AAT DQAA
Sbjct  337  FYVTSMSTAASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITATAATWDQAA  396

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS+P+RK  DETQETLRTSAFPSTHVKEKW+KNLY+A++CYGRTV
Sbjct  397  FILSVPKRKPGDETQETLRTSAFPSTHVKEKWAKNLYLAAVCYGRTV  443



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYP EGIHRRW++GYRIT+ AAT DQAA
Sbjct  612  FHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAA  671

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  672  FVLSVPRRRPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>ref|XP_002880706.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56965.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=674

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  567  FYVTSMATAGSKWGIVMSRGANFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAA  626

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  627  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  673



>ref|NP_187977.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01914.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AAL85021.1| putative casein kinase [Arabidopsis thaliana]
 gb|AAM51279.1| putative casein kinase [Arabidopsis thaliana]
 gb|AEE75390.1| protein kinase family protein [Arabidopsis thaliana]
Length=703

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  596  FHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  656  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYP EGIHRRW++G+RIT+ AAT DQAA
Sbjct  499  FYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAA  558

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  559  FVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  605



>emb|CDX75726.1| BnaC03g38090D [Brassica napus]
Length=652

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  545  FHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAA  604

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  605  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  651



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYP EGIHRRW++G+RIT+ AAT DQAA
Sbjct  603  FYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAA  662

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  663  FVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYP EGIHRRW++G+RIT+ AAT DQAA
Sbjct  597  FYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  657  FVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  703



>gb|KDP44321.1| hypothetical protein JCGZ_19188 [Jatropha curcas]
Length=710

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++G+RITS AAT DQAA
Sbjct  603  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATLDQAA  662

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  663  LILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  709



>ref|XP_009404157.1| PREDICTED: uncharacterized protein LOC103987553 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWG+VMSRNAG+S+QVVELDFLYP EGIHRRW+ GYRITSMAAT DQAA
Sbjct  618  FHVTSMATAGTRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITSMAATWDQAA  677

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTS+FPS HVK+KW+KNLY+ASICYGRTV
Sbjct  678  LILSVPKRKPGDETQETLRTSSFPSAHVKDKWAKNLYLASICYGRTV  724



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GY++QV+ELDFLYP EGIHRRW++GYRIT+ AAT DQ+A
Sbjct  568  FHVTSMATAGSRWGVVMSRNSGYTDQVIELDFLYPSEGIHRRWDNGYRITATAATWDQSA  627

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  628  LILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  675



>ref|XP_004142151.1| PREDICTED: uncharacterized protein LOC101213194 [Cucumis sativus]
 ref|XP_008449783.1| PREDICTED: uncharacterized protein LOC103491568 [Cucumis melo]
 gb|KGN54092.1| hypothetical protein Csa_4G285680 [Cucumis sativus]
Length=694

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  587  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAA  646

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV 
Sbjct  647  LILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTVA  694



>ref|XP_004162011.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213194 
[Cucumis sativus]
Length=694

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  587  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAA  646

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV 
Sbjct  647  LILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTVA  694



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRW VVMSR+AG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  590  FYVTSMATAGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  649

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  650  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAG+RWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+ GYRIT+ AAT DQAA
Sbjct  578  FYVTAMATAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITATAATMDQAA  637

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  638  FVLSVPRRKPTDETQETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  684



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRW VVMSR+AG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  586  FYVTSMATAGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  645

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  646  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  692



>ref|XP_008351086.1| PREDICTED: uncharacterized protein LOC103414488 [Malus domestica]
Length=486

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++G+RITS AAT DQAA
Sbjct  379  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAA  438

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  439  LILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  485



>ref|XP_006293796.1| hypothetical protein CARUB_v10022778mg [Capsella rubella]
 gb|EOA26694.1| hypothetical protein CARUB_v10022778mg [Capsella rubella]
Length=675

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  568  FYVTSMATAGSKWGIVMSRGASFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAA  627

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS+HVKEKW+KNLYIASICYGRTV
Sbjct  628  FVLSMPRRKLTDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRTV  674



>ref|XP_010033842.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 ref|XP_010033843.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 gb|KCW53681.1| hypothetical protein EUGRSUZ_J02945 [Eucalyptus grandis]
Length=709

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRW +VMSR AG+SEQVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  602  FYVTSMGTAGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  661

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LSIPRRK  DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  662  FVLSIPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYLASICYGRTV  708



>ref|XP_008655737.1| PREDICTED: uncharacterized protein LOC103634938 [Zea mays]
 gb|AFW80326.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
 gb|AFW80327.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
Length=332

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW VVMSRNAG++ QVVELDFLYP EGIH RW++GYRIT+ AAT DQAA
Sbjct  225  FYVTAMATAGSRWAVVMSRNAGFTSQVVELDFLYPSEGIHMRWDNGYRITATAATWDQAA  284

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIPRRK  DETQETLRTSAFPS HVK+KWSKNLY+ASICYGR+V
Sbjct  285  FILSIPRRKPSDETQETLRTSAFPSQHVKDKWSKNLYLASICYGRSV  331



>ref|NP_973532.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC07749.1| protein kinase family protein [Arabidopsis thaliana]
Length=676

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QV+ELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  569  FYVTSMATAGSKWGIVMSRGASFSDQVIELDFLYPSEGIHRRWENGYRITSVAATWDQAA  628

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  629  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  675



>ref|NP_180147.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC07748.1| protein kinase family protein [Arabidopsis thaliana]
Length=673

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QV+ELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  566  FYVTSMATAGSKWGIVMSRGASFSDQVIELDFLYPSEGIHRRWENGYRITSVAATWDQAA  625

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  626  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  672



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRIT+ AAT DQ+A
Sbjct  492  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSA  551

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  552  LILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  599



>ref|XP_009413490.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413491.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW++GYRIT M AT DQAA
Sbjct  610  FHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITCMGATWDQAA  669

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  670  LILSVPKRKPCDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  716



>ref|XP_008228435.1| PREDICTED: uncharacterized protein LOC103327845 [Prunus mume]
Length=706

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M T+GSRW VVMSR AGYSEQVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  599  FYVTAMATSGSRWAVVMSRGAGYSEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAA  658

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  659  FVLSVPRRKPQDETQETLRTSAFPSTHVKEKWAKNLYIASMCYGRTV  705



>gb|KHN39248.1| Casein kinase I isoform delta-like, partial [Glycine soja]
Length=661

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM T+GSRWGVVMSR AG+S+QVVELDFLYP EGIH+RW+ GYRIT+ AAT DQAA
Sbjct  554  FYVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCGYRITATAATWDQAA  613

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  614  FVLSVPRRKPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  660



>emb|CBI16476.3| unnamed protein product [Vitis vinifera]
Length=603

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQ+A
Sbjct  496  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSA  555

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  556  LILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  602



>ref|XP_009117581.1| PREDICTED: uncharacterized protein LOC103842673 [Brassica rapa]
Length=683

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYP EG+HRRW+ G+RITS AAT DQAA
Sbjct  576  FHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAA  635

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++D+TQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  636  LILSIPRRRLVDKTQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  682



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M TAGSRW +VMSR AG+S QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  576  FHVTAMATAGSRWAIVMSRGAGFSXQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAA  635

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  636  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  682



>ref|XP_010472590.1| PREDICTED: uncharacterized protein LOC104752211 [Camelina sativa]
Length=676

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  569  FYVTSMATAGSKWGIVMSRGACFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAA  628

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  629  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  675



>gb|KJB21848.1| hypothetical protein B456_004G018000 [Gossypium raimondii]
Length=704

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  597  FYVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATLDQAA  656

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIP+RK  DETQETLRTS FPS HVKEKW+KNLY+A +CYGRTV
Sbjct  657  LILSIPKRKPGDETQETLRTSQFPSIHVKEKWAKNLYLACLCYGRTV  703



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRIT+ AAT DQ+A
Sbjct  560  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSA  619

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  620  LILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  667



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  564  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  623

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  624  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  670



>gb|KDP34168.1| hypothetical protein JCGZ_07739 [Jatropha curcas]
Length=681

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  574  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  633

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  634  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  680



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F VTSMTTAGSRWG+VMSRNAG+S QVVELDFLYP EGIHRRWESGYRITS AATADQAA
Sbjct  522  FFVTSMTTAGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAA  581

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  582  FILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  628



>ref|XP_011006418.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006419.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006420.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006421.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
Length=691

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+ GYRITS AAT DQAA
Sbjct  584  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDGGYRITSTAATWDQAA  643

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  644  FVLSVPRRKLADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  690



>ref|XP_006583050.1| PREDICTED: uncharacterized protein LOC100800869 [Glycine max]
Length=723

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM T+GSRWGVVMSR AG+S+QVVELDFLYP EGIH+RW+ GYRIT+ AAT DQAA
Sbjct  616  FYVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCGYRITATAATWDQAA  675

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  676  FVLSVPRRKPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  722



>ref|XP_008445007.1| PREDICTED: uncharacterized protein LOC103488176 [Cucumis melo]
Length=699

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAG RW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  592  FYVTAMATAGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATLDQAA  651

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  652  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698



>gb|EMT21659.1| Casein kinase I-RAG8-like protein [Aegilops tauschii]
Length=640

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYS Q+VELDFLYP EGIH RWE GYRITS AAT DQAA
Sbjct  533  FHVTSMATAGNRWGVVMSRNSGYSGQIVELDFLYPSEGIHWRWEHGYRITSSAATGDQAA  592

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  593  FILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  639



>ref|XP_010429582.1| PREDICTED: uncharacterized protein LOC104714043 [Camelina sativa]
Length=677

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  570  FYVTSMATAGSKWGIVMSRGAYFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAA  629

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  630  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  676



>ref|XP_007014775.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY32394.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=701

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITS AAT+DQAA
Sbjct  594  FYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATSDQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  654  LILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  700



>ref|XP_002531638.1| casein kinase, putative [Ricinus communis]
 gb|EEF30734.1| casein kinase, putative [Ricinus communis]
Length=703

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++G+RITS AAT DQAA
Sbjct  596  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATFDQAA  655

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  656  LILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  702



>ref|XP_008392669.1| PREDICTED: uncharacterized protein LOC103454855 [Malus domestica]
Length=708

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M T+GSRW VVMSR A Y++QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  601  FHVTAMATSGSRWAVVMSRGANYTDQVVELDFLYPSEGIHRRWDSGYRITATAATCDQAA  660

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LSIP+RK+ DETQETLRTS FPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  661  FVLSIPKRKLQDETQETLRTSVFPSTHVKEKWAKNLYLASICYGRTV  707



>emb|CAN69523.1| hypothetical protein VITISV_040873 [Vitis vinifera]
Length=670

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQ+A
Sbjct  563  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSA  622

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  623  LILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  669



>ref|XP_006476018.1| PREDICTED: uncharacterized protein LOC102627154 isoform X1 [Citrus 
sinensis]
Length=697

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  590  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  649

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  650  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_006450715.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 ref|XP_006450716.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63955.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63956.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
Length=697

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  590  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  649

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  650  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_009349729.1| PREDICTED: uncharacterized protein LOC103941259 isoform X2 [Pyrus 
x bretschneideri]
Length=686

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M T+GSRW VVMSR A Y++QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  579  FHVTAMATSGSRWAVVMSRGANYTDQVVELDFLYPSEGIHRRWDSGYRITATAATCDQAA  638

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LSIP+RK+ DETQETLRTS FPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  639  FVLSIPKRKLQDETQETLRTSVFPSTHVKEKWAKNLYLASICYGRTV  685



>gb|KDO79859.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79860.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79861.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79862.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79863.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=697

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  590  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  649

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  650  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_009349728.1| PREDICTED: uncharacterized protein LOC103941259 isoform X1 [Pyrus 
x bretschneideri]
Length=710

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M T+GSRW VVMSR A Y++QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQAA
Sbjct  603  FHVTAMATSGSRWAVVMSRGANYTDQVVELDFLYPSEGIHRRWDSGYRITATAATCDQAA  662

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LSIP+RK+ DETQETLRTS FPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  663  FVLSIPKRKLQDETQETLRTSVFPSTHVKEKWAKNLYLASICYGRTV  709



>ref|XP_009367436.1| PREDICTED: uncharacterized protein LOC103957076 [Pyrus x bretschneideri]
Length=677

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M TA SRW +VMSR AG+S+QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  570  FHVTAMATARSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAA  629

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  630  FVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>ref|XP_010093160.1| Casein kinase I [Morus notabilis]
 gb|EXB53619.1| Casein kinase I [Morus notabilis]
Length=801

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRIT+ AAT DQ+A
Sbjct  694  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQSA  753

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  754  LILSIPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  800



>ref|XP_010417347.1| PREDICTED: uncharacterized protein LOC104703104 isoform X1 [Camelina 
sativa]
Length=678

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  571  FYVTSMATAGSKWGIVMSRGAYFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAA  630

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  631  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  677



>ref|XP_008338530.1| PREDICTED: casein kinase I homolog 2-like [Malus domestica]
Length=538

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+ G+RITS AAT DQAA
Sbjct  431  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITSTAATWDQAA  490

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  491  LILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  537



>ref|XP_008797939.1| PREDICTED: uncharacterized protein LOC103712966 isoform X4 [Phoenix 
dactylifera]
Length=727

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITSMAAT DQAA
Sbjct  620  FHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAA  679

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  680  LILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  726



>ref|XP_010417348.1| PREDICTED: uncharacterized protein LOC104703104 isoform X2 [Camelina 
sativa]
 ref|XP_010417349.1| PREDICTED: uncharacterized protein LOC104703104 isoform X3 [Camelina 
sativa]
Length=678

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGS+WG+VMSR A +S+QVVELDFLYP EGIHRRWE+GYRITS+AAT DQAA
Sbjct  571  FYVTSMATAGSKWGIVMSRGAYFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAA  630

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  631  FVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  677



>ref|XP_008797930.1| PREDICTED: uncharacterized protein LOC103712966 isoform X3 [Phoenix 
dactylifera]
Length=728

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITSMAAT DQAA
Sbjct  621  FHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAA  680

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  681  LILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  727



>ref|XP_009135319.1| PREDICTED: uncharacterized protein LOC103859531 [Brassica rapa]
Length=676

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQ A
Sbjct  569  FHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQTA  628

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  629  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  675



>ref|XP_008797922.1| PREDICTED: uncharacterized protein LOC103712966 isoform X2 [Phoenix 
dactylifera]
Length=731

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITSMAAT DQAA
Sbjct  624  FHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAA  683

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  684  LILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  730



>ref|XP_008797915.1| PREDICTED: uncharacterized protein LOC103712966 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITSMAAT DQAA
Sbjct  625  FHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAA  684

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  685  LILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  731



>ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera]
Length=714

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQ+A
Sbjct  607  FHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSA  666

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  667  LILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  713



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F VTSMTTAGSRWG+VMSRNAG+S QVVELDFLYP EGIHRRWESGYRITS AATADQAA
Sbjct  593  FFVTSMTTAGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAA  652

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  653  FILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  699



>emb|CDX82524.1| BnaA03g32970D [Brassica napus]
Length=654

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYP EGIHRRW+ G+RITS AAT DQ A
Sbjct  547  FHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQTA  606

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  607  LILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  653



>gb|KJB07481.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=485

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR A +S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  378  FYVTAMATAGSRWAIVMSRGAPFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  437

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  438  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  484



>gb|KHN10182.1| Casein kinase I like 2 [Glycine soja]
Length=606

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  499  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  558

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  559  FVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  605



>ref|XP_003523751.1| PREDICTED: uncharacterized protein LOC100779382 isoform X1 [Glycine 
max]
 ref|XP_006578236.1| PREDICTED: uncharacterized protein LOC100779382 isoform X2 [Glycine 
max]
 ref|XP_006578237.1| PREDICTED: uncharacterized protein LOC100779382 isoform X3 [Glycine 
max]
 ref|XP_006578238.1| PREDICTED: uncharacterized protein LOC100779382 isoform X4 [Glycine 
max]
Length=710

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  603  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  662

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  663  FVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  709



>ref|XP_004148393.1| PREDICTED: uncharacterized protein LOC101218249 [Cucumis sativus]
 ref|XP_004162975.1| PREDICTED: uncharacterized LOC101218249 [Cucumis sativus]
Length=695

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAG RW +VMSR AG+S+QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  588  FYVTAMATAGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATLDQAA  647

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  648  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  694



>tpg|DAA54811.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=186

 Score =   182 bits (462),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M T+G+RW +VMSR+AG+SEQVVELDFLYP EGIHRRW++G+RIT+MAAT DQ+A
Sbjct  79   FHVTAMATSGNRWAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSA  138

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILS PRR+  DETQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  139  LILSKPRRRPRDETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  186



>ref|XP_007014774.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY32393.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=891

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYP EGIHRRW++GYRITS AAT+DQAA
Sbjct  784  FYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATSDQAA  843

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  844  LILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  890



>gb|KGN62809.1| hypothetical protein Csa_2G373520 [Cucumis sativus]
Length=699

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAG RW +VMSR AG+S+QVVELDFLYP EGIHRRW++GYRITS AAT DQAA
Sbjct  592  FYVTAMATAGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATLDQAA  651

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  652  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698



>ref|XP_010546534.1| PREDICTED: uncharacterized protein LOC104818596 [Tarenaya hassleriana]
Length=701

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS+AAT DQAA
Sbjct  594  FYVTSMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSLAATLDQAA  653

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
             ILS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIA ICYGRTV
Sbjct  654  LILSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIAYICYGRTV  700


 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 55/103 (53%), Gaps = 9/103 (9%)
 Frame = +3

Query  9    VTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPC----EGIHRRWESGYRITSMAATADQ  176
            ++S+ +  + W ++M    GY+ QV +L    PC    E I  +WE+ Y IT++A T + 
Sbjct  502  ISSVASCSNLWALIMDAGTGYTAQVYQLS---PCFLHKEWIMEQWENNYYITAIAGTNNG  558

Query  177  AAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASI  305
            ++ ++     + + ++ +   + +FP   + +KW +  Y+ S+
Sbjct  559  SSLVVMSKGTQYLQQSYKV--SESFPFKWINKKWREGFYVTSM  599



>gb|KDP40868.1| hypothetical protein JCGZ_24867 [Jatropha curcas]
Length=720

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVT+M TAG+RWGVVMSR AG++ QVVELDFLYP EGIHRRW+ GYRIT+ AA  DQAA
Sbjct  613  FHVTAMATAGNRWGVVMSRGAGFAHQVVELDFLYPSEGIHRRWDHGYRITATAANLDQAA  672

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  673  FVLSVPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  719



>ref|XP_003531651.1| PREDICTED: uncharacterized protein LOC100799630 [Glycine max]
 gb|KHN05338.1| Casein kinase I isoform delta-like [Glycine soja]
Length=711

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M T+GSRWGVVMSR AG+S+QVVELDFLYP EGIH+RW+ GYRIT+ AAT DQAA
Sbjct  604  FYVTAMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCGYRITATAATWDQAA  663

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  664  FVLSVPRRKPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  710



>ref|XP_004155952.1| PREDICTED: uncharacterized protein LOC101230855 [Cucumis sativus]
Length=716

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M T+GSRWGVVMSR +G+S+QVVELDFLYP EGIHRRW+ GYRIT+ AAT+DQAA
Sbjct  609  FYVTAMATSGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATSDQAA  668

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  669  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  715



>ref|XP_006644695.1| PREDICTED: casein kinase I homolog 1-like [Oryza brachyantha]
Length=598

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VTSM TAGSRW VVMSRNAG+S+QVVELDFLYP EGIH+RW++GYRIT+ AAT DQAA
Sbjct  491  FYVTSMATAGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHKRWDNGYRITATAATWDQAA  550

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLY+AS+CYGRTV
Sbjct  551  FVLSVPRRKPTDETQETLRTSAFPSQHVKEKWSKNLYLASVCYGRTV  597



>gb|KGN45587.1| hypothetical protein Csa_7G452910 [Cucumis sativus]
Length=720

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M T+GSRWGVVMSR +G+S+QVVELDFLYP EGIHRRW+ GYRIT+ AAT+DQAA
Sbjct  613  FYVTAMATSGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATSDQAA  672

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  673  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  719



>ref|XP_002324211.2| hypothetical protein POPTR_0018s08230g [Populus trichocarpa]
 gb|EEF02776.2| hypothetical protein POPTR_0018s08230g [Populus trichocarpa]
Length=687

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+ GYRITS AAT DQAA
Sbjct  580  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDGGYRITSTAATWDQAA  639

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  640  FVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  686



>ref|XP_003523750.1| PREDICTED: uncharacterized protein LOC100778855 isoform X1 [Glycine 
max]
Length=663

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW +VMSR AG+S+QVVELDFLYP EGIHRRW+SGYRITS AAT DQAA
Sbjct  556  FYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAA  615

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  616  FVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  662



>ref|XP_004141661.1| PREDICTED: uncharacterized protein LOC101213589 [Cucumis sativus]
Length=716

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M T+GSRWGVVMSR +G+S+QVVELDFLYP EGIHRRW+ GYRIT+ AAT+DQAA
Sbjct  609  FYVTAMATSGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATSDQAA  668

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            F+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  669  FVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  715



>ref|XP_002884419.1| hypothetical protein ARALYDRAFT_340552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60678.1| hypothetical protein ARALYDRAFT_340552 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   185 bits (469),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            FHVTSMTTAGS WGVVMSRN+G+SEQV+ELDFL P E I+RR ESGYRITSMAATADQAA
Sbjct  181  FHVTSMTTAGSGWGVVMSRNSGFSEQVMELDFLNPSEDINRRLESGYRITSMAATADQAA  240

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  326
             ILSIP+RK+ DE QETLRTS+FPS+++K+KW KN++I SICYGRTVC
Sbjct  241  LILSIPKRKITDEIQETLRTSSFPSSYIKDKWEKNMFITSICYGRTVC  288



>dbj|BAG92829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62667.1| hypothetical protein OsJ_17470 [Oryza sativa Japonica Group]
Length=607

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW VVMSRNAG+++QVVELDFLYP EGIHRRW++G+RIT+ AAT DQAA
Sbjct  500  FYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAA  559

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  560  FILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>gb|EEC78673.1| hypothetical protein OsI_18806 [Oryza sativa Indica Group]
Length=607

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    FHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPCEGIHRRWESGYRITSMAATADQAA  182
            F+VT+M TAGSRW VVMSRNAG+++QVVELDFLYP EGIHRRW++G+RIT+ AAT DQAA
Sbjct  500  FYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAA  559

Query  183  FILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  323
            FILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  560  FILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552667832160