BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN030I07

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC40984.1|  chloroplast allene oxide cyclase precursor              266   2e-86   Ipomoea nil [qian niu]
emb|CAC83765.1|  allene oxide cyclase                                   212   4e-65   Nicotiana tabacum [American tobacco]
ref|XP_009790745.1|  PREDICTED: allene oxide cyclase 4, chloropla...    212   4e-65   Nicotiana sylvestris
ref|NP_001289444.1|  uncharacterized protein LOC104120106               209   7e-64   Nicotiana tomentosiformis
gb|ACD12705.1|  AOC                                                     207   5e-63   Petunia x hybrida [garden petunia]
ref|XP_006363132.1|  PREDICTED: allene oxide cyclase 3, chloropla...    199   4e-60   
gb|AAU11327.1|  allene oxide cyclase                                    196   6e-59   Hyoscyamus niger [black henbane]
ref|NP_001234019.1|  allene oxide cyclase                               195   2e-58   Solanum lycopersicum
gb|ABK94763.1|  unknown                                                 194   6e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002305951.2|  mangrin family protein                             194   7e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011004427.1|  PREDICTED: allene oxide cyclase 3, chloropla...    194   8e-58   Populus euphratica
ref|XP_010061864.1|  PREDICTED: allene oxide cyclase 4, chloropla...    194   8e-58   Eucalyptus grandis [rose gum]
gb|AAA80500.1|  unknown                                                 192   1e-57   Solanum lycopersicum
ref|NP_001275212.1|  allene oxide cyclase                               193   1e-57   Solanum tuberosum [potatoes]
gb|ABK96763.1|  unknown                                                 193   2e-57   Populus trichocarpa x Populus deltoides
ref|XP_011021206.1|  PREDICTED: allene oxide cyclase 3, chloropla...    192   3e-57   Populus euphratica
ref|XP_010103817.1|  Allene oxide cyclase 4                             191   7e-57   Morus notabilis
ref|XP_011099573.1|  PREDICTED: LOW QUALITY PROTEIN: allene oxide...    191   1e-56   Sesamum indicum [beniseed]
gb|ADY38579.1|  allene oxide cyclase                                    190   1e-56   Camellia sinensis [black tea]
gb|AEE99197.1|  allene oxide cyclase 2                                  190   2e-56   Glycine max [soybeans]
gb|ACU24579.1|  unknown                                                 189   2e-56   Glycine max [soybeans]
ref|XP_003518680.1|  PREDICTED: allene oxide cyclase 4, chloropla...    190   2e-56   
gb|ACZ06580.1|  allene oxide cyclase                                    190   2e-56   Jatropha curcas
gb|EYU44656.1|  hypothetical protein MIMGU_mgv1a012403mg                190   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_007033323.1|  Allene oxide cyclase 4 isoform 1                   190   3e-56   
ref|XP_006482294.1|  PREDICTED: allene oxide cyclase 4, chloropla...    190   3e-56   Citrus sinensis [apfelsine]
ref|NP_001241361.1|  allene oxide cyclase 4, chloroplastic-like         190   3e-56   Glycine max [soybeans]
ref|XP_003614458.1|  Allene oxide cyclase                               189   3e-56   Medicago truncatula
ref|XP_007033324.1|  Allene oxide cyclase isoform 2                     187   4e-56   
ref|XP_004309482.1|  PREDICTED: allene oxide cyclase 3, chloropla...    189   4e-56   Fragaria vesca subsp. vesca
ref|XP_004514328.1|  PREDICTED: allene oxide cyclase 3, chloropla...    189   6e-56   Cicer arietinum [garbanzo]
emb|CDP02799.1|  unnamed protein product                                189   6e-56   Coffea canephora [robusta coffee]
ref|XP_008459463.1|  PREDICTED: allene oxide cyclase 4, chloropla...    189   8e-56   Cucumis melo [Oriental melon]
dbj|BAE45342.1|  allene oxide cyclase                                   189   9e-56   Pisum sativum [garden pea]
ref|XP_006430815.1|  hypothetical protein CICLE_v10012552mg             188   1e-55   Citrus clementina [clementine]
gb|AFV68275.1|  allene oxide cyclase                                    188   1e-55   Catharanthus roseus [chatas]
ref|NP_001240078.1|  allene oxide cyclase 3, chloroplastic-like         188   1e-55   Glycine max [soybeans]
ref|XP_002530384.1|  Allene oxide cyclase 4, chloroplast precurso...    188   1e-55   Ricinus communis
ref|XP_010265246.1|  PREDICTED: allene oxide cyclase 2, chloropla...    188   2e-55   Nelumbo nucifera [Indian lotus]
ref|NP_001240200.1|  membrane primary amine oxidase                     188   2e-55   Glycine max [soybeans]
ref|XP_009394846.1|  PREDICTED: allene oxide cyclase 1, chloropla...    187   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP00580.1|  unnamed protein product                                187   4e-55   Coffea canephora [robusta coffee]
ref|NP_001240033.1|  allene oxide cyclase 4, chloroplastic-like         187   4e-55   Glycine max [soybeans]
gb|ACU19690.1|  unknown                                                 187   5e-55   Glycine max [soybeans]
gb|AGR49302.1|  allene oxide cyclase                                    186   6e-55   Catharanthus roseus [chatas]
ref|XP_007139329.1|  hypothetical protein PHAVU_008G020200g             186   7e-55   Phaseolus vulgaris [French bean]
gb|AFB69864.1|  allene oxide cyclase                                    185   1e-54   Salvia miltiorrhiza [Chinese salvia]
gb|KHN47545.1|  Allene oxide cyclase 4, chloroplastic                   186   1e-54   Glycine soja [wild soybean]
ref|NP_001242726.1|  allene oxide cyclase 4, chloroplastic-like         186   2e-54   Glycine max [soybeans]
ref|XP_008339701.1|  PREDICTED: allene oxide cyclase 4, chloropla...    185   2e-54   
ref|XP_009356280.1|  PREDICTED: allene oxide cyclase 4, chloropla...    185   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_008465778.1|  PREDICTED: allene oxide cyclase 1, chloropla...    185   3e-54   Cucumis melo [Oriental melon]
ref|XP_008459462.1|  PREDICTED: allene oxide cyclase 4, chloropla...    185   3e-54   
ref|XP_010093405.1|  Allene oxide cyclase 4                             184   5e-54   Morus notabilis
gb|KJB22404.1|  hypothetical protein B456_004G046400                    184   5e-54   Gossypium raimondii
gb|KHG19305.1|  Allene oxide cyclase 4, chloroplastic -like protein     184   5e-54   Gossypium arboreum [tree cotton]
ref|XP_009336614.1|  PREDICTED: allene oxide cyclase 4, chloropla...    184   6e-54   Pyrus x bretschneideri [bai li]
gb|AFK41265.1|  unknown                                                 184   6e-54   Lotus japonicus
gb|KJB22342.1|  hypothetical protein B456_004G046100                    184   6e-54   Gossypium raimondii
ref|XP_007154351.1|  hypothetical protein PHAVU_003G111500g             184   7e-54   Phaseolus vulgaris [French bean]
dbj|BAB21610.2|  mangrin                                                184   7e-54   Bruguiera sexangula
ref|XP_009392456.1|  PREDICTED: allene oxide cyclase 3, chloropla...    184   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297139.1|  PREDICTED: allene oxide cyclase 3, chloropla...    184   8e-54   Fragaria vesca subsp. vesca
ref|XP_008243177.1|  PREDICTED: allene oxide cyclase 3, chloropla...    184   8e-54   Prunus mume [ume]
ref|XP_008389309.1|  PREDICTED: allene oxide cyclase 4, chloropla...    183   9e-54   
gb|AFK38605.1|  unknown                                                 183   1e-53   Lotus japonicus
gb|AFK47606.1|  unknown                                                 183   1e-53   Medicago truncatula
gb|KEH21777.1|  allene oxide cyclase                                    183   1e-53   Medicago truncatula
ref|XP_007046300.1|  Allene oxide cyclase                               183   1e-53   Theobroma cacao [chocolate]
ref|XP_007223720.1|  hypothetical protein PRUPE_ppa010397mg             183   1e-53   Prunus persica
emb|CAI29046.1|  allene-oxide cyclase                                   183   1e-53   Medicago truncatula
ref|XP_008459464.1|  PREDICTED: allene oxide cyclase 4, chloropla...    182   2e-53   
ref|XP_010660502.1|  PREDICTED: allene oxide cyclase                    183   2e-53   Vitis vinifera
ref|XP_008230384.1|  PREDICTED: allene oxide cyclase 4, chloropla...    180   2e-53   Prunus mume [ume]
gb|KJB50746.1|  hypothetical protein B456_008G185600                    182   2e-53   Gossypium raimondii
ref|XP_007215041.1|  hypothetical protein PRUPE_ppa012079mg             180   2e-53   Prunus persica
ref|XP_010044291.1|  PREDICTED: allene oxide cyclase 3, chloropla...    182   3e-53   Eucalyptus grandis [rose gum]
gb|KHG22804.1|  Allene oxide cyclase 4, chloroplastic -like protein     182   3e-53   Gossypium arboreum [tree cotton]
gb|KHG22803.1|  Allene oxide cyclase 4, chloroplastic -like protein     182   3e-53   Gossypium arboreum [tree cotton]
gb|EYU29945.1|  hypothetical protein MIMGU_mgv1a012640mg                181   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_003637011.1|  Allene oxide cyclase C4                            181   5e-53   
ref|XP_004141500.1|  PREDICTED: allene oxide cyclase 4, chloropla...    181   5e-53   Cucumis sativus [cucumbers]
gb|KHG03969.1|  Allene oxide cyclase 4, chloroplastic -like protein     181   7e-53   Gossypium arboreum [tree cotton]
gb|AAT96852.1|  allene oxide cyclase C4                                 181   8e-53   Humulus lupulus [common hop]
gb|AGU09699.1|  allene oxide cyclase                                    181   1e-52   Gossypium hirsutum [American cotton]
gb|KHG12052.1|  Allene oxide cyclase 3, chloroplastic -like protein     181   1e-52   Gossypium arboreum [tree cotton]
gb|KHG19308.1|  Allene oxide cyclase 4, chloroplastic -like protein     178   1e-52   Gossypium arboreum [tree cotton]
gb|AAX56078.1|  allene oxide cyclase                                    181   1e-52   Camptotheca acuminata
gb|AAT96851.1|  allene oxide cyclase C1                                 181   1e-52   Humulus lupulus [common hop]
ref|XP_006437732.1|  hypothetical protein CICLE_v10032510mg             181   1e-52   Citrus clementina [clementine]
ref|XP_011021732.1|  PREDICTED: allene oxide cyclase 3, chloropla...    180   2e-52   Populus euphratica
ref|XP_008810937.1|  PREDICTED: allene oxide cyclase 3, chloropla...    179   2e-52   Phoenix dactylifera
gb|KJB22328.1|  hypothetical protein B456_004G046300                    177   2e-52   Gossypium raimondii
gb|AEC11095.1|  allene oxide cyclase                                    179   3e-52   Torenia fournieri [bluewings]
ref|XP_004161644.1|  PREDICTED: allene oxide cyclase 3, chloropla...    179   3e-52   
ref|XP_004140337.1|  PREDICTED: allene oxide cyclase 3, chloropla...    179   3e-52   Cucumis sativus [cucumbers]
ref|XP_009394154.1|  PREDICTED: allene oxide cyclase 2, chloropla...    180   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007151755.1|  hypothetical protein PHAVU_004G072000g             179   4e-52   Phaseolus vulgaris [French bean]
gb|ABK21165.1|  unknown                                                 180   5e-52   Picea sitchensis
gb|KEH30395.1|  allene oxide cyclase                                    179   6e-52   Medicago truncatula
ref|XP_009357038.1|  PREDICTED: allene oxide cyclase 4, chloropla...    176   7e-52   Pyrus x bretschneideri [bai li]
ref|XP_008348108.1|  PREDICTED: allene oxide cyclase 4, chloropla...    176   7e-52   
ref|XP_008379524.1|  PREDICTED: allene oxide cyclase 4, chloropla...    176   8e-52   
ref|XP_004508556.1|  PREDICTED: allene oxide cyclase 3, chloropla...    178   9e-52   Cicer arietinum [garbanzo]
gb|ADE76918.1|  unknown                                                 179   1e-51   Picea sitchensis
ref|XP_002278768.1|  PREDICTED: allene oxide cyclase 4, chloropla...    177   2e-51   Vitis vinifera
gb|AET50928.1|  allene oxide cylase                                     177   2e-51   Lilium longiflorum [Easter lily]
gb|AEO13839.1|  allene oxide cyclase                                    177   2e-51   Gladiolus hybrid cultivar
gb|AAT66741.1|  plastid allene oxide cyclase                            177   4e-51   Humulus lupulus [common hop]
gb|AFH89625.1|  allene oxide cyclase                                    176   5e-51   Cymbidium ensifolium
gb|AHZ35333.1|  allene oxide cyclase                                    176   8e-51   Picrorhiza kurrooa
ref|XP_010916944.1|  PREDICTED: allene oxide cyclase 1, chloropla...    175   1e-50   Elaeis guineensis
gb|ADL60034.1|  allene oxide cyclase                                    174   2e-50   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009395977.1|  PREDICTED: allene oxide cyclase 1, chloropla...    176   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67695.1|  allene oxide cyclase                                    172   2e-50   Genlisea aurea
ref|XP_010924770.1|  PREDICTED: allene oxide cyclase 4, chloropla...    174   3e-50   Elaeis guineensis
gb|AHZ21033.1|  mangrin                                                 174   4e-50   Kandelia candel
ref|XP_006857130.1|  hypothetical protein AMTR_s00065p00146710          174   6e-50   Amborella trichopoda
dbj|BAI58542.1|  mangrin                                                171   8e-50   Rhizophora apiculata
ref|XP_008792377.1|  PREDICTED: allene oxide cyclase 4, chloropla...    172   1e-49   Phoenix dactylifera
gb|AIR76995.1|  allene oxide cyclase                                    169   1e-49   Lilium longiflorum [Easter lily]
ref|XP_004304145.1|  PREDICTED: allene oxide cyclase 4, chloropla...    170   2e-49   Fragaria vesca subsp. vesca
ref|XP_007042039.1|  Allene oxide cyclase, putative                     172   2e-49   
gb|ACS96438.1|  allene oxide cyclase                                    171   5e-49   Jatropha curcas
ref|XP_011078449.1|  PREDICTED: allene oxide cyclase 3, chloropla...    171   7e-49   
gb|ABO61151.1|  allene oxide cyclase                                    165   8e-49   Nicotiana attenuata
ref|XP_003637010.1|  Allene-oxide cyclase                               168   7e-48   
ref|XP_006430816.1|  hypothetical protein CICLE_v10012528mg             168   9e-48   Citrus clementina [clementine]
dbj|BAI58602.1|  mangrin                                                164   2e-47   Rhizophora mucronata
gb|ADL16493.1|  allene oxide cyclase                                    167   2e-47   Artemisia annua [sweet Annie]
ref|XP_006482293.1|  PREDICTED: allene oxide cyclase 4, chloropla...    166   5e-47   Citrus sinensis [apfelsine]
gb|AFP87550.1|  allene oxide cyclase 4                                  165   1e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001050447.1|  Os03g0438100                                       164   1e-46   
gb|EAZ27451.1|  hypothetical protein OsJ_11399                          164   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EMT08815.1|  Allene oxide cyclase 3, chloroplastic                   164   3e-46   
ref|XP_004983950.1|  PREDICTED: allene oxide cyclase 3, chloropla...    164   3e-46   Setaria italica
ref|XP_002465087.1|  hypothetical protein SORBIDRAFT_01g031870          164   4e-46   Sorghum bicolor [broomcorn]
ref|NP_001267900.1|  allene oxide cyclase                               164   5e-46   Vitis vinifera
ref|XP_006650236.1|  PREDICTED: allene oxide cyclase 3, chloropla...    163   5e-46   Oryza brachyantha
gb|KFK35078.1|  hypothetical protein AALP_AA5G232400                    163   8e-46   Arabis alpina [alpine rockcress]
ref|XP_002524412.1|  Allene oxide cyclase 3, chloroplast precurso...    163   1e-45   Ricinus communis
ref|XP_008359967.1|  PREDICTED: allene oxide cyclase 1, chloropla...    162   1e-45   
ref|XP_008388976.1|  PREDICTED: allene oxide cyclase 1, chloropla...    162   1e-45   
emb|CDY59866.1|  BnaC09g52550D                                          162   1e-45   Brassica napus [oilseed rape]
ref|NP_001141267.1|  allene oxide cyclase 4                             162   2e-45   Zea mays [maize]
gb|ACG39242.1|  allene oxide cyclase 4                                  162   2e-45   Zea mays [maize]
ref|NP_001105245.1|  allene oxide cyclase1                              161   2e-45   Zea mays [maize]
gb|AHA93095.1|  allene oxide cyclase 1                                  161   2e-45   Triticum aestivum [Canadian hard winter wheat]
gb|ACG32920.1|  allene oxide cyclase 4                                  161   3e-45   Zea mays [maize]
ref|XP_010556382.1|  PREDICTED: allene oxide cyclase 3, chloropla...    161   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_003562362.1|  PREDICTED: allene oxide cyclase 3, chloropla...    160   6e-45   Brachypodium distachyon [annual false brome]
gb|AFP87304.1|  chloroplast allene oxide cyclase                        160   6e-45   Leymus mollis
ref|XP_002875279.1|  hypothetical protein ARALYDRAFT_484340             160   7e-45   
dbj|BAJ96870.1|  predicted protein                                      160   7e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_566777.1|  allene oxide cyclase 3                                160   7e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CAC83766.1|  allene oxide cyclase                                   159   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACY74378.1|  allene oxidase cyclase                                  160   1e-44   Brassica napus [oilseed rape]
ref|XP_009114114.1|  PREDICTED: allene oxide cyclase 3, chloropla...    160   1e-44   Brassica rapa
gb|ACY74377.1|  allene oxidase cyclase                                  159   1e-44   Brassica napus [oilseed rape]
ref|XP_010692623.1|  PREDICTED: allene oxide cyclase 2, chloropla...    159   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692616.1|  PREDICTED: allene oxide cyclase 2, chloropla...    159   2e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|AGU41846.1|  allene oxide cyclase                                    159   2e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006292768.1|  hypothetical protein CARUB_v10019017mg             159   2e-44   Capsella rubella
gb|EYU29946.1|  hypothetical protein MIMGU_mgv1a012460mg                159   4e-44   Erythranthe guttata [common monkey flower]
ref|XP_010528046.1|  PREDICTED: allene oxide cyclase 3, chloropla...    158   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_010502459.1|  PREDICTED: allene oxide cyclase 3, chloropla...    158   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010514199.1|  PREDICTED: allene oxide cyclase 3, chloropla...    158   9e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006395626.1|  hypothetical protein EUTSA_v10004810mg             157   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010476324.1|  PREDICTED: allene oxide cyclase 4, chloropla...    157   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_001783824.1|  predicted protein                                  155   1e-43   
pdb|4H6B|A  Chain A, Structural Basis For Allene Oxide Cyclizatio...    155   1e-43   Physcomitrella patens
ref|NP_172786.1|  allene oxide cyclase 4                                157   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554241.1|  PREDICTED: allene oxide cyclase 3, chloropla...    157   2e-43   Tarenaya hassleriana [spider flower]
gb|AAG09557.1|AC011810_16  Unknown Protein                              154   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425230.1|  PREDICTED: allene oxide cyclase 3, chloropla...    155   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010425228.1|  PREDICTED: allene oxide cyclase 2, chloropla...    155   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010495179.1|  PREDICTED: allene oxide cyclase 4, chloropla...    155   7e-43   Camelina sativa [gold-of-pleasure]
gb|KFK43593.1|  hypothetical protein AALP_AA1G146300                    155   7e-43   Arabis alpina [alpine rockcress]
ref|XP_010514196.1|  PREDICTED: allene oxide cyclase 2, chloropla...    155   8e-43   
ref|XP_010458779.1|  PREDICTED: allene oxide cyclase 4, chloropla...    155   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006304140.1|  hypothetical protein CARUB_v10010123mg             154   1e-42   Capsella rubella
ref|XP_010514195.1|  PREDICTED: allene oxide cyclase 2, chloropla...    154   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010502447.1|  PREDICTED: allene oxide cyclase 2, chloropla...    154   2e-42   Camelina sativa [gold-of-pleasure]
gb|ACN27052.1|  unknown                                                 153   3e-42   Zea mays [maize]
ref|XP_006291745.1|  hypothetical protein CARUB_v10017913mg             153   4e-42   Capsella rubella
ref|XP_006291721.1|  hypothetical protein CARUB_v10017888mg             153   5e-42   Capsella rubella
pdb|4CQ6|A  Chain A, The Crystal Structure Of The Allene Oxide Cy...    151   5e-42   Arabidopsis thaliana [mouse-ear cress]
pdb|2GIN|A  Chain A, X-Ray Structure Of The Wt Allene Oxide Cycla...    151   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566776.1|  allene oxide cyclase 2                                152   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875278.1|  hypothetical protein ARALYDRAFT_484339             152   9e-42   
ref|XP_010425227.1|  PREDICTED: allene oxide cyclase 2, chloropla...    152   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010502446.1|  PREDICTED: allene oxide cyclase 2, chloropla...    152   1e-41   Camelina sativa [gold-of-pleasure]
pdb|1Z8K|A  Chain A, X-ray Structure Of Allene Oxide Cyclase From...    150   1e-41   Arabidopsis thaliana [mouse-ear cress]
pdb|2DIO|A  Chain A, Crystal Structure Of The Allene Oxide Cyclas...    150   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430726.1|  PREDICTED: allene oxide cyclase 2, chloropla...    153   1e-41   Camelina sativa [gold-of-pleasure]
pdb|2BRJ|A  Chain A, X-Ray Structure Of The Allene Oxide Cyclase ...    150   2e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83551.1|  BnaC07g22910D                                          151   3e-41   
ref|XP_002889998.1|  hypothetical protein ARALYDRAFT_334627             151   3e-41   
emb|CDY50180.1|  BnaC08g15790D                                          150   5e-41   Brassica napus [oilseed rape]
ref|XP_001751254.1|  predicted protein                                  148   6e-41   
emb|CDX83550.1|  BnaC07g22900D                                          150   6e-41   
pdb|4H69|A  Chain A, Crystal Structure Of The Allene Oxide Cyclas...    148   7e-41   Physcomitrella patens
pdb|1ZVC|A  Chain A, X-Ray Structure Of Allene Oxide Cyclase From...    148   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009152186.1|  PREDICTED: allene oxide cyclase 3, chloropla...    149   7e-41   Brassica rapa
ref|NP_189204.1|  allene oxide cyclase 1                                150   7e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB63918.1|  ERD12 protein                                          150   9e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK35075.1|  hypothetical protein AALP_AA5G232000                    156   1e-40   Arabis alpina [alpine rockcress]
emb|CAD48753.1|  allene oxide cyclase                                   147   1e-40   Physcomitrella patens
emb|CDY72244.1|  BnaCnng76690D                                          149   1e-40   Brassica napus [oilseed rape]
emb|CDY13582.1|  BnaA06g33410D                                          149   3e-40   Brassica napus [oilseed rape]
emb|CDY59869.1|  BnaC09g52570D                                          149   3e-40   Brassica napus [oilseed rape]
ref|XP_009114115.1|  PREDICTED: allene oxide cyclase 2, chloropla...    149   3e-40   Brassica rapa
ref|XP_009110591.1|  PREDICTED: allene oxide cyclase 4, chloropla...    148   3e-40   Brassica rapa
ref|XP_010514198.1|  PREDICTED: allene oxide cyclase 2, chloropla...    148   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006395628.1|  hypothetical protein EUTSA_v10004824mg             148   4e-40   Eutrema salsugineum [saltwater cress]
gb|ABV89668.1|  ERD12 protein                                           148   6e-40   Brassica rapa
ref|XP_008370524.1|  PREDICTED: allene oxide cyclase 2, chloropla...    147   7e-40   
emb|CAN68566.1|  hypothetical protein VITISV_032173                     147   1e-39   Vitis vinifera
ref|XP_010425226.1|  PREDICTED: allene oxide cyclase 2, chloropla...    146   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010502458.1|  PREDICTED: allene oxide cyclase 3, chloropla...    146   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002875277.1|  ERD12 protein                                      145   5e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_002969526.1|  hypothetical protein SELMODRAFT_91887              142   9e-39   
ref|XP_009152113.1|  PREDICTED: allene oxide cyclase 2, chloropla...    140   3e-37   Brassica rapa
ref|XP_010554242.1|  PREDICTED: allene oxide cyclase 3, chloropla...    140   3e-37   Tarenaya hassleriana [spider flower]
emb|CDY13583.1|  BnaA06g33400D                                          137   1e-36   Brassica napus [oilseed rape]
ref|XP_006373455.1|  hypothetical protein POPTR_0017s13940g             133   9e-36   
gb|KJB22383.1|  hypothetical protein B456_004G0462002                   119   4e-30   Gossypium raimondii
ref|XP_004156234.1|  PREDICTED: allene oxide cyclase 2, chloropla...    112   1e-27   
gb|KJB50748.1|  hypothetical protein B456_008G185600                    109   1e-25   Gossypium raimondii
ref|XP_006495473.1|  PREDICTED: allene oxide cyclase 4, chloropla...    103   6e-24   
ref|XP_001760307.1|  predicted protein                                  102   2e-23   
gb|AFW88168.1|  hypothetical protein ZEAMMB73_091885                    101   3e-23   
gb|EMS52587.1|  Allene oxide cyclase 3, chloroplastic                 99.4    5e-22   Triticum urartu
ref|XP_001779767.1|  predicted protein                                96.3    7e-21   
dbj|BAO93687.1|  allene oxide cyclase                                 93.6    1e-19   Marchantia polymorpha
ref|XP_001771240.1|  predicted protein                                93.2    2e-19   
ref|XP_009394152.1|  PREDICTED: uncharacterized protein LOC103979...  81.3    5e-15   
ref|XP_009394153.1|  PREDICTED: uncharacterized protein LOC103979...  80.9    6e-15   
gb|AGL75607.1|  mangrin                                               67.4    9e-12   Rhizophora apiculata
tpg|DAA45889.1|  TPA: hypothetical protein ZEAMMB73_165754            65.9    1e-10   
ref|XP_006417137.1|  hypothetical protein EUTSA_v10008630mg           67.0    2e-10   
ref|XP_003628626.1|  Allene-oxide cyclase                             63.5    9e-10   
ref|XP_007208176.1|  hypothetical protein PRUPE_ppa022035mg           52.8    2e-05   
dbj|BAN45359.1|  mangrin                                              47.4    1e-04   Bruguiera gymnorhiza [Burma mangrove]



>gb|ABC40984.1| chloroplast allene oxide cyclase precursor [Ipomoea nil]
Length=245

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +1

Query  130  ISSSAKLPSTSPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGKVQE  309
            ISSSAKLPSTSPAVLKFQPFKRTNPLISKSLGLTASTAAAASKRSVTVKSQSAPAGKVQE
Sbjct  17   ISSSAKLPSTSPAVLKFQPFKRTNPLISKSLGLTASTAAAASKRSVTVKSQSAPAGKVQE  76

Query  310  LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHEE  489
            LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPF+NKLYTGDLQKRVGITAGLCILIKHEE
Sbjct  77   LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHEE  136

Query  490  EKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            EKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA
Sbjct  137  EKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  172



>emb|CAC83765.1| allene oxide cyclase [Nicotiana tabacum]
Length=245

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  130  ISSSAKLPSTSP---AVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGK  300
            ISSSAKL S+ P   A  K + FK  NPLIS+SL L  ST + +        S  +   K
Sbjct  14   ISSSAKLTSSFPTTSASQKIRSFKLPNPLISQSLKLGTSTNSKSFYCKSQSGSTDSSTTK  73

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPF+NKLYTGDL+KR+GITAGLCILIK
Sbjct  74   VQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIK  133

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            HEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  134  HEEEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  172



>ref|XP_009790745.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Nicotiana 
sylvestris]
Length=245

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  130  ISSSAKLPSTSP---AVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGK  300
            ISSSAKL S+ P   A  K +PFK  NPLIS+SL L+ ST++ +        S  +   K
Sbjct  14   ISSSAKLTSSFPTTTASQKIRPFKLPNPLISQSLKLSTSTSSKSFYCKSQSSSTDSTTTK  73

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NKLYTGDL+KR+GITAGLCILIK
Sbjct  74   VQELSVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIK  133

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            HEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  134  HEEEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  172



>ref|NP_001289444.1| uncharacterized protein LOC104120106 [Nicotiana tomentosiformis]
 gb|AGR88649.1| allene oxide cyclase [Nicotiana tomentosiformis]
Length=245

 Score =   209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  130  ISSSAKL-PS--TSPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGK  300
            ISSSAKL PS  T+ A  K + FK  NPLIS+SL L  ST + +        S      K
Sbjct  14   ISSSAKLTPSFPTTSASQKIRSFKLPNPLISQSLKLGTSTNSKSFYCKSQSGSTDPSTTK  73

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPF+NKLYTGDL+KR+GITAGLCILIK
Sbjct  74   VQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIK  133

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            HEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  134  HEEEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  172



>gb|ACD12705.1| AOC [Petunia x hybrida]
Length=243

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +1

Query  163  PAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGKVQELCVYEINERDR  342
            P   K Q FK  NPLISK+L L+ ST + +        S  +   KVQEL VYE+NERDR
Sbjct  26   PTTQKIQSFKLPNPLISKTLKLSTSTNSKSFYCKSQSSSTDSTNTKVQELSVYEMNERDR  85

Query  343  GSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIY  522
            GSPAYLRLSQK+VN+LGDLVPF+NKLYTGDL+KR+GITAGLCILIKHEEEKKGDRYEAIY
Sbjct  86   GSPAYLRLSQKTVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIKHEEEKKGDRYEAIY  145

Query  523  SFYFGDYGHIAVQGQYLTYEDTYLA  597
            SFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  146  SFYFGDYGHIAVQGSYLTYEDTYLA  170



>ref|XP_006363132.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Solanum tuberosum]
Length=244

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 125/158 (79%), Gaps = 5/158 (3%)
 Frame = +1

Query  133  SSSAKLPS---TSPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGKV  303
            SSS KLPS   T+    K Q FK  NPLIS++  LT ++ + + K   +    +    +V
Sbjct  16   SSSYKLPSAFQTTSLSQKIQSFKLPNPLISQTHKLTTASRSFSCKSQNSSTDSTN--TEV  73

Query  304  QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKH  483
            QEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPF+NKLYT DL+KR+GITAGLCILIKH
Sbjct  74   QELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILIKH  133

Query  484  EEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            EEEKKGDRYEA+YSFYFGDYG IAVQG YLTYEDTYLA
Sbjct  134  EEEKKGDRYEAVYSFYFGDYGQIAVQGSYLTYEDTYLA  171



>gb|AAU11327.1| allene oxide cyclase [Hyoscyamus niger]
Length=248

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 125/159 (79%), Gaps = 4/159 (3%)
 Frame = +1

Query  133  SSSAKLPSTSP---AVLKFQPFKRTNPLIskslg-ltastaaaaskrsvtvksQSAPAGK  300
            SS+ KLPST P   A  K Q FK  NPLIS+SL   T++T + +        S  +   K
Sbjct  17   SSTYKLPSTFPLTSASQKIQSFKLPNPLISQSLKLNTSTTTSRSFSCKSQSSSTDSTTTK  76

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQEL VYE+NE DRGSPAYLRLSQK+VN+LGDLVPF+NKLYT DL+KR+GITAGLCIL K
Sbjct  77   VQELSVYELNEHDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILTK  136

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            HEEEKKGDRYEAIYSFYFG+YGHIAVQG YLTYEDTYLA
Sbjct  137  HEEEKKGDRYEAIYSFYFGEYGHIAVQGSYLTYEDTYLA  175



>ref|NP_001234019.1| allene oxide cyclase [Solanum lycopersicum]
 gb|AAK62358.1|AF384374_1 allene oxide cylase [Solanum lycopersicum]
 emb|CAB95731.1| allene oxide cyclase [Solanum lycopersicum]
 emb|CAC83759.1| allene oxide cyclase [Solanum lycopersicum]
 emb|CAC83760.1| allene oxide cyclase [Solanum lycopersicum]
Length=244

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  175  KFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAG--KVQELCVYEINERDRGS  348
            K Q FK  NPLIS++  LT ++  A+   S   +S S  +   +VQEL VYEINERDRGS
Sbjct  29   KIQSFKLPNPLISQNHKLTTTSTTASRSFSCKSQSTSTDSTNTEVQELSVYEINERDRGS  88

Query  349  PAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSF  528
            PAYLRLSQK+VN+LGDLVPF+NKLYT DL+KR+GITAGLCILIKHEEEKKGDRYEA+YSF
Sbjct  89   PAYLRLSQKTVNSLGDLVPFSNKLYTADLKKRIGITAGLCILIKHEEEKKGDRYEAVYSF  148

Query  529  YFGDYGHIAVQGQYLTYEDTYLA  597
            YFGDYGHIAVQG YLTYE+TYLA
Sbjct  149  YFGDYGHIAVQGAYLTYEETYLA  171



>gb|ABK94763.1| unknown [Populus trichocarpa]
Length=251

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  138  QNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  177



>ref|XP_002305951.2| mangrin family protein [Populus trichocarpa]
 gb|ABK94126.1| unknown [Populus trichocarpa]
 gb|EEE86462.2| mangrin family protein [Populus trichocarpa]
Length=251

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  138  QNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  177



>ref|XP_011004427.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=251

 Score =   194 bits (492),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  138  QNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  177



>ref|XP_010061864.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW68894.1| hypothetical protein EUGRSUZ_F02479 [Eucalyptus grandis]
Length=256

 Score =   194 bits (493),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 6/112 (5%)
 Frame = +1

Query  280  QSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQK  441
            Q+APAG      KVQELC+YEINERDRGSPA L+LSQK VN+LGDLVPF+NKLYTGDLQK
Sbjct  72   QAAPAGGDSAPGKVQELCIYEINERDRGSPAILKLSQKPVNSLGDLVPFSNKLYTGDLQK  131

Query  442  RVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            RVGITAG+CILI+++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  132  RVGITAGICILIQNKPEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLA  183



>gb|AAA80500.1| unknown, partial [Solanum lycopersicum]
Length=214

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            +VQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NKLYT DL+KR+GITAGLCILI
Sbjct  42   EVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  101

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            KHEEEKKGDRYEA+YSFYFGDYGHIAVQG YLTYE+TYLA
Sbjct  102  KHEEEKKGDRYEAVYSFYFGDYGHIAVQGAYLTYEETYLA  141



>ref|NP_001275212.1| allene oxide cyclase [Solanum tuberosum]
 gb|AAN37418.1| allene oxide cyclase [Solanum tuberosum]
Length=246

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 125/160 (78%), Gaps = 5/160 (3%)
 Frame = +1

Query  133  SSSAKLPST---SPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAG--  297
            SSS KLPS    +    K Q  K  NPLIS++  LT ++  A+   S   ++ S  +   
Sbjct  16   SSSYKLPSAFQITSLSQKIQSLKLPNPLISQTHKLTTTSTTASRSFSCKSQNSSTDSTNT  75

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            +VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPF+NKLYT DL+KR+GITAGLCILI
Sbjct  76   EVQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  135

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            KHEEEKKGDRYEA+YSFYFGDYG IAVQG YLTYED+YLA
Sbjct  136  KHEEEKKGDRYEAVYSFYFGDYGQIAVQGSYLTYEDSYLA  175



>gb|ABK96763.1| unknown [Populus trichocarpa x Populus deltoides]
Length=251

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKAVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  138  QNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  177



>ref|XP_011021206.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=254

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S PA KVQEL VYEINERDRGSPAYLRLS + VNTLGDLVPF+NKLYTGDLQKR+GITAG
Sbjct  76   SRPATKVQELNVYEINERDRGSPAYLRLSYRPVNTLGDLVPFSNKLYTGDLQKRIGITAG  135

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LCILI+H+ EK+GDRYEA+YSFYFGDYGH++VQG YLTYEDTYLA
Sbjct  136  LCILIQHKTEKQGDRYEAVYSFYFGDYGHLSVQGAYLTYEDTYLA  180



>ref|XP_010103817.1| Allene oxide cyclase 4 [Morus notabilis]
 gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis]
Length=247

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLC  468
            P  KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLYTGDLQKR+GITAG+C
Sbjct  72   PPTKVQELYVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRIGITAGIC  131

Query  469  ILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +LI+++ E KGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  132  VLIQNKPETKGDRYEAIYSFYFGDYGHISVQGSYLTYEDTYLA  174



>ref|XP_011099573.1| PREDICTED: LOW QUALITY PROTEIN: allene oxide cyclase 4, chloroplastic-like 
[Sesamum indicum]
Length=247

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            + KVQ+L VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NK+YTGDL+KR GITAG+C+
Sbjct  76   SSKVQQLNVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRAGITAGICV  135

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LIK+E EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  136  LIKNEPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  177



>gb|ADY38579.1| allene oxide cyclase [Camellia sinensis]
Length=245

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQ+LCVYEINERDRGSPAYLRLSQKSVN+LGDLVPF NK+YTGDLQKR+GITAG+CILI
Sbjct  73   KVQQLCVYEINERDRGSPAYLRLSQKSVNSLGDLVPFTNKVYTGDLQKRLGITAGICILI  132

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDT LA
Sbjct  133  QNVPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTCLA  172



>gb|AEE99197.1| allene oxide cyclase 2 [Glycine max]
 gb|KHN23766.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+   KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPF+NK+Y+GDLQKR+GITAG
Sbjct  78   SSQPTKVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LC+LI+HE EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  138  LCVLIQHEPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLA  182



>gb|ACU24579.1| unknown [Glycine max]
Length=213

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+ + KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NKLY+G LQKRVGITAG
Sbjct  80   SSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSGCLQKRVGITAG  139

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +C+LI+++ EKKGD YEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  140  ICVLIQNKSEKKGDMYEAIYSFYFGDYGHISVQGSYLTYEDTYLA  184



>ref|XP_003518680.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Glycine 
max]
Length=255

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+   KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPF+NK+Y+GDLQKR+GITAG
Sbjct  78   SSQPTKVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LC+LI+HE EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  138  LCVLIQHEPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLA  182



>gb|ACZ06580.1| allene oxide cyclase [Jatropha curcas]
 gb|KDP32930.1| hypothetical protein JCGZ_12961 [Jatropha curcas]
Length=250

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K QEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLYTGDLQKR+GITAG+CILI
Sbjct  78   KFQELHVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKLYTGDLQKRIGITAGICILI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H+ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYED+YLA
Sbjct  138  EHKAEKKGDRYEAIYSFYFGDYGHIAVQGAYLTYEDSYLA  177



>gb|EYU44656.1| hypothetical protein MIMGU_mgv1a012403mg [Erythranthe guttata]
Length=251

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 127/163 (78%), Gaps = 9/163 (6%)
 Frame = +1

Query  133  SSSAKLPSTSPA-------VLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQS-A  288
            +SSAKLP ++ A       +L F+P  + NPLI + L  +A+  +  S +S  +   S  
Sbjct  17   TSSAKLPPSTTAAAAVAQKLLSFRPLIK-NPLIPQPLKFSAAQRSHFSCKSAQITDPSDT  75

Query  289  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLC  468
             + K+QEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NK+YTGD++KR GITAG+C
Sbjct  76   RSSKIQELNVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDMKKRAGITAGIC  135

Query  469  ILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +LIK+E EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDT LA
Sbjct  136  VLIKNEPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTCLA  178



>ref|XP_007033323.1| Allene oxide cyclase 4 isoform 1 [Theobroma cacao]
 gb|EOY04249.1| Allene oxide cyclase 4 isoform 1 [Theobroma cacao]
Length=253

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NK+YTGDLQKR+GIT+G+CILI
Sbjct  81   KVQELYVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYTGDLQKRIGITSGICILI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H+ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  141  EHKPEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLA  180



>ref|XP_006482294.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Citrus 
sinensis]
 gb|KDO36048.1| hypothetical protein CISIN_1g025525mg [Citrus sinensis]
Length=251

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLYTGDLQKR+GITAGLCILI
Sbjct  79   KVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYTGDLQKRLGITAGLCILI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  139  ENKPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  178



>ref|NP_001241361.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99196.1| allene oxide cyclase 1 [Glycine max]
 gb|KHN10797.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 99/105 (94%), Gaps = 1/105 (1%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S PA KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NK+Y+GDLQKR+GITAG
Sbjct  79   SQPA-KVQELFVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LC+LI+HE EKKGDRYEAIYSFYFG+YGHI+VQG YLT++DTYLA
Sbjct  138  LCVLIQHEPEKKGDRYEAIYSFYFGNYGHISVQGAYLTFQDTYLA  182



>ref|XP_003614458.1| Allene oxide cyclase [Medicago truncatula]
 emb|CAC83767.1| allene oxide cyclase [Medicago truncatula]
 gb|ACJ84503.1| unknown [Medicago truncatula]
 gb|AES97416.1| allene oxide cyclase [Medicago truncatula]
 gb|AFK35723.1| unknown [Medicago truncatula]
Length=252

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            +S+   KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLY+G+L+KR+GIT+
Sbjct  74   ESSKPAKVQELFVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGNLEKRLGITS  133

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLCILI++E EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  134  GLCILIQNEPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYQDTYLA  179



>ref|XP_007033324.1| Allene oxide cyclase isoform 2 [Theobroma cacao]
 gb|EOY04250.1| Allene oxide cyclase isoform 2 [Theobroma cacao]
Length=191

 Score =   187 bits (476),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NK+YTGDLQKR+GIT+G+CILI
Sbjct  19   KVQELYVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYTGDLQKRIGITSGICILI  78

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H+ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  79   EHKPEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLA  118



>ref|XP_004309482.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 6/112 (5%)
 Frame = +1

Query  280  QSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQK  441
            QS+P+       KVQEL VYEINERDRGSPA+L+LSQK VN+LGDLVPF+NKLYTGDLQK
Sbjct  64   QSSPSSETERSTKVQELNVYEINERDRGSPAFLKLSQKPVNSLGDLVPFSNKLYTGDLQK  123

Query  442  RVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            R+GITAG+C+LI+++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  124  RIGITAGICVLIENKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  175



>ref|XP_004514328.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cicer 
arietinum]
Length=252

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+   KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLY+G+L+KR+GIT+G
Sbjct  75   SSKPAKVQELFVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGNLEKRLGITSG  134

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LCILI+HE EKKGDRYEAIYSFYFGDYGHI VQG YLTY+DTYLA
Sbjct  135  LCILIQHEPEKKGDRYEAIYSFYFGDYGHITVQGPYLTYQDTYLA  179



>emb|CDP02799.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 123/157 (78%), Gaps = 11/157 (7%)
 Frame = +1

Query  148  LPSTSPA---VLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPA----GKVQ  306
            L S+SP    +L F+PF  +NPLIS +  LTA+ AA     +     QSAP+     KVQ
Sbjct  21   LTSSSPTAQNILSFKPF--SNPLISNNFRLTANFAATCRSFTCKS--QSAPSDSTPAKVQ  76

Query  307  ELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHE  486
            EL VYEINERDRGSPA+L+LSQK VN+LGDL+PF NK+Y+G LQKR+GITAG+CILIKHE
Sbjct  77   ELNVYEINERDRGSPAFLKLSQKDVNSLGDLIPFTNKIYSGCLQKRLGITAGICILIKHE  136

Query  487  EEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             EKKGDRYEAI+SFYFG YGHIAVQG YLTYEDTYLA
Sbjct  137  PEKKGDRYEAIFSFYFGGYGHIAVQGPYLTYEDTYLA  173



>ref|XP_008459463.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X2 [Cucumis melo]
Length=247

 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S P+G+VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF NKLYTGDLQKRVGIT+G
Sbjct  70   SNPSGRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGITSG  129

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LCIL++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  130  LCILVQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  174



>dbj|BAE45342.1| allene oxide cyclase [Pisum sativum]
Length=252

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            QS+  GKVQEL VYE+NER RGSPAYL+LSQKS+N+LGDLVPF+NKLY+G+L+KR+GITA
Sbjct  74   QSSKPGKVQELFVYEMNERGRGSPAYLKLSQKSMNSLGDLVPFSNKLYSGNLEKRIGITA  133

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLCILI+H  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  134  GLCILIQHVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLA  179



>ref|XP_006430815.1| hypothetical protein CICLE_v10012552mg [Citrus clementina]
 gb|ESR44055.1| hypothetical protein CICLE_v10012552mg [Citrus clementina]
Length=251

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLYTGDLQKRVGITAG+CILI
Sbjct  79   KVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYTGDLQKRVGITAGICILI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEA YSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  139  ENKPEKKGDRYEATYSFYFGDYGHIAVQGPYLTYEDTYLA  178



>gb|AFV68275.1| allene oxide cyclase [Catharanthus roseus]
Length=251

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K+QEL VYEINERDRGSPAYLRLSQK+ N+LGDLVPF NK+Y+GDLQKR+GIT+G+CILI
Sbjct  79   KIQELHVYEINERDRGSPAYLRLSQKTANSLGDLVPFTNKVYSGDLQKRLGITSGICILI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            K+E EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  139  KNEPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  178



>ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [Glycine max]
 gb|AEE99199.1| allene oxide cyclase 4 [Glycine max]
 gb|KHN47653.1| Allene oxide cyclase 3, chloroplastic [Glycine soja]
Length=253

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+ + KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NKLY+G LQKRVGITAG
Sbjct  76   SSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSGCLQKRVGITAG  135

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +C+LI+++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  136  ICVLIQNKAEKKGDRYEAIYSFYFGDYGHISVQGSYLTYEDTYLA  180



>ref|XP_002530384.1| Allene oxide cyclase 4, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF31990.1| Allene oxide cyclase 4, chloroplast precursor, putative [Ricinus 
communis]
Length=263

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 101/112 (90%), Gaps = 6/112 (5%)
 Frame = +1

Query  280  QSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQK  441
            Q+AP+       +VQELCVYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLYTGDLQ+
Sbjct  78   QAAPSDDNSRPTEVQELCVYEINERDRGSPAYLRLSQKQVNSLGDLVPFSNKLYTGDLQQ  137

Query  442  RVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            R+GITAG+CILI+++ E KGDRYEAIYSFYFGDYGH+AVQG YLT+EDTYLA
Sbjct  138  RIGITAGICILIQNKPEMKGDRYEAIYSFYFGDYGHLAVQGPYLTFEDTYLA  189



>ref|XP_010265246.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Nelumbo 
nucifera]
Length=256

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NK+Y+GDLQKR+GITAG+C+LI
Sbjct  84   KVQELHVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKIYSGDLQKRLGITAGICVLI  143

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKGDRYEAIYSFYFGDYGHI VQG YLTYEDTYLA
Sbjct  144  QHVPEKKGDRYEAIYSFYFGDYGHITVQGAYLTYEDTYLA  183



>ref|NP_001240200.1| membrane primary amine oxidase [Glycine max]
 gb|AEE99198.1| allene oxide cyclase 3 [Glycine max]
 gb|KHN28337.1| Allene oxide cyclase 3, chloroplastic [Glycine soja]
Length=257

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+ + KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NKLY+G LQKRVGITAG
Sbjct  80   SSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSGCLQKRVGITAG  139

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +C+LI+++ EKKGD YEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  140  ICVLIQNKSEKKGDMYEAIYSFYFGDYGHISVQGSYLTYEDTYLA  184



>ref|XP_009394846.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQELCVYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLY+G+L+KRVGITAG+C+LI
Sbjct  77   KVQELCVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKLYSGNLEKRVGITAGICVLI  136

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEAIYSFYFGDYGH++VQG YLTYED+YLA
Sbjct  137  QHVPERGGDRYEAIYSFYFGDYGHVSVQGAYLTYEDSYLA  176



>emb|CDP00580.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLS+K  N+LGDLVPF+NKLYTGDLQKR+GIT+GLC+LI
Sbjct  80   KVQELYVYEINERDRGSPAYLRLSKKDANSLGDLVPFSNKLYTGDLQKRLGITSGLCVLI  139

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            KH  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  140  KHVPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEDTHLA  179



>ref|NP_001240033.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99201.1| allene oxide cyclase 6 [Glycine max]
 gb|KHN13814.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPF+NKLYTGDLQKR+GIT+G+CILI
Sbjct  83   KVQELSVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTGDLQKRIGITSGICILI  142

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  143  QNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLA  182



>gb|ACU19690.1| unknown [Glycine max]
Length=255

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+   KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPF+NK+Y+GDLQKR+GITAG
Sbjct  78   SSQPTKVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LC+LI+HE EKKGDRYEAI SFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  138  LCVLIQHEPEKKGDRYEAICSFYFGDYGHISVQGAYLTYQDTYLA  182



>gb|AGR49302.1| allene oxide cyclase [Catharanthus roseus]
Length=254

 Score =   186 bits (473),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            QS+   KVQEL VYEINERDRGSPA+L+LS+K VN+LGDLVPF NKLYTGDLQKR+GITA
Sbjct  76   QSSVPTKVQELFVYEINERDRGSPAFLKLSKKEVNSLGDLVPFTNKLYTGDLQKRLGITA  135

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC+LI+H  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DT+LA
Sbjct  136  GLCVLIQHLPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYQDTFLA  181



>ref|XP_007139329.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris]
 gb|ESW11323.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris]
Length=250

 Score =   186 bits (472),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q   + KVQEL VYEINERDRGSP YLRLS K+VN+LGDLVPF+NKLYTGDLQKR+GIT+
Sbjct  72   QPVSSEKVQELSVYEINERDRGSPVYLRLSYKTVNSLGDLVPFSNKLYTGDLQKRIGITS  131

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+CILI+++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYED+YLA
Sbjct  132  GICILIQNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDSYLA  177



>gb|AFB69864.1| allene oxide cyclase [Salvia miltiorrhiza]
 gb|AFB69865.1| allene oxide cyclase [Salvia miltiorrhiza]
Length=239

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPF+NK+YTGDL+KR GITAG+CILI
Sbjct  67   KVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRAGITAGICILI  126

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            K+E EKKGDRYEAIYSFY GDYGHIAVQG YLTY+DT LA
Sbjct  127  KNEAEKKGDRYEAIYSFYLGDYGHIAVQGPYLTYQDTELA  166



>gb|KHN47545.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=257

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPF+NKLYTGDLQKR+GIT+G+CILI
Sbjct  85   KVQELTVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTGDLQKRIGITSGICILI  144

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYED+YLA
Sbjct  145  QNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDSYLA  184



>ref|NP_001242726.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99200.1| allene oxide cyclase 5 [Glycine max]
Length=257

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPF+NKLYTGDLQKR+GIT+G+CILI
Sbjct  85   KVQELTVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTGDLQKRIGITSGICILI  144

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYED+YLA
Sbjct  145  QNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDSYLA  184



>ref|XP_008339701.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Malus domestica]
Length=253

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK VNTLGDLVPF+NK+Y+G+L+KR+GITAGLC+LI
Sbjct  81   KVQELHVYEINERDRGSPAYLRLSQKQVNTLGDLVPFSNKIYSGBLEKRLGITAGLCVLI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  141  QNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLA  180



>ref|XP_009356280.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Pyrus 
x bretschneideri]
Length=253

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NK+Y+GDL+KR+GITAGLC+LI
Sbjct  81   KVQELHVYEINERDRGSPAYLRLSQKQVNSLGDLVPFSNKIYSGDLEKRLGITAGLCVLI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  141  QNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLA  180



>ref|XP_008465778.1| PREDICTED: allene oxide cyclase 1, chloroplastic [Cucumis melo]
Length=250

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            + KVQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPF+NKLY+GDLQKR+GITAGLC+
Sbjct  76   SAKVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITAGLCV  135

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LI+H  EKKGDRYEAIYSFYFGDYGHIAVQG YLTY+DTYLA
Sbjct  136  LIQHLPEKKGDRYEAIYSFYFGDYGHIAVQGAYLTYQDTYLA  177



>ref|XP_008459462.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X1 [Cucumis melo]
Length=251

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
             G+VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF NKLYTGDLQKRVGIT+GLCI
Sbjct  77   GGRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGITSGLCI  136

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            L++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  137  LVQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  178



>ref|XP_010093405.1| Allene oxide cyclase 4 [Morus notabilis]
 gb|EXB53999.1| Allene oxide cyclase 4 [Morus notabilis]
Length=255

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            +S+   KVQEL VYEINERDRGSPA+L+LSQK VN+LGDLVPF NK+YTGDLQKR+GIT+
Sbjct  77   ESSRPTKVQELHVYEINERDRGSPAFLKLSQKQVNSLGDLVPFTNKIYTGDLQKRLGITS  136

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC+LI+H  +KKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  137  GLCVLIQHVPDKKGDRYEAIYSFYFGDYGHISVQGPYLTYQDTYLA  182



>gb|KJB22404.1| hypothetical protein B456_004G046400 [Gossypium raimondii]
Length=245

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
             SAP  KVQEL +YE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GITA
Sbjct  68   NSAP-DKVQELHIYEMNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITA  126

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+DT+LA
Sbjct  127  GICILIEHKPEMKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDTFLA  172



>gb|KHG19305.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=245

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
             SAP  KVQEL +YE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GITA
Sbjct  68   NSAP-DKVQELHIYEMNERDRGSPAYLRLSQKSVNSLGDLVPFSNKMYRGDLEKRIGITA  126

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+DT+LA
Sbjct  127  GICILIEHKPEMKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDTFLA  172



>ref|XP_009336614.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Pyrus x bretschneideri]
Length=252

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPF+NK+Y+GDL+KR+GITAGLC+LI
Sbjct  80   KVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGITAGLCVLI  139

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTY+A
Sbjct  140  QNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYMA  179



>gb|AFK41265.1| unknown [Lotus japonicus]
Length=256

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 1/105 (1%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S PA KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLY+G+L+KR+GIT G
Sbjct  80   SRPA-KVQELSVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYSGNLEKRLGITTG  138

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  139  LCVLIQNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLA  183



>gb|KJB22342.1| hypothetical protein B456_004G046100 [Gossypium raimondii]
Length=246

 Score =   184 bits (466),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+DTYLA
Sbjct  128  GICILIEHKPEMKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDTYLA  173



>ref|XP_007154351.1| hypothetical protein PHAVU_003G111500g [Phaseolus vulgaris]
 gb|ESW26345.1| hypothetical protein PHAVU_003G111500g [Phaseolus vulgaris]
Length=254

 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  295  GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
             KVQEL VYEINERDRGSPA+LRLSQK VN+LGDLVPF+NK+Y+G+L+KR+GITAGLC+L
Sbjct  81   AKVQELFVYEINERDRGSPAFLRLSQKPVNSLGDLVPFSNKIYSGNLEKRLGITAGLCVL  140

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  141  IQHVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLA  181



>dbj|BAB21610.2| mangrin [Bruguiera sexangula]
Length=256

 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQELCVYE+NERDRGSPA LRLSQK VN+LGDLVPF+NK+Y+GDLQKR+G+TAG+CILI
Sbjct  84   KVQELCVYEMNERDRGSPAVLRLSQKPVNSLGDLVPFSNKVYSGDLQKRIGVTAGICILI  143

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDR+EAIYSFYFG YGHIAVQG YLTYEDT+LA
Sbjct  144  QNKPEKKGDRFEAIYSFYFGGYGHIAVQGAYLTYEDTHLA  183



>ref|XP_009392456.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=250

 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGL  465
             PA  VQE+CVYEINE DR SPAYLRLSQK VN+LGDLVPF+NK+Y+GDLQKR+GITAGL
Sbjct  74   GPATDVQEMCVYEINELDRNSPAYLRLSQKDVNSLGDLVPFSNKVYSGDLQKRLGITAGL  133

Query  466  CILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            C+LI+H  E+ GDRYEAIYSFYFG+YGHI+VQG YLTYEDTYLA
Sbjct  134  CVLIQHVPERVGDRYEAIYSFYFGEYGHISVQGAYLTYEDTYLA  177



>ref|XP_004297139.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=250

 Score =   184 bits (466),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPF+NK+Y+GDL+KR+GIT+GLC+LI
Sbjct  78   KVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGITSGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  138  QNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLA  177



>ref|XP_008243177.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Prunus mume]
Length=274

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPF+NK+Y+GDL+KR+G+TAGLC+LI
Sbjct  101  KVQELHVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGVTAGLCVLI  160

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  161  QNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLA  200



>ref|XP_008389309.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Malus domestica]
 ref|XP_008350872.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=252

 Score =   183 bits (465),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPF+NK+Y+GDL+KR+GITAGLC+LI
Sbjct  80   KVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGITAGLCVLI  139

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTY+A
Sbjct  140  QNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYMA  179



>gb|AFK38605.1| unknown [Lotus japonicus]
Length=248

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLY+G LQKRVGITAG+C+LI
Sbjct  76   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGCLQKRVGITAGICVLI  135

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  136  ENKAEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  175



>gb|AFK47606.1| unknown [Medicago truncatula]
Length=251

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPF+NKLYTGDLQKR+GIT G+CILI
Sbjct  77   KVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTGDLQKRIGITTGICILI  136

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLA  597
            +H+ EKKGDRYEAIYSF+FGDYGH+AVQG YLTY EDTYLA
Sbjct  137  EHKAEKKGDRYEAIYSFHFGDYGHLAVQGPYLTYPEDTYLA  177



>gb|KEH21777.1| allene oxide cyclase [Medicago truncatula]
Length=250

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPF+NKLYTGDLQKR+GIT G+CILI
Sbjct  77   KVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTGDLQKRIGITTGICILI  136

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLA  597
            +H+ EKKGDRYEAIYSF+FGDYGH+AVQG YLTY EDTYLA
Sbjct  137  EHKAEKKGDRYEAIYSFHFGDYGHLAVQGPYLTYPEDTYLA  177



>ref|XP_007046300.1| Allene oxide cyclase [Theobroma cacao]
 gb|EOY02132.1| Allene oxide cyclase [Theobroma cacao]
Length=256

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQELCVYEINERDR SPA L+LSQK VN+LGDLVPF NKLYTGDLQKR+GITAGLC+LI
Sbjct  84   KVQELCVYEINERDRNSPAVLKLSQKPVNSLGDLVPFTNKLYTGDLQKRLGITAGLCVLI  143

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK+GDR+EAIYSFYFG+YGHI+VQG YLTYED+YLA
Sbjct  144  QHVPEKQGDRFEAIYSFYFGEYGHISVQGPYLTYEDSYLA  183



>ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica]
 gb|EMJ24919.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica]
Length=251

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPF NK+Y+GDL+KR+G+TAGLC+LI
Sbjct  78   KVQELHVYEINERDRGSPAYLRLSKKEVNSLGDLVPFTNKIYSGDLEKRLGVTAGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  138  QNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLA  177



>emb|CAI29046.1| allene-oxide cyclase [Medicago truncatula]
Length=250

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPF+NKLYTGDLQKR+GIT G+CILI
Sbjct  77   KVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTGDLQKRIGITTGICILI  136

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLA  597
            +H+ EKKGDRYEAIYSF+FGDYGH+AVQG YLTY EDTYLA
Sbjct  137  EHKAEKKGDRYEAIYSFHFGDYGHLAVQGPYLTYPEDTYLA  177



>ref|XP_008459464.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X3 [Cucumis melo]
Length=246

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+   +VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF NKLYTGDLQKRVGIT+G
Sbjct  69   SSNPSRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGITSG  128

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LCIL++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  129  LCILVQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  173



>ref|XP_010660502.1| PREDICTED: allene oxide cyclase [Vitis vinifera]
 emb|CBI16856.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 5/111 (5%)
 Frame = +1

Query  280  QSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKR  444
            QS+P+      KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NK+YTGDL+KR
Sbjct  68   QSSPSDPPRPTKVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYTGDLEKR  127

Query  445  VGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +G+TAGLC+LI++   KKGDRYEA YSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  128  LGVTAGLCVLIQNVPGKKGDRYEATYSFYFGDYGHISVQGAYLTYEDTYLA  178



>ref|XP_008230384.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Prunus 
mume]
Length=184

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPF NK+YTGDLQKR+G+TAG+CILI
Sbjct  11   KVQELHVYEINERDRASPAYLSLSQKPVNSLGDLVPFTNKIYTGDLQKRLGVTAGICILI  70

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  71   ENKPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLA  110



>gb|KJB50746.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
 gb|KJB50747.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
Length=253

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NERDR SPA L+LSQK VN+LGDLVPF NKLY+GDLQKRVGITAGLC+LI
Sbjct  81   KVQELHVYEMNERDRSSPAVLKLSQKPVNSLGDLVPFTNKLYSGDLQKRVGITAGLCVLI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLA
Sbjct  141  QHVPEKKGDRYEAIYSFYFGDYGHLSVQGPYLTYEDTYLA  180



>ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica]
 gb|EMJ16240.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica]
Length=184

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPF NK+YTGDLQKR+G+TAG+CILI
Sbjct  11   KVQELHVYEINERDRASPAYLSLSQKPVNSLGDLVPFTNKIYTGDLQKRLGVTAGICILI  70

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  71   ENKPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLA  110



>ref|XP_010044291.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Eucalyptus 
grandis]
Length=253

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQELCVYEINERDRGSPA+LRLS+K VN+LGDLVPF NKLY+GDLQ+R+G+T+GLC++I
Sbjct  81   KVQELCVYEINERDRGSPAFLRLSEKPVNSLGDLVPFTNKLYSGDLQRRLGVTSGLCVVI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  +K GDRYEAIYSFYFGDYGHI+VQG YLTY+DT+LA
Sbjct  141  QHLPDKGGDRYEAIYSFYFGDYGHISVQGPYLTYQDTFLA  180



>gb|KHG22804.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=246

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA
Sbjct  128  GICILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLA  173



>gb|KHG22803.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=246

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA
Sbjct  128  GICILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLA  173



>gb|EYU29945.1| hypothetical protein MIMGU_mgv1a012640mg [Erythranthe guttata]
Length=244

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYLRLSQK VN+LGDLVPF+NKLY+GDLQKR+GITAGLC+LI
Sbjct  72   KVQELYVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKLYSGDLQKRLGITAGLCVLI  131

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  +KKGDRYEA+YSFYFGDYGHI+VQG YLTY DT LA
Sbjct  132  QHSPDKKGDRYEAMYSFYFGDYGHISVQGSYLTYADTVLA  171



>ref|XP_003637011.1| Allene oxide cyclase C4 [Medicago truncatula]
 gb|KEH25317.1| allene oxide cyclase [Medicago truncatula]
Length=234

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            QS+ + KVQEL VYEINE+DRGSPAYLRLSQK+VNTL DLVPF+NKLY+G LQKRVGITA
Sbjct  71   QSSNSVKVQELSVYEINEKDRGSPAYLRLSQKNVNTLNDLVPFSNKLYSGCLQKRVGITA  130

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+C+LI+++ EKKGD YEAIYSFYFGDYGHI VQG YLTYEDTYL 
Sbjct  131  GICVLIQNKAEKKGDIYEAIYSFYFGDYGHIYVQGSYLTYEDTYLV  176



>ref|XP_004141500.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Cucumis 
sativus]
 gb|KGN52574.1| hypothetical protein Csa_5G644020 [Cucumis sativus]
Length=247

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            +VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF NKLY+GDLQKRVGITAGLCIL+
Sbjct  75   RVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYSGDLQKRVGITAGLCILV  134

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  135  QNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  174



>gb|KHG03969.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=253

 Score =   181 bits (459),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NERDR SPA L+LSQK VN+LGDLVPF NKLY+GDLQKRVGITAGLC+LI
Sbjct  81   KVQELHVYEMNERDRSSPAVLKLSQKPVNSLGDLVPFTNKLYSGDLQKRVGITAGLCVLI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKGDRYEAIYSFYFGDYGH++VQG YLTYED+YLA
Sbjct  141  QHVPEKKGDRYEAIYSFYFGDYGHLSVQGPYLTYEDSYLA  180



>gb|AAT96852.1| allene oxide cyclase C4 [Humulus lupulus]
Length=254

 Score =   181 bits (459),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYLRLS+K VN+LGDLVPF+NKLYTG LQKR+GITAG+CILI
Sbjct  82   KVQELHVYEINERDRSSPAYLRLSKKEVNSLGDLVPFSNKLYTGCLQKRIGITAGICILI  141

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ E KGDRYEAIYSFYFGDYGH+AVQG YLTYEDTYLA
Sbjct  142  QNKAENKGDRYEAIYSFYFGDYGHLAVQGSYLTYEDTYLA  181



>gb|AGU09699.1| allene oxide cyclase [Gossypium hirsutum]
Length=246

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+CILI+H+ E KGDRYEAI+SFYFGD GHIAVQG YLTY+DTYLA
Sbjct  128  GICILIEHKPEMKGDRYEAIFSFYFGDCGHIAVQGPYLTYQDTYLA  173



>gb|KHG12052.1| Allene oxide cyclase 3, chloroplastic -like protein [Gossypium 
arboreum]
Length=260

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GIT+G
Sbjct  84   SAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITSG  142

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA
Sbjct  143  ICILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLA  187



>gb|KHG19308.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=178

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGL  465
            A + KVQEL VYE+NERDRGSPAYLRLSQK VN+LGD+VPF+NK+Y GDL+KR+GITAG+
Sbjct  2    AASDKVQELHVYEMNERDRGSPAYLRLSQKPVNSLGDIVPFSNKIYRGDLEKRIGITAGM  61

Query  466  CILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA
Sbjct  62   CILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLA  105



>gb|AAX56078.1| allene oxide cyclase [Camptotheca acuminata]
Length=246

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 127/163 (78%), Gaps = 8/163 (5%)
 Frame = +1

Query  130  ISSSAKLPS----TSPAVLKFQPFKRTNPLIskslgltastaaaaskrs---vtvksQSA  288
            ISSS KLP+    TSPA  K   FK +NP +S++L LT + A +    +    +  S S+
Sbjct  12   ISSSVKLPTATAITSPA-QKLTHFKLSNPFVSQNLRLTTTAAPSRISFTCKCQSSXSDSS  70

Query  289  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLC  468
               KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y+G L+KR+G+TAG+C
Sbjct  71   RPSKVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYSGCLKKRLGVTAGIC  130

Query  469  ILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +LI++  EKKGD YEAIYSFYFGDYGHIAVQG YLT++DTYLA
Sbjct  131  VLIRNVPEKKGDVYEAIYSFYFGDYGHIAVQGAYLTHQDTYLA  173



>gb|AAT96851.1| allene oxide cyclase C1 [Humulus lupulus]
Length=255

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KV EL VYEINERDR SPAYLRLSQK VN+LGDLVPF+NKLYTG LQKR+GITAG+CILI
Sbjct  82   KVHELRVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKLYTGCLQKRIGITAGICILI  141

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFGDYGH++VQG Y+TYEDTYLA
Sbjct  142  QNKAEKKGDRYEAIYSFYFGDYGHLSVQGSYMTYEDTYLA  181



>ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citrus clementina]
 ref|XP_006484415.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Citrus 
sinensis]
 gb|ESR50972.1| hypothetical protein CICLE_v10032510mg [Citrus clementina]
 gb|KDO70085.1| hypothetical protein CISIN_1g025155mg [Citrus sinensis]
Length=257

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 2/107 (2%)
 Frame = +1

Query  283  SAPAG-KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGIT  456
            S PA  KVQEL VYEINERDR SPA L+LSQK  + T+GDLVPF NKLYTGDLQKR+GIT
Sbjct  78   SRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGIT  137

Query  457  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            AGLC+LIKHE EKKGDR+EAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  138  AGLCVLIKHEPEKKGDRFEAIYSFYFGDYGHISVQGAYLTYEDTYLA  184



>ref|XP_011021732.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=258

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  295  GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
             KVQEL VYEINERDRGSPA+L+LSQK  N+LGDLVPF+NKLY+GDLQKR+GIT+GLC+L
Sbjct  85   AKVQELHVYEINERDRGSPAFLKLSQKPQNSLGDLVPFSNKLYSGDLQKRLGITSGLCVL  144

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  145  IQNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLA  185



>ref|XP_008810937.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Phoenix 
dactylifera]
Length=245

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQE+CVYEINERDR SPAYLRLSQK VN+LGDLVPF+NK+Y G+L+KR+GITAG+ ILI
Sbjct  73   KVQEMCVYEINERDRNSPAYLRLSQKEVNSLGDLVPFSNKVYHGNLEKRLGITAGITILI  132

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  133  QHVPERNGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLA  172



>gb|KJB22328.1| hypothetical protein B456_004G046300 [Gossypium raimondii]
Length=178

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGL  465
            A + KVQEL VYE+NERDRGSPAYLRLSQK VN+LGD+VPF+NK+Y GDL+KR+GITAG+
Sbjct  2    AASDKVQELHVYEMNERDRGSPAYLRLSQKPVNSLGDIVPFSNKIYRGDLEKRIGITAGM  61

Query  466  CILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA
Sbjct  62   CILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLA  105



>gb|AEC11095.1| allene oxide cyclase [Torenia fournieri]
Length=240

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            +VQE+ VYEINE DRGSPAYLRLSQK+VN+LGDLVPF+NK+YTGDL+KR GIT+G+CILI
Sbjct  67   QVQEMHVYEINELDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRCGITSGICILI  126

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYE-DTYLA  597
            KHEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTY  DT+LA
Sbjct  127  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYPVDTHLA  167



>ref|XP_004161644.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cucumis 
sativus]
Length=250

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            + +VQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPF+NKLY+GDLQKR+GIT GLC+
Sbjct  76   SARVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITTGLCV  135

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LI+H  EKKGDRYEAIYSFYFGDYGHI VQG YLTY+DTYLA
Sbjct  136  LIQHLPEKKGDRYEAIYSFYFGDYGHITVQGAYLTYQDTYLA  177



>ref|XP_004140337.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cucumis 
sativus]
 gb|KGN50952.1| Allene oxide cyclase [Cucumis sativus]
Length=250

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            + +VQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPF+NKLY+GDLQKR+GIT GLC+
Sbjct  76   SARVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITTGLCV  135

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LI+H  EKKGDRYEAIYSFYFGDYGHI VQG YLTY+DTYLA
Sbjct  136  LIQHLPEKKGDRYEAIYSFYFGDYGHITVQGAYLTYQDTYLA  177



>ref|XP_009394154.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=259

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPF+NKLY+G+L+KR+GIT+G+C+LI
Sbjct  87   KVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNKLYSGNLEKRLGITSGICVLI  146

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE+++LA
Sbjct  147  QHVPERDGDRYEAIYSFYFGDYGHISVQGAYLTYEESHLA  186



>ref|XP_007151755.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris]
 gb|ESW23749.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris]
Length=253

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            +++ + KVQEL VYEINERDRGSPAYLRL QK+ N+LGDLVPF+NKLY+G LQKRVGITA
Sbjct  75   RTSDSAKVQELSVYEINERDRGSPAYLRLGQKTTNSLGDLVPFSNKLYSGCLQKRVGITA  134

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            G+C+LI+++ EKKGD YEAIYSFYFGDYGHI+VQG YLTYE+TYLA
Sbjct  135  GICVLIQNKAEKKGDMYEAIYSFYFGDYGHISVQGSYLTYENTYLA  180



>gb|ABK21165.1| unknown [Picea sitchensis]
Length=276

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 95/108 (88%), Gaps = 2/108 (2%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q  P+G VQEL VYEINE DRGSPAYLRLSQK VN LGDLVPF+NKLYTG+LQKR+GITA
Sbjct  96   QGPPSGSVQELHVYEINELDRGSPAYLRLSQKPVNHLGDLVPFSNKLYTGNLQKRIGITA  155

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYED--TYLA  597
            G+CILI+   EKKGDRYEAIYSFYFGDYGHIAVQG YLT+ED  +YLA
Sbjct  156  GICILIQQFPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTFEDEESYLA  203



>gb|KEH30395.1| allene oxide cyclase [Medicago truncatula]
Length=257

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q++   KVQEL VYEINERDRGSPAYLRL  KSVN+LGDLVPF+NKLYTGDLQKR+GITA
Sbjct  79   QNSDIEKVQELNVYEINERDRGSPAYLRLGFKSVNSLGDLVPFSNKLYTGDLQKRIGITA  138

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  594
            G+CILI+H+ EK GDRYEAIYSF+ GDYG IAVQG YLTYEDTYL
Sbjct  139  GICILIQHKAEKYGDRYEAIYSFHVGDYGQIAVQGPYLTYEDTYL  183



>ref|XP_009357038.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Pyrus 
x bretschneideri]
Length=184

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF NK+YTGDLQKR+GITAG+CILI
Sbjct  11   KVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGITAGICILI  70

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFG+YGH+AVQG YLTYEDTYLA
Sbjct  71   ENKPEKKGDRYEAIYSFYFGNYGHVAVQGPYLTYEDTYLA  110



>ref|XP_008348108.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=184

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF NK+YTGDLQKR+GITAG+CILI
Sbjct  11   KVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGITAGICILI  70

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFG+YGH+AVQG YLTYEDTYLA
Sbjct  71   ENKPEKKGDRYEAIYSFYFGNYGHVAVQGPYLTYEDTYLA  110



>ref|XP_008379524.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=184

 Score =   176 bits (446),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF NK+YTGDLQKR+GITAG+CILI
Sbjct  11   KVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGITAGICILI  70

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEAIYSFYFG+YGH+AVQG YLTYEDTYLA
Sbjct  71   ENKPEKKGDRYEAIYSFYFGNYGHVAVQGPYLTYEDTYLA  110



>ref|XP_004508556.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cicer 
arietinum]
Length=260

 Score =   178 bits (452),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            +VQEL +YE+NERDRGSPAYLRLS KSVNTLGDLVPF+NKLYTGDLQKR+GITAG+CILI
Sbjct  87   RVQELHLYELNERDRGSPAYLRLSNKSVNTLGDLVPFSNKLYTGDLQKRIGITAGICILI  146

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEA+YSF+FG YG +AVQG YLTYEDTYL+
Sbjct  147  QHNAERNGDRYEAVYSFHFGKYGSLAVQGAYLTYEDTYLS  186



>gb|ADE76918.1| unknown [Picea sitchensis]
Length=274

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q  P+G VQEL VYE+NE DRGSPAYLRLSQK VN LGD+VPF+NKLY+G+LQKR+GITA
Sbjct  96   QGPPSGSVQELYVYEMNELDRGSPAYLRLSQKPVNHLGDIVPFSNKLYSGNLQKRLGITA  155

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  594
            G+CILI+H  EK GDRYEAIYSFYFGDYGHI+VQG YLTYE++YL
Sbjct  156  GICILIQHFPEKNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYL  200



>ref|XP_002278768.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Vitis vinifera]
 emb|CBI27060.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQEL VYEINERDR SPA+L+LSQK  N+LGDLVPF NK+YTGDL+KR+G+TAG+C+LI+
Sbjct  83   VQELYVYEINERDRDSPAFLKLSQKPANSLGDLVPFTNKIYTGDLEKRLGVTAGICVLIQ  142

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            H  E+KGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLA
Sbjct  143  HVRERKGDRYEAIYSFYFGDYGHVSVQGPYLTYEDTYLA  181



>gb|AET50928.1| allene oxide cylase [Lilium longiflorum]
Length=246

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLC  468
            PAGK+QEL VYEINE DR SPAYL+LS+K VN+LGDLVPF+NKLY G+LQ R+GIT+GLC
Sbjct  71   PAGKIQELRVYEINELDRSSPAYLKLSEKPVNSLGDLVPFSNKLYHGNLQMRLGITSGLC  130

Query  469  ILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ILI+H  EK GDRYEAIYSFYFGDYGHI+VQG YLTYED+YLA
Sbjct  131  ILIQHVPEKGGDRYEAIYSFYFGDYGHISVQGPYLTYEDSYLA  173



>gb|AEO13839.1| allene oxide cyclase [Gladiolus hybrid cultivar]
Length=244

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K+Q+L VYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NKLY G+L+KR+GITAGLC LI
Sbjct  72   KIQKLYVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYHGNLEKRLGITAGLCTLI  131

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEA+YSFYFGDYGHI+VQG YLTYED+YLA
Sbjct  132  QHVPERNGDRYEAMYSFYFGDYGHISVQGAYLTYEDSYLA  171



>gb|AAT66741.1| plastid allene oxide cyclase [Humulus lupulus]
Length=255

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KV EL VYEINERDR SPAYLRLSQK VN+LGDLVPF+NKLYTG LQKR+GITAG+C LI
Sbjct  82   KVHELRVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKLYTGCLQKRIGITAGICTLI  141

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  594
            +++ EKKGDRYEAIYSFYFGDYGH++VQG Y+TYEDTYL
Sbjct  142  QNKAEKKGDRYEAIYSFYFGDYGHLSVQGSYMTYEDTYL  180



>gb|AFH89625.1| allene oxide cyclase [Cymbidium ensifolium]
Length=256

 Score =   176 bits (447),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S+    VQEL VYEINERDRGSP YLRLSQK VN+LGDLVPF+NK+Y+GDL+KR+GITAG
Sbjct  79   SSRPSNVQELHVYEINERDRGSPVYLRLSQKEVNSLGDLVPFSNKVYSGDLEKRLGITAG  138

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            + ILI++E EKKGDRYEAIYSFYFG+YGHI++QG YLTYED+YLA
Sbjct  139  ITILIQNEPEKKGDRYEAIYSFYFGEYGHISIQGSYLTYEDSYLA  183



>gb|AHZ35333.1| allene oxide cyclase [Picrorhiza kurrooa]
Length=254

 Score =   176 bits (446),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            A +VQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF NKLY+GDLQKR+GITAGL +
Sbjct  80   ATRVQELYVYEINERDRGSPAYLRLSQKEVNSLGDLVPFTNKLYSGDLQKRLGITAGLTV  139

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LI+H  +K GDRYEA YSFYFGDYGHI+VQG YLTYE+T+LA
Sbjct  140  LIQHVPDKNGDRYEATYSFYFGDYGHISVQGAYLTYEETHLA  181



>ref|XP_010916944.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Elaeis 
guineensis]
Length=245

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            + KVQE+ VYEINERDRGSP YLRLSQK VN+LGDLVP  NK+Y G+L+KR+GITAG+C+
Sbjct  71   SSKVQEMYVYEINERDRGSPVYLRLSQKEVNSLGDLVPLTNKVYHGNLEKRLGITAGICV  130

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            L++H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  131  LVQHVPERGGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLA  172



>gb|ADL60034.1| allene oxide cyclase [Salvia miltiorrhiza]
Length=245

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NERDRGSPAYLRL QK  NTLGDLVPF+NKLY+GDLQKR+GITAGLC+LI
Sbjct  73   KVQELYVYEMNERDRGSPAYLRLGQKQQNTLGDLVPFSNKLYSGDLQKRLGITAGLCVLI  132

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  ++  DRYEAIYSFYFGDYGHI+VQG YLT  DTYLA
Sbjct  133  QHFPDQNADRYEAIYSFYFGDYGHISVQGAYLTRSDTYLA  172



>ref|XP_009395977.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSP YLRLSQK VN LGDLVPF+NKLY+G+L+KR+GITAG+C+LI
Sbjct  140  KVQELSVYEINERDRGSPVYLRLSQKEVNCLGDLVPFSNKLYSGNLEKRLGITAGICVLI  199

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  200  QHVPERGGDRYEAIYSFYFGDYGHISVQGMYLTYEESYLA  239



>gb|EPS67695.1| allene oxide cyclase, partial [Genlisea aurea]
Length=175

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYLRLS K+VN++GDLVPF+NK+YTGDL+KR GITAG+C+L+
Sbjct  3    KVQELNVYEINERDRGSPAYLRLSNKTVNSIGDLVPFSNKIYTGDLKKRAGITAGICLLV  62

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++E EKKGDR+EA+YSFYFGDYGHI+VQG Y+TY DT LA
Sbjct  63   RNEAEKKGDRFEAMYSFYFGDYGHISVQGPYITYADTDLA  102



>ref|XP_010924770.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Elaeis 
guineensis]
Length=245

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPF+NK+Y G+L+KR+GITAG+CILI
Sbjct  73   KVQELYVYEINERDRNSPAYLSLSQKEVNSLGDLVPFSNKVYHGNLEKRLGITAGICILI  132

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYL+
Sbjct  133  QHVPERNGDRYEAIYSFYFGDYGHISVQGGYLTYEDTYLS  172



>gb|AHZ21033.1| mangrin [Kandelia candel]
Length=256

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  283  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            S P G VQE+CVYEINE DR SPA LRLSQK V +LGDLVPF+NKLYTGDLQKR+GITAG
Sbjct  80   SRPTG-VQEMCVYEINEGDRESPAVLRLSQKPVLSLGDLVPFSNKLYTGDLQKRIGITAG  138

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            + I I+H+ E+KG+R+EAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  139  IAIQIQHKPERKGNRFEAIYSFYFGDYGHIAVQGAYLTYEDTYLA  183



>ref|XP_006857130.1| hypothetical protein AMTR_s00065p00146710 [Amborella trichopoda]
 gb|ERN18597.1| hypothetical protein AMTR_s00065p00146710 [Amborella trichopoda]
Length=256

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQE+ VYEINE DRGSPAYL LSQK +N+LGDLVPF+NKLY G+L+KR GITAG+C+LIK
Sbjct  85   VQEMHVYEINELDRGSPAYLPLSQKPINSLGDLVPFSNKLYHGNLKKRAGITAGICVLIK  144

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            H  EKKGDRYEAI+SFYFGDYGHI+VQG+YLTY+DTYLA
Sbjct  145  HVPEKKGDRYEAIFSFYFGDYGHISVQGEYLTYQDTYLA  183



>dbj|BAI58542.1| mangrin [Rhizophora apiculata]
 dbj|BAI58543.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58544.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58545.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58546.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58547.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58548.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58549.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58550.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58551.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58552.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58553.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58554.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58555.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58556.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58557.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58558.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58559.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58560.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58561.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58562.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58563.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58564.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58565.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58566.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58567.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58568.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58569.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58570.1| mangrin [Rhizophora apiculata]
 dbj|BAI58571.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58572.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58573.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58574.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58575.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58576.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58577.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58578.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58579.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58580.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58581.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58582.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58583.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58584.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58585.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58586.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58587.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58588.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58589.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58590.1| mangrin [Rhizophora apiculata]
 dbj|BAI58591.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58592.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58593.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58594.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58595.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58596.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58597.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58598.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58599.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58600.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58601.1| mangrin, partial [Rhizophora apiculata]
Length=178

 Score =   171 bits (433),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPF+NK+Y+GDLQKR+GITAG+C+ I
Sbjct  36   KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNKVYSGDLQKRIGITAGICVQI  95

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H+ +KKG+R+EAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  96   QHKPDKKGERFEAIYSFYFGDYGHIAVQGAYLTYEDTYLA  135



>ref|XP_008792377.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Phoenix 
dactylifera]
Length=245

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQE+ VYEINERDR SPAYLRLSQK  N+LGDLVPF+NK+Y G L+KR+GITAG+CILI
Sbjct  73   KVQEMYVYEINERDRSSPAYLRLSQKEHNSLGDLVPFSNKVYHGTLEKRLGITAGICILI  132

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYL+
Sbjct  133  QHVPERNGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLS  172



>gb|AIR76995.1| allene oxide cyclase, partial [Lilium longiflorum]
Length=133

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +1

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQEL VYEINE DR SPAYL+LS+K +N+LGDLVPF+NKLY G+LQKR+GITAGLCILI+
Sbjct  1    VQELSVYEINELDRSSPAYLKLSEKPINSLGDLVPFSNKLYHGNLQKRLGITAGLCILIQ  60

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            H  EK GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  61   HVPEKGGDRYEAIYSFYFGDYGHISVQGSYLTYEESYLA  99



>ref|XP_004304145.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=184

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQE  VYEINERDR SPAYL LSQK  ++LGDLVPF NK+YTGDL+KR+GITAGLCILI
Sbjct  11   KVQEFHVYEINERDRSSPAYLSLSQKPAHSLGDLVPFTNKIYTGDLEKRLGITAGLCILI  70

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            + + EKKGDRYEA+YSFYFGDYGHI+VQG YLTYEDT LA
Sbjct  71   ESKPEKKGDRYEAMYSFYFGDYGHISVQGPYLTYEDTSLA  110



>ref|XP_007042039.1| Allene oxide cyclase, putative [Theobroma cacao]
 gb|EOX97870.1| Allene oxide cyclase, putative [Theobroma cacao]
Length=251

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDRGSPAYL LSQKSV +LGDLV F+NKLYTGD+QKR+GIT+G+CIL+
Sbjct  79   KVQELYVYEINERDRGSPAYLSLSQKSVKSLGDLVCFSNKLYTGDMQKRIGITSGMCILV  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H+ EK G+RYEA+ SFYFGDYGH+ VQG Y+TYED+YLA
Sbjct  139  QHKPEKNGERYEALSSFYFGDYGHMTVQGPYMTYEDSYLA  178



>gb|ACS96438.1| allene oxide cyclase [Jatropha curcas]
 gb|KDP29368.1| hypothetical protein JCGZ_18289 [Jatropha curcas]
Length=258

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLC  468
            PAGKVQ+L VYEINERDR SPA L+LS+K    LGDLVPF NKLY+GDLQKR GITAGLC
Sbjct  83   PAGKVQQLNVYEINERDRDSPAILKLSKKPELALGDLVPFTNKLYSGDLQKRFGITAGLC  142

Query  469  ILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +LI+H  EK GDRYEA YSFYFGDYGHI+VQG YLTY+DT+LA
Sbjct  143  VLIQHVPEKNGDRYEANYSFYFGDYGHISVQGAYLTYQDTFLA  185



>ref|XP_011078449.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Sesamum indicum]
Length=248

 Score =   171 bits (432),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            QS+   KVQEL VYE+NERDRGSPAYL+LSQK    LGDLVPF+NKLY+GDLQKR+GITA
Sbjct  79   QSSRPTKVQELYVYEMNERDRGSPAYLKLSQKEGKFLGDLVPFSNKLYSGDLQKRLGITA  138

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC+LI++  E KGDRYEA+YSFYFGDYGH+ VQG YLTYEDTYLA
Sbjct  139  GLCMLIQNFPE-KGDRYEAVYSFYFGDYGHVTVQGAYLTYEDTYLA  183



>gb|ABO61151.1| allene oxide cyclase, partial [Nicotiana attenuata]
Length=86

 Score =   165 bits (418),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +1

Query  349  PAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSF  528
            PAYLRLSQK+VN+LGDLVPF+NKLYTGDL+KR+GITAGLCILIKHEEEKKGDRYEAIYSF
Sbjct  1    PAYLRLSQKTVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIKHEEEKKGDRYEAIYSF  60

Query  529  YFGDYGHIAVQGQYLTYEDTYLA  597
            YFGDYGHIAVQG YLTYEDTYLA
Sbjct  61   YFGDYGHIAVQGSYLTYEDTYLA  83



>ref|XP_003637010.1| Allene-oxide cyclase [Medicago truncatula]
 gb|KEH25316.1| allene oxide cyclase [Medicago truncatula]
Length=249

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            QS+ + KVQEL VYEINE+DRGSP YLRLSQK+VN L DL+ F+NKLY+G LQKRVGITA
Sbjct  70   QSSNSVKVQELSVYEINEKDRGSPVYLRLSQKNVNILDDLISFSNKLYSGCLQKRVGITA  129

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLA  597
            G+C+LI+++ EKKGD YEAIYSFYFG+YGHI+VQG YLTY EDTYLA
Sbjct  130  GICVLIQNKAEKKGDIYEAIYSFYFGEYGHISVQGSYLTYEEDTYLA  176



>ref|XP_006430816.1| hypothetical protein CICLE_v10012528mg [Citrus clementina]
 gb|ESR44056.1| hypothetical protein CICLE_v10012528mg [Citrus clementina]
Length=256

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 2/101 (2%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKS-VNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYEINE DRGSPAYLRLS+K  +N+LGDLVPF+NKLY+GDLQKRVGITAG+CIL
Sbjct  84   KVQELYVYEINELDRGSPAYLRLSKKCFINSLGDLVPFSNKLYSGDLQKRVGITAGICIL  143

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H +  KGDRYEA+YSFYFGDYGHI+VQG YLTY+DT LA
Sbjct  144  IQH-KPMKGDRYEAVYSFYFGDYGHISVQGSYLTYKDTCLA  183



>dbj|BAI58602.1| mangrin [Rhizophora mucronata]
 dbj|BAI58603.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58604.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58605.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58606.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58607.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58608.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58609.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58610.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58611.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58612.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58613.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58614.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58615.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58616.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58617.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58618.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58619.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58620.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58621.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58622.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58623.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58624.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58625.1| mangrin [Rhizophora mucronata]
 dbj|BAI58626.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58627.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58628.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58629.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58630.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58631.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58632.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58633.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58634.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58635.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58636.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58637.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58638.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58639.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58640.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58641.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58642.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58643.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58644.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58645.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58646.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58647.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58648.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58649.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58650.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58651.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58652.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58653.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58654.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58655.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58656.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58657.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58658.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58659.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58660.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58661.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58662.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58663.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58664.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58665.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58666.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58667.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58668.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58669.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58670.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58671.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58672.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58673.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58674.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58675.1| mangrin, partial [Rhizophora mucronata]
Length=142

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPF+NK+Y+GDLQKR+GITAG+C+ I
Sbjct  1    KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNKVYSGDLQKRIGITAGICVQI  60

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H+ + KG+R+EAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  61   QHKPD-KGERFEAIYSFYFGDYGHIAVQGAYLTYEDTYLA  99



>gb|ADL16493.1| allene oxide cyclase [Artemisia annua]
Length=249

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KV ELCVYEINERDRGSPAYLRL QK VN+LGDLVPF NK+Y+ DL+ R+GITAG+CILI
Sbjct  76   KVHELCVYEINERDRGSPAYLRLGQKPVNSLGDLVPFTNKIYSADLKTRLGITAGICILI  135

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            K+  E KGDRYEAIYSF+ GDYG I+ QG Y+T EDTYLA
Sbjct  136  KNMPEVKGDRYEAIYSFHLGDYGQISAQGAYITTEDTYLA  175



>ref|XP_006482293.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Citrus 
sinensis]
Length=255

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 2/101 (2%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKS-VNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYEINE DRGSPAYLRLS+K  +N+LGDLVPF+NKLY+GDLQKRVGITAG+CIL
Sbjct  83   KVQELYVYEINELDRGSPAYLRLSKKFFINSLGDLVPFSNKLYSGDLQKRVGITAGICIL  142

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H +  KGDRYEA+YSFYFGDYGHI+VQG YLTY+DT LA
Sbjct  143  IQH-KPMKGDRYEAVYSFYFGDYGHISVQGSYLTYKDTCLA  182



>gb|AFP87550.1| allene oxide cyclase 4 [Oryza sativa Indica Group]
Length=240

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +1

Query  295  GKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
             KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF NKLY+G L KR+GI+AG+CI
Sbjct  66   AKVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGISAGICI  125

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  126  LIQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  167



>ref|NP_001050447.1| Os03g0438100 [Oryza sativa Japonica Group]
 emb|CAD38519.1| allene oxide cyclase [Oryza sativa Japonica Group]
 gb|AAR89017.1| allene oxide cyclase [Oryza sativa Japonica Group]
 gb|ABF96821.1| Allene oxide cyclase 3, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12361.1| Os03g0438100 [Oryza sativa Japonica Group]
 gb|EAY90593.1| hypothetical protein OsI_12194 [Oryza sativa Indica Group]
 gb|ABV03555.1| AOC [Oryza sativa Japonica Group]
 gb|ABV45432.1| AOC [Oryza sativa Japonica Group]
 dbj|BAG87277.1| unnamed protein product [Oryza sativa Japonica Group]
Length=240

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +1

Query  295  GKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
             KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF NKLY+G L KR+GI+AG+CI
Sbjct  66   AKVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGISAGICI  125

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  126  LIQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  167



>gb|EAZ27451.1| hypothetical protein OsJ_11399 [Oryza sativa Japonica Group]
Length=241

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF NKLY+G L KR+GI+AG+CIL
Sbjct  68   KVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGISAGICIL  127

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  128  IQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  168



>gb|EMT08815.1| Allene oxide cyclase 3, chloroplastic [Aegilops tauschii]
Length=239

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYS YFGDYGHIAVQG YLTYE++YLA
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHIAVQGPYLTYEESYLA  165



>ref|XP_004983950.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Setaria 
italica]
Length=245

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF NK+Y+G L KR+GITAG+CIL
Sbjct  72   KVQELYVYELNERDRESPAYLRLSAKQTENALGDLVPFTNKVYSGSLDKRLGITAGICIL  131

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  132  IQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  172



>ref|XP_002465087.1| hypothetical protein SORBIDRAFT_01g031870 [Sorghum bicolor]
 gb|EER92085.1| hypothetical protein SORBIDRAFT_01g031870 [Sorghum bicolor]
Length=274

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYEINERDR SPAYLRLS K S N LGDLVPF NK+Y+G L KR+GITAG+C+L
Sbjct  101  KVQELYVYEINERDRESPAYLRLSAKQSENALGDLVPFTNKVYSGSLDKRLGITAGICVL  160

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  161  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  201



>ref|NP_001267900.1| allene oxide cyclase [Vitis vinifera]
 gb|ABD64688.1| allene oxide cyclase [Vitis vinifera]
Length=254

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  334  RDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYE  513
            RDRGSPAYLRLSQKSVN+LGDLVPF+NK+YTGDL+KR+G+TAG+C+LI++   KKGDRYE
Sbjct  94   RDRGSPAYLRLSQKSVNSLGDLVPFSNKIYTGDLEKRLGVTAGICVLIQNVPGKKGDRYE  153

Query  514  AIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            AIYSFYFGDYGHI+VQG YLTYEDTYLA
Sbjct  154  AIYSFYFGDYGHISVQGAYLTYEDTYLA  181



>ref|XP_006650236.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Oryza 
brachyantha]
Length=242

 Score =   163 bits (413),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF NK+Y+G L KR+GITAG+C+L
Sbjct  69   KVQEMYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYSGSLDKRLGITAGICVL  128

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            ++H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  129  VQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  169



>gb|KFK35078.1| hypothetical protein AALP_AA5G232400 [Arabis alpina]
Length=254

 Score =   163 bits (412),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NE DR SPA L+L +K    LGDLVPF NKLYTGDL+KRVGITAGLC+LI
Sbjct  82   KVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITAGLCVLI  141

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQGQYLTYEDT+LA
Sbjct  142  QHVPEKNGDRFEANYSFYFGDYGHLSVQGQYLTYEDTFLA  181



>ref|XP_002524412.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF38023.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus 
communis]
Length=259

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYEINERDR SPA L+LS+K     LGDLVPF NKLY+GDL+KR+GITAGL +L
Sbjct  86   KIQELNVYEINERDRESPAILKLSKKPDQLALGDLVPFTNKLYSGDLKKRLGITAGLSVL  145

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            IKH  EK GDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA
Sbjct  146  IKHVPEKNGDRYEAIYSFYFGDYGHISVQGAYLTYDDTYLA  186



>ref|XP_008359967.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Malus 
domestica]
Length=260

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = +1

Query  289  PAGKV-QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGL  465
            P  +V Q L VYEINERDRGSP YLRLS K V++LGDLVP  NKLYTGDLQKR+GITAG+
Sbjct  81   PGSEVPQVLHVYEINERDRGSPVYLRLSGKEVHSLGDLVPLTNKLYTGDLQKRIGITAGI  140

Query  466  CILIKHEEEK--KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             ILI+H  EK   GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYL+
Sbjct  141  TILIQHYPEKLNSGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLS  186



>ref|XP_008388976.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Malus 
domestica]
Length=260

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = +1

Query  289  PAGKV-QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGL  465
            P  +V Q L VYEINERDRGSP YLRLS K V++LGDLVP  NKLYTGDLQKR+GITAG+
Sbjct  81   PGSEVPQVLHVYEINERDRGSPVYLRLSGKEVHSLGDLVPLTNKLYTGDLQKRIGITAGI  140

Query  466  CILIKHEEEK--KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             ILI+H  EK   GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYL+
Sbjct  141  TILIQHYPEKINSGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLS  186



>emb|CDY59866.1| BnaC09g52550D [Brassica napus]
Length=253

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF NKLYTGDL+KRVGITA
Sbjct  75   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  134

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA
Sbjct  135  GLCVLIQHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDTFLA  180



>ref|NP_001141267.1| allene oxide cyclase 4 [Zea mays]
 gb|ACF85913.1| unknown [Zea mays]
 gb|AFW88169.1| allene oxide cyclase 4 [Zea mays]
Length=238

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF NK+Y G L KR+GITAG+C+L
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGITAGICVL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  125  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESYLA  165



>gb|ACG39242.1| allene oxide cyclase 4 [Zea mays]
Length=238

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF NK+Y G L KR+GITAG+C+L
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGITAGICVL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  125  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESYLA  165



>ref|NP_001105245.1| allene oxide cyclase1 [Zea mays]
 gb|AAR33049.1| allene oxide cyclase [Zea mays]
 gb|ACF80011.1| unknown [Zea mays]
 tpg|DAA45890.1| TPA: allene oxide cyclase 4 [Zea mays]
Length=238

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF NK+Y G L KR+G+TAG+C+L
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGVTAGICVL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  125  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  165



>gb|AHA93095.1| allene oxide cyclase 1 [Triticum aestivum]
Length=239

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYS YFGDYGHI VQG YLTYE++YLA
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHITVQGPYLTYEESYLA  165



>gb|ACG32920.1| allene oxide cyclase 4 [Zea mays]
Length=240

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF NK+Y G L KR+G+TAG+C+L
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGVTAGICVL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  125  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLA  165



>ref|XP_010556382.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Tarenaya 
hassleriana]
Length=250

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL +YE+NE DR SPA L+L  K    LGDLVPF NKLYTGDL KRVGITAGLC+LI
Sbjct  78   KVQELHIYELNEGDRNSPAVLKLGNKQELCLGDLVPFTNKLYTGDLTKRVGITAGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EAIYSFYFGDYGH+AVQG YLTYEDT+L+
Sbjct  138  QHVPEKNGDRFEAIYSFYFGDYGHLAVQGPYLTYEDTFLS  177



>ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Brachypodium 
distachyon]
Length=243

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  70   KVQELYVYELNERDRESPAYLRLSAKQSENALGDLVPFTNKVYNGSLDKRIGITAGICIL  129

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYS YFGDYGHI VQG YLTYE++YLA
Sbjct  130  IQHVPERNGDRYEAIYSLYFGDYGHITVQGPYLTYEESYLA  170



>gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis]
Length=238

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYS YFGDYGH+ VQG YLTYE++YLA
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHLTVQGPYLTYEESYLA  165



>ref|XP_002875279.1| hypothetical protein ARALYDRAFT_484340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51538.1| hypothetical protein ARALYDRAFT_484340 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  84   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  143

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EK GDR+EA YSFYFGDYGH++VQGQYLTYEDT+LA
Sbjct  144  IQHVPEKNGDRFEANYSFYFGDYGHLSVQGQYLTYEDTFLA  184



>dbj|BAJ96870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLS-QKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS  +S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYS YFGDYGHI++QG YLTYE++YLA
Sbjct  125  IQHVPERNGDRYEAIYSMYFGDYGHISLQGPYLTYEESYLA  165



>ref|NP_566777.1| allene oxide cyclase 3 [Arabidopsis thaliana]
 sp|Q9LS01.1|AOC3_ARATH RecName: Full=Allene oxide cyclase 3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA95765.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64909.1| allene oxide cyclase, putative [Arabidopsis thaliana]
 emb|CAC83763.1| allene oxide cyclase [Arabidopsis thaliana]
 dbj|BAF01112.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77067.1| allene oxide cyclase 3 [Arabidopsis thaliana]
Length=258

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  84   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  143

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EK GDR+EA YSFYFGDYGH++VQGQYLTYEDT+LA
Sbjct  144  IQHVPEKSGDRFEASYSFYFGDYGHLSVQGQYLTYEDTFLA  184



>emb|CAC83766.1| allene oxide cyclase [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLS-QKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS  +S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYS YFGDYGHI++QG YLTYE++YLA
Sbjct  125  IQHVPERNGDRYEAIYSMYFGDYGHISLQGPYLTYEESYLA  165



>gb|ACY74378.1| allene oxidase cyclase [Brassica napus]
Length=253

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF NKLYTGDL+KRVGITA
Sbjct  75   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  134

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC+LI+H  EK GDR+EA YSFY GDYGH++VQG YLTYEDT+LA
Sbjct  135  GLCVLIQHVPEKNGDRFEATYSFYLGDYGHLSVQGPYLTYEDTFLA  180



>ref|XP_009114114.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Brassica rapa]
 gb|ACY74379.1| allene oxidase cyclase [Brassica napus]
 emb|CDY04179.1| BnaA09g19570D [Brassica napus]
Length=253

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF NKLYTGDL+KRVGITA
Sbjct  75   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  134

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC+LI+H  EK GDR+EA YSFY GDYGH++VQG YLTYEDT+LA
Sbjct  135  GLCVLIQHVPEKNGDRFEATYSFYLGDYGHLSVQGPYLTYEDTFLA  180



>gb|ACY74377.1| allene oxidase cyclase [Brassica napus]
Length=247

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF NKLYTGDL+KRVGITA
Sbjct  69   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  128

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC+LI+H  EK GDR+EA YSFY GDYGH++VQG YLTYEDT+LA
Sbjct  129  GLCVLIQHVPEKNGDRFEATYSFYLGDYGHLSVQGPYLTYEDTFLA  174



>ref|XP_010692623.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K+ E CVYEINERDR SPA L+LSQK V +LGDL+PF NKLYT DL+ R+GI+AG+CILI
Sbjct  75   KIHEFCVYEINERDRASPAVLKLSQKPVFSLGDLIPFTNKLYTADLKTRLGISAGICILI  134

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEA +S YFGDYGHI++QG YLTY+++YLA
Sbjct  135  QNKPEKKGDRYEANFSLYFGDYGHISIQGPYLTYDESYLA  174



>ref|XP_010692616.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=249

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K+ E CVYEINERDR SPA L+LSQK V +LGDL+PF NKLYT DL+ R+GI+AG+CILI
Sbjct  76   KIHEFCVYEINERDRASPAVLKLSQKPVFSLGDLIPFTNKLYTADLKTRLGISAGICILI  135

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +++ EKKGDRYEA +S YFGDYGHI++QG YLTY+++YLA
Sbjct  136  QNKPEKKGDRYEANFSLYFGDYGHISIQGPYLTYDESYLA  175



>gb|AGU41846.1| allene oxide cyclase [Triticum aestivum]
Length=238

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NE DR SPAYLRLS K S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNEHDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  E+ GDRYEAIYS YFGDYGHI VQG YLTYE++YLA
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHITVQGPYLTYEESYLA  165



>ref|XP_006292768.1| hypothetical protein CARUB_v10019017mg [Capsella rubella]
 gb|EOA25666.1| hypothetical protein CARUB_v10019017mg [Capsella rubella]
Length=257

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  142

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EK GDR+EA YSFYFGDYGH++VQGQYLTY+DT+LA
Sbjct  143  IQHVPEKSGDRFEANYSFYFGDYGHLSVQGQYLTYQDTFLA  183



>gb|EYU29946.1| hypothetical protein MIMGU_mgv1a012460mg [Erythranthe guttata]
Length=250

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQE+CVYEINE+DRGSP YL+LS K  N+LGDL PF NKLY+G+LQKR+GITAGLC+LI
Sbjct  78   KVQEMCVYEINEQDRGSPVYLKLSPKKENSLGDLGPFTNKLYSGNLQKRLGITAGLCVLI  137

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E   DR+EAIYS YFGDYGHI++QG Y+ ++DT LA
Sbjct  138  QHSPETGNDRFEAIYSMYFGDYGHISIQGAYVLHQDTILA  177



>ref|XP_010528046.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Tarenaya 
hassleriana]
Length=249

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NE DR SPA L+L +K    LGDL+PF NKLY+GDL KRVGITAGLC+LI
Sbjct  77   KVQELHVYELNEGDRNSPAVLKLGKKQELCLGDLIPFTNKLYSGDLTKRVGITAGLCVLI  136

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA
Sbjct  137  QHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDTHLA  176



>ref|XP_010502459.1| PREDICTED: allene oxide cyclase 3, chloroplastic isoform X2 [Camelina 
sativa]
Length=257

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  142

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA
Sbjct  143  IQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLA  183



>ref|XP_010514199.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Camelina 
sativa]
Length=257

 Score =   158 bits (399),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  142

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA
Sbjct  143  IQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLA  183



>ref|XP_006395626.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum]
 gb|ESQ32912.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum]
Length=252

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K+QEL VYE+NE DR SPA L+L +K    LGDLVPF NKLYTGDL+KRVGITAGLC+LI
Sbjct  80   KIQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITAGLCVLI  139

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFG+YGH+AVQG YLTY+DT+LA
Sbjct  140  QHVPEKNGDRFEANYSFYFGEYGHLAVQGPYLTYQDTFLA  179



>ref|XP_010476324.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Camelina 
sativa]
Length=254

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE NE DR SPA L+L +K     LGDLVPF NKLYTGDL KR+GITAGLC+L
Sbjct  80   KVQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  139

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  140  IQHVSEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  180



>ref|XP_001783824.1| predicted protein [Physcomitrella patens]
 emb|CAD48752.1| allene oxide cyclase [Physcomitrella patens]
 gb|AAN39877.1| allene oxide cyclase [Physcomitrella patens]
 gb|EDQ51364.1| predicted protein [Physcomitrella patens]
Length=189

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 7/113 (6%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKS-------VNTLGDLVPFNNKLYTGDLQ  438
            + A  G VQEL VYEINERDRGSP +L    K        VN+LGDLVPF+NK+Y G L+
Sbjct  4    RGASPGHVQELFVYEINERDRGSPVFLPFGGKKQPGTDAHVNSLGDLVPFSNKIYDGSLK  63

Query  439  KRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             R+GITAGLC LI H ++K GDRYEA+YSFYFGDYGHI+VQG Y+TYED+YLA
Sbjct  64   TRLGITAGLCTLISHSDQKNGDRYEALYSFYFGDYGHISVQGPYITYEDSYLA  116



>pdb|4H6B|A Chain A, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|D Chain D, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|C Chain C, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|B Chain B, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|E Chain E, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|F Chain F, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|G Chain G, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|H Chain H, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|I Chain I, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|J Chain J, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|K Chain K, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|L Chain L, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6C|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|G Chain G, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|H Chain H, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|I Chain I, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|J Chain J, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|K Chain K, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|L Chain L, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
Length=195

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 7/113 (6%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKS-------VNTLGDLVPFNNKLYTGDLQ  438
            + A  G VQEL VYEINERDRGSP +L    K        VN+LGDLVPF+NK+Y G L+
Sbjct  10   RGASPGHVQELFVYEINERDRGSPVFLPFGGKKQPGTDAHVNSLGDLVPFSNKIYDGSLK  69

Query  439  KRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             R+GITAGLC LI H ++K GDRYEA+YSFYFGDYGHI+VQG Y+TYED+YLA
Sbjct  70   TRLGITAGLCTLISHSDQKNGDRYEALYSFYFGDYGHISVQGPYITYEDSYLA  122



>ref|NP_172786.1| allene oxide cyclase 4 [Arabidopsis thaliana]
 sp|Q93ZC5.1|AOC4_ARATH RecName: Full=Allene oxide cyclase 4, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL15267.1| At1g13280/T6J4_23 [Arabidopsis thaliana]
 gb|AAM98257.1| At1g13280/T6J4_23 [Arabidopsis thaliana]
 emb|CAC83764.1| allene oxide cyclase [Arabidopsis thaliana]
 gb|AEE28994.1| allene oxide cyclase 4 [Arabidopsis thaliana]
Length=254

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA L+L +K     LGDLVPF NKLYTGDL KR+GITAGLC+L
Sbjct  80   KIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  139

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  140  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  180



>ref|XP_010554241.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=254

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NE DR SPA L+L +K    LGDLVPF NKLY+GDL KR+GITAGLC+LI
Sbjct  82   KVQELHVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYSGDLTKRLGITAGLCVLI  141

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  E+ GDR+EA YSFYFGDYGH++VQG YLTYEDTYL+
Sbjct  142  QHVPERNGDRFEATYSFYFGDYGHLSVQGPYLTYEDTYLS  181



>gb|AAG09557.1|AC011810_16 Unknown Protein [Arabidopsis thaliana]
Length=180

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            ++QEL VYE NE DR SPA L+L +K     LGDLVPF NKLYTGDL KR+GITAGLC+L
Sbjct  6    QIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  65

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  66   IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  106



>ref|XP_010425230.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like, partial 
[Camelina sativa]
Length=250

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL V+E+NE DR SPA L+L +K     LGDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  84   KIQELNVHELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  143

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA
Sbjct  144  IQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLA  184



>ref|XP_010425228.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=246

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  79   KVQELSVYELNELDRHSPKILKNAMSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKG+R+EA YSFYFGDYGH++VQGQYLTYED++LA
Sbjct  139  EHVPEKKGERFEATYSFYFGDYGHLSVQGQYLTYEDSFLA  178



>ref|XP_010495179.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Camelina sativa]
Length=252

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA ++L +K     LGDLVPF NKLYTGDL KR+GITAGLC+L
Sbjct  78   KIQELNVYEFNEGDRNSPALIKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  137

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  138  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  178



>gb|KFK43593.1| hypothetical protein AALP_AA1G146300 [Arabis alpina]
Length=253

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA L+L +      LGD VPF NKLYTGDL KRVGITAGLC+L
Sbjct  79   KIQELNVYEFNEGDRNSPAVLKLGKNPTQLCLGDFVPFTNKLYTGDLTKRVGITAGLCVL  138

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  139  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  179



>ref|XP_010514196.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=248

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q A   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITA
Sbjct  69   QDARPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA
Sbjct  129  GLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLA  174



>ref|XP_010458779.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Camelina 
sativa]
Length=255

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA ++L +K     LGDLVPF NKLYTGDL KR+GITAGLC+L
Sbjct  81   KIQELNVYEFNEGDRNSPALIKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  140

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  141  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  181



>ref|XP_006304140.1| hypothetical protein CARUB_v10010123mg [Capsella rubella]
 gb|EOA37038.1| hypothetical protein CARUB_v10010123mg [Capsella rubella]
Length=245

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SP  L+L +K     LGDLVPF NKLYTGDL KR+GITAGLC+L
Sbjct  71   KIQELNVYEFNEGDRNSPTVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  130

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  131  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  171



>ref|XP_010514195.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=248

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q A   +VQEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITA
Sbjct  69   QDARPSRVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA
Sbjct  129  GLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLA  174



>ref|XP_010502447.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=248

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q +   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITA
Sbjct  69   QDSRPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA
Sbjct  129  GLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLA  174



>gb|ACN27052.1| unknown [Zea mays]
 gb|AFW88170.1| hypothetical protein ZEAMMB73_091885 [Zea mays]
Length=249

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 12/112 (11%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNK-----------LYTGDLQK  441
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF NK           +Y G L K
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKPLFLPTHPCTQVYNGSLDK  124

Query  442  RVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            R+GITAG+C+LI+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLA
Sbjct  125  RLGITAGICVLIQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESYLA  176



>ref|XP_006291745.1| hypothetical protein CARUB_v10017913mg [Capsella rubella]
 gb|EOA24643.1| hypothetical protein CARUB_v10017913mg [Capsella rubella]
Length=248

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q +   K+QEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITA
Sbjct  69   QDSRPSKIQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA
Sbjct  129  GLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLA  174



>ref|XP_006291721.1| hypothetical protein CARUB_v10017888mg [Capsella rubella]
 gb|EOA24619.1| hypothetical protein CARUB_v10017888mg [Capsella rubella]
Length=254

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYELNELDRHSPKILKNAMSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  141  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  180



>pdb|4CQ6|A Chain A, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ6|B Chain B, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ6|C Chain C, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ7|A Chain A, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
 pdb|4CQ7|B Chain B, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
 pdb|4CQ7|C Chain C, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
Length=188

 Score =   151 bits (381),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  114



>pdb|2GIN|A Chain A, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|B Chain B, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|C Chain C, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|D Chain D, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|E Chain E, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|F Chain F, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
Length=188

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  114



>ref|NP_566776.1| allene oxide cyclase 2 [Arabidopsis thaliana]
 sp|Q9LS02.1|AOC2_ARATH RecName: Full=Allene oxide cyclase 2, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK55711.1|AF380630_1 AT3g25770/K13N2_9 [Arabidopsis thaliana]
 dbj|BAA95764.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL06792.1| AT3g25770/K13N2_9 [Arabidopsis thaliana]
 emb|CAC83762.1| allene oxide cyclase [Arabidopsis thaliana]
 gb|AEE77066.1| allene oxide cyclase 2 [Arabidopsis thaliana]
Length=253

 Score =   152 bits (385),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  80   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  139

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  140  EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  179



>ref|XP_002875278.1| hypothetical protein ARALYDRAFT_484339 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51537.1| hypothetical protein ARALYDRAFT_484339 [Arabidopsis lyrata subsp. 
lyrata]
Length=254

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  141  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  180



>ref|XP_010425227.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=249

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q +   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITA
Sbjct  70   QDSRPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  129

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC++I+H  E+ GDR+EA YSFYFGDYGH+AVQG YLTYED++LA
Sbjct  130  GLCVVIEHVPERNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLA  175



>ref|XP_010502446.1| PREDICTED: allene oxide cyclase 2, chloroplastic [Camelina sativa]
Length=248

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  75   KVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  134

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  135  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  174



>pdb|1Z8K|A Chain A, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|1Z8K|B Chain B, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|1Z8K|C Chain C, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|2Q4I|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
 pdb|2Q4I|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
 pdb|2Q4I|C Chain C, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
Length=193

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  20   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  79

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  80   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  119



>pdb|2DIO|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
 pdb|2DIO|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
 pdb|2DIO|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
Length=188

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  114



>ref|XP_010430726.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=296

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q +   KVQEL VYE+NE DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITA
Sbjct  68   QDSRPSKVQELSVYELNELDRHSPKILKNAFSLTFGLGDLVPFTNKLYTGDLKKRVGITA  127

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC++I+H  EK G+R+EAIYSFYFGDYGH+AVQG YLTYED++LA
Sbjct  128  GLCVVIEHVPEKNGERFEAIYSFYFGDYGHLAVQGPYLTYEDSFLA  173



>pdb|2BRJ|A Chain A, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
 pdb|2BRJ|B Chain B, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
 pdb|2BRJ|C Chain C, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
Length=188

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  114



>emb|CDX83551.1| BnaC07g22910D [Brassica napus]
Length=247

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  74   RIQELSVYELNELDRHSPKILKNAISLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  133

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             H  EKKGDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  134  AHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  173



>ref|XP_002889998.1| hypothetical protein ARALYDRAFT_334627 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66257.1| hypothetical protein ARALYDRAFT_334627 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA L+L +K     LGDLVPF NKLYTGDL KR+GITAGLC+L
Sbjct  78   KIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  137

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  +  GDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  138  IQHVPKMNGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLA  178



>emb|CDY50180.1| BnaC08g15790D [Brassica napus]
Length=250

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA L+L +      +GDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  76   KIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGITAGLCVL  135

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKG+R+EA YSFYFGDYGHI+VQG YLTYEDT LA
Sbjct  136  IQHVPEKKGERFEASYSFYFGDYGHISVQGPYLTYEDTLLA  176



>ref|XP_001751254.1| predicted protein [Physcomitrella patens]
 gb|EDQ83571.1| predicted protein [Physcomitrella patens]
Length=188

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 80/104 (77%), Gaps = 6/104 (6%)
 Frame = +1

Query  301  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            VQEL VYEINERDRGSP  L    K        N+LGDLVPF+NK+Y G LQ+R+GITAG
Sbjct  11   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  70

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  594
            +C LI H  EKKGDRYEA YSFYFGDYGHI+VQG Y+TYEDT L
Sbjct  71   ICTLISHNAEKKGDRYEAQYSFYFGDYGHISVQGPYITYEDTEL  114



>emb|CDX83550.1| BnaC07g22900D [Brassica napus]
Length=252

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  79   RIQELSVYELNELDRHSPKILKNAACLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             H  EKKGDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  139  AHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  178



>pdb|4H69|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H6A|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
Length=194

 Score =   148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 80/104 (77%), Gaps = 6/104 (6%)
 Frame = +1

Query  301  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            VQEL VYEINERDRGSP  L    K        N+LGDLVPF+NK+Y G LQ+R+GITAG
Sbjct  17   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  76

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  594
            +C LI H  EKKGDRYEA YSFYFGDYGHI+VQG Y+TYEDT L
Sbjct  77   ICTLISHNAEKKGDRYEAQYSFYFGDYGHISVQGPYITYEDTEL  120



>pdb|1ZVC|A Chain A, X-Ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25760
Length=189

 Score =   148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  16   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  75

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  76   EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  115



>ref|XP_009152186.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Brassica 
rapa]
Length=205

 Score =   149 bits (375),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            +GK QEL VYE+NERDR SPA L+L +K    LGDLVPF NKLYTGDL+KRVGITAGL +
Sbjct  31   SGKTQELNVYELNERDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITAGLYV  90

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LI+H  EK GDR+EA YSFYFG  G ++V+GQYLTYEDT+LA
Sbjct  91   LIQHVPEKNGDRFEANYSFYFGHCGQLSVEGQYLTYEDTFLA  132



>ref|NP_189204.1| allene oxide cyclase 1 [Arabidopsis thaliana]
 sp|Q9LS03.1|AOC1_ARATH RecName: Full=Allene oxide cyclase 1, chloroplastic; AltName: 
Full=Early-responsive to dehydration 12 protein; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA95763.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAC83761.1| allene oxide cyclase [Arabidopsis thaliana]
 dbj|BAD43155.1| ERD12 protein [Arabidopsis thaliana]
 dbj|BAD44540.1| ERD12 protein [Arabidopsis thaliana]
 gb|ABD19660.1| At3g25760 [Arabidopsis thaliana]
 gb|AEE77065.1| allene oxide cyclase 1 [Arabidopsis thaliana]
Length=254

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  141  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  180



>dbj|BAB63918.1| ERD12 protein [Arabidopsis thaliana]
Length=252

 Score =   150 bits (378),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  79   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  139  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  178



>gb|KFK35075.1| hypothetical protein AALP_AA5G232000 [Arabis alpina]
Length=732

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCI  471
            +GKVQEL VYE+NE DR SP  L+     + +LGDLVPF NKLYTGDL+KRVGITAGLC+
Sbjct  73   SGKVQELSVYELNEGDRESPKILKHGLSLMFSLGDLVPFTNKLYTGDLKKRVGITAGLCV  132

Query  472  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  133  VIEHVHEKNGDRFEASYSFYFGDYGHLSVQGPYLTYEDSFLA  174



>emb|CAD48753.1| allene oxide cyclase [Physcomitrella patens]
Length=188

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 80/105 (76%), Gaps = 6/105 (6%)
 Frame = +1

Query  301  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            VQEL VYEINERDRGSP  L    K        N+LGDLVPF+NK+Y G LQ+R+GITAG
Sbjct  11   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  70

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +C LI H  EKKGDRYEA YSFYFGDYGHI+VQG Y+TYEDT L 
Sbjct  71   ICTLISHNAEKKGDRYEAQYSFYFGDYGHISVQGPYITYEDTELV  115



>emb|CDY72244.1| BnaCnng76690D [Brassica napus]
Length=252

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            ++QEL VYE+NE DR SP  L+        LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  79   RIQELSVYELNELDRHSPKILKNVISLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             H  EKKGDR+EA YSFYFGDYGH++VQG Y+TYED++LA
Sbjct  139  AHVPEKKGDRFEATYSFYFGDYGHLSVQGPYMTYEDSFLA  178



>emb|CDY13582.1| BnaA06g33410D [Brassica napus]
Length=252

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  79   RIQELSVYELNELDRHSPKILKNAACLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  139  AHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  178



>emb|CDY59869.1| BnaC09g52570D [Brassica napus]
Length=253

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+        LGDLVPF NKLYT DL+KRVGITAGLC++I
Sbjct  80   KVQELNVYEINELDRHSPKILKNVMSLKFRLGDLVPFTNKLYTADLKKRVGITAGLCVVI  139

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKGDR+EA YSFYFGDYGH++VQG YLTYE+++LA
Sbjct  140  QHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEESFLA  179



>ref|XP_009114115.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Brassica 
rapa]
 emb|CDY04177.1| BnaA09g19550D [Brassica napus]
Length=253

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEINE DR SP  L+        LGDLVPF NKLYT DL+KRVGITAGLC++I
Sbjct  80   KVQELNVYEINELDRHSPKILKNVMSLKFRLGDLVPFTNKLYTADLKKRVGITAGLCVVI  139

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EKKGDR+EA YSFYFGDYGH++VQG YLTYE+++LA
Sbjct  140  QHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEESFLA  179



>ref|XP_009110591.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Brassica rapa]
 emb|CDY21090.1| BnaA08g24350D [Brassica napus]
Length=249

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA L+L +      +GDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  75   KIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGITAGLCVL  134

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKG+R+EA YSFYFG+YGHI+VQG YLTYEDT LA
Sbjct  135  IQHVPEKKGERFEASYSFYFGEYGHISVQGPYLTYEDTLLA  175



>ref|XP_010514198.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=252

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL +YE+NE DR SP  L+ +   +  LGDLVPF NKLY GDL+KRVGITAGLC++I
Sbjct  79   KVQELSMYELNELDRHSPKILKNAMSLIFGLGDLVPFTNKLYIGDLKKRVGITAGLCVVI  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR+EA Y+FYFGDYGH++VQG YLTYED++LA
Sbjct  139  EHVPEKNGDRFEATYNFYFGDYGHLSVQGPYLTYEDSFLA  178



>ref|XP_006395628.1| hypothetical protein EUTSA_v10004824mg [Eutrema salsugineum]
 gb|ESQ32914.1| hypothetical protein EUTSA_v10004824mg [Eutrema salsugineum]
Length=249

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYE+NE DR SP  L+ +      LGDLVPF NKLYTGDL+K VGITAGLC++I
Sbjct  76   KVQELNVYELNELDRDSPKILKNAMSLTFGLGDLVPFTNKLYTGDLKKCVGITAGLCVVI  135

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDRYEA YSFYFG+YGH++VQG YLTYED++LA
Sbjct  136  EHVPEKNGDRYEATYSFYFGEYGHLSVQGPYLTYEDSFLA  175



>gb|ABV89668.1| ERD12 protein [Brassica rapa]
Length=264

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            K+QEL VYE NE DR SPA L+L +      +GDLVPF NKLYTGDL+KRVGITAGLC+L
Sbjct  75   KIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGITAGLCVL  134

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            I+H  EKKG+R+EA YSFYFG+YGHI+VQG YLTYEDT LA
Sbjct  135  IQHVPEKKGERFEASYSFYFGEYGHISVQGPYLTYEDTLLA  175



>ref|XP_008370524.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Malus 
domestica]
Length=258

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 85/106 (80%), Gaps = 3/106 (3%)
 Frame = +1

Query  289  PAGKV-QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGL  465
            PA +V Q L VYE+NE DRGSPAYL LS K V++LGD+V F NKLYTGDLQKR GIT G+
Sbjct  80   PASEVPQVLHVYELNELDRGSPAYLXLSGKEVHSLGDVVXFXNKLYTGDLQKRXGITTGI  139

Query  466  CILIKHEEEK--KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
             +LI+H  EK   GDRYE IYSF FGDYGHI+VQG YLTYED+YLA
Sbjct  140  TLLIQHYPEKINSGDRYEGIYSFNFGDYGHISVQGAYLTYEDSYLA  185



>emb|CAN68566.1| hypothetical protein VITISV_032173 [Vitis vinifera]
Length=244

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 10/99 (10%)
 Frame = +1

Query  301  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIK  480
            VQEL VYEINERDR SPA+L+LSQK  N+LGDL            +KR+G+TAG+C+LI+
Sbjct  83   VQELYVYEINERDRDSPAFLKLSQKPANSLGDLT----------WEKRLGVTAGICVLIQ  132

Query  481  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            H  E+KGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLA
Sbjct  133  HVRERKGDRYEAIYSFYFGDYGHVSVQGPYLTYEDTYLA  171



>ref|XP_010425226.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=243

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
            Q +   K+ +L VYE+NE DR  P  L+ +   +  LGDLVPF NKLYTGDL+KRVGITA
Sbjct  64   QDSRPSKLSKLSVYELNELDRHRPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  123

Query  460  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            GLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA
Sbjct  124  GLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLA  169



>ref|XP_010502458.1| PREDICTED: allene oxide cyclase 3, chloroplastic isoform X1 [Camelina 
sativa]
Length=263

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 81/107 (76%), Gaps = 7/107 (7%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDL-------VPFNNKLYTGDLQKRVGIT  456
            K+QEL VYE+NE DR SPA L+L +K               VPF NKLYTGDL+KRVGIT
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLLCLGDLVPFTNKLYTGDLKKRVGIT  142

Query  457  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            AGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA
Sbjct  143  AGLCVLIQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLA  189



>ref|XP_002875277.1| ERD12 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51536.1| ERD12 protein [Arabidopsis lyrata subsp. lyrata]
Length=253

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            KVQEL VYEIN+ DR SP  L+ +   +  LGDLVPF NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINDLDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H   KKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  141  EH-VPKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  179



>ref|XP_002969526.1| hypothetical protein SELMODRAFT_91887, partial [Selaginella moellendorffii]
 ref|XP_002986761.1| hypothetical protein SELMODRAFT_124720, partial [Selaginella 
moellendorffii]
 gb|EFJ12091.1| hypothetical protein SELMODRAFT_124720, partial [Selaginella 
moellendorffii]
 gb|EFJ29614.1| hypothetical protein SELMODRAFT_91887, partial [Selaginella moellendorffii]
Length=176

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQ-KSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            +VQ L VYEINE DRGSP  L+  + K  N LGDLVPF+NKLY G L+ R+GITAGLC+L
Sbjct  6    EVQTLSVYEINELDRGSPVLLKGDKAKPTNALGDLVPFSNKLYDGCLETRLGITAGLCVL  65

Query  475  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            IKH    KGDRYEA YSFYFGDYGHI+VQG Y+TY+DTY+A
Sbjct  66   IKHVP-GKGDRYEATYSFYFGDYGHISVQGAYITYQDTYMA  105



>ref|XP_009152113.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Brassica 
rapa]
Length=252

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF NK+YTGDL+KRVGITAGLC+ +
Sbjct  79   RIQELSVYELNELDRHSPKILKNAASLTFGLGDLVPFTNKIYTGDLKKRVGITAGLCVGV  138

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
                 KKG+R+EA YSFYFGDYGH++VQG YLTYED++LA
Sbjct  139  AQVPVKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLA  178



>ref|XP_010554242.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=241

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  322  EINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHEEEKKG  501
            +   RDR SPA L+L +K    LGDLVPF NKLY+GDL KR+GITAGLC+LI+H  E+ G
Sbjct  77   KFTPRDRNSPAVLKLGKKPELCLGDLVPFTNKLYSGDLTKRLGITAGLCVLIQHVPERNG  136

Query  502  DRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            DR+EA YSFYFGDYGH++VQG YLTYEDTYL+
Sbjct  137  DRFEATYSFYFGDYGHLSVQGPYLTYEDTYLS  168



>emb|CDY13583.1| BnaA06g33400D [Brassica napus]
Length=181

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K QEL VYE+NE DR SPA L+L +K    LGDLVPF NKLY  DL+KRVGITAGL +LI
Sbjct  9    KTQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYPDDLKKRVGITAGLYVLI  68

Query  478  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +H  EK GDR EA YSFYFG  G ++V+GQYLTYEDT+LA
Sbjct  69   QHVPEKNGDRLEANYSFYFGHCGQLSVEGQYLTYEDTFLA  108



>ref|XP_006373455.1| hypothetical protein POPTR_0017s13940g, partial [Populus trichocarpa]
 gb|ERP51252.1| hypothetical protein POPTR_0017s13940g, partial [Populus trichocarpa]
Length=135

 Score =   133 bits (335),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  379  VNTLGDLVPFNNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAV  558
            VNTLGDLVPF+NKLYTGDLQKR+GITAG+CILI+H+ EK+GDRYEA+YSFYFGDYGH++V
Sbjct  2    VNTLGDLVPFSNKLYTGDLQKRIGITAGICILIQHKTEKQGDRYEAVYSFYFGDYGHLSV  61

Query  559  QGQYLTYEDT  588
            QG Y+TYEDT
Sbjct  62   QGAYITYEDT  71



>gb|KJB22383.1| hypothetical protein B456_004G0462002, partial [Gossypium raimondii]
Length=140

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = +1

Query  280  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITA  459
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPF+NK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  460  GLCILIKHEEEKK  498
            G+CILI+H+ E K
Sbjct  128  GICILIEHKPEMK  140



>ref|XP_004156234.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Cucumis 
sativus]
Length=141

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  418  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            LY+GDLQKRVGITAGLCIL++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  9    LYSGDLQKRVGITAGLCILVQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLA  68



>gb|KJB50748.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
Length=208

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +LQKRVGITAGLC+LI+H  EKKGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLA
Sbjct  80   NLQKRVGITAGLCVLIQHVPEKKGDRYEAIYSFYFGDYGHLSVQGPYLTYEDTYLA  135



>ref|XP_006495473.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like, partial 
[Citrus sinensis]
Length=157

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +1

Query  415  KLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  594
            +LY+GDLQKRVGITAG+CILI+H+   KGDRYEA+YSFYFGDYGHI+VQG YLTY+DT L
Sbjct  25   QLYSGDLQKRVGITAGICILIQHKP-MKGDRYEAVYSFYFGDYGHISVQGSYLTYKDTCL  83

Query  595  A  597
            A
Sbjct  84   A  84



>ref|XP_001760307.1| predicted protein [Physcomitrella patens]
 gb|EDQ75063.1| predicted protein, partial [Physcomitrella patens]
Length=184

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 12/112 (11%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYL-RLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            +VQ   VYEINERDR SPA+L  LS    + LGDLVPF+NKLY   LQ R+G+TAG+ ++
Sbjct  1    EVQLFSVYEINERDRNSPAFLPTLSGDHEHGLGDLVPFSNKLYDSSLQVRLGVTAGMAMV  60

Query  475  I--------KHEEEKK---GDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            +        KH  +      D YEA Y+FY GD GH++ QG + T++DT L 
Sbjct  61   VKAFPGKGQKHHTKHNFFFPDCYEATYTFYLGDMGHVSAQGPFSTFDDTLLT  112



>gb|AFW88168.1| hypothetical protein ZEAMMB73_091885, partial [Zea mays]
Length=144

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  412  NKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTY  591
             ++Y G L KR+GITAG+C+LI+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++Y
Sbjct  10   TQVYNGSLDKRLGITAGICVLIQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESY  69

Query  592  LA  597
            LA
Sbjct  70   LA  71



>gb|EMS52587.1| Allene oxide cyclase 3, chloroplastic [Triticum urartu]
Length=204

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAGLCIL  474
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  475  IKHEE  489
            I+H  
Sbjct  125  IQHSS  129



>ref|XP_001779767.1| predicted protein [Physcomitrella patens]
 gb|EDQ55451.1| predicted protein [Physcomitrella patens]
Length=200

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 22/120 (18%)
 Frame = +1

Query  304  QELCVYEINERDRGSPAYLRLSQKSVN-----------TLGDLVPFNNKLYTGDLQKRVG  450
            Q   VYE+NE DR SPA+L LS+++VN            LGD VPF NKLY   L+ R+G
Sbjct  9    QTFTVYELNEFDRDSPAFLELSRQTVNRVDPNTGDHIKALGDQVPFTNKLYNSALEMRLG  68

Query  451  ITAGLCILIKHEEEK-----------KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            IT G+C+ +K+   +             D YE I S+YFGD GHI+  G ++ ++DT + 
Sbjct  69   ITTGICLHMKNYPGRGAPELHSLPFFTSDHYETIMSWYFGDMGHISGMGPFINFQDTLMG  128



>dbj|BAO93687.1| allene oxide cyclase [Marchantia polymorpha]
Length=257

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +1

Query  286  APAGKVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFNNKLYTGDLQKRVGITAG  462
            AP  + Q + V+E NE DR SP  ++ + K  V  +GD VP++NK+Y    +K +GI++G
Sbjct  86   APEDQEQVMGVFEFNEGDRNSPFVVKNNAKLPVLCIGDFVPYSNKVYDCTGKKYLGISSG  145

Query  463  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  594
            LC +++H  E  GD YE + S Y G YGH++ QG Y TY DT +
Sbjct  146  LCTVVEHHYESGGDLYETVMSHYMGSYGHLSCQGPYKTYGDTEM  189



>ref|XP_001771240.1| predicted protein [Physcomitrella patens]
 gb|EDQ63951.1| predicted protein [Physcomitrella patens]
Length=254

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 67/120 (56%), Gaps = 22/120 (18%)
 Frame = +1

Query  304  QELCVYEINERDRGSPAYLRLSQKSVN-----------TLGDLVPFNNKLYTGDLQKRVG  450
            Q   VYE+NE DR SPA+L LS++SVN            LGD VPF NKLY   L+ R+G
Sbjct  63   QTFTVYELNEFDRDSPAFLELSRQSVNRTDPVTGEHVKALGDQVPFTNKLYDSSLRTRLG  122

Query  451  ITAGLCILIKH-----EEEKKG------DRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  597
            IT G+C+ +K        E  G      D YE I S++ GD GHI+  G ++ ++DT + 
Sbjct  123  ITTGICLHMKQYPGRGAPELHGLPFFTPDHYETIMSWHLGDMGHISGMGPFINFQDTLMG  182



>ref|XP_009394152.1| PREDICTED: uncharacterized protein LOC103979699 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=307

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  292  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNK  417
            + KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPF+NK
Sbjct  87   SAKVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNK  128



>ref|XP_009394153.1| PREDICTED: uncharacterized protein LOC103979699 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=305

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNK  417
            KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPF+NK
Sbjct  87   KVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNK  126



>gb|AGL75607.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75608.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75609.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75610.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75611.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75612.1| mangrin, partial [Rhizophora mucronata]
 gb|AGL75613.1| mangrin, partial [Rhizophora mucronata]
 gb|AGL75614.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75615.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75616.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75617.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75618.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75619.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75620.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75621.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75622.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75623.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75624.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75625.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75626.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75627.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75628.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75629.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75630.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75631.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75632.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75633.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75634.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75635.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75636.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75637.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75638.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75639.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75640.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75641.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75642.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75643.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75644.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75645.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75646.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75647.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75648.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75649.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75650.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75651.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75652.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75653.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75654.1| mangrin, partial [Rhizophora x lamarckii]
Length=40

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNK  417
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPF+NK
Sbjct  1    KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNK  40



>tpg|DAA45889.1| TPA: hypothetical protein ZEAMMB73_165754 [Zea mays]
Length=117

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFNNKL  420
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF NK+
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKV  106



>ref|XP_006417137.1| hypothetical protein EUTSA_v10008630mg [Eutrema salsugineum]
 gb|ESQ35490.1| hypothetical protein EUTSA_v10008630mg [Eutrema salsugineum]
Length=241

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 54/108 (50%), Gaps = 27/108 (25%)
 Frame = +1

Query  298  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFNNKLYTGDLQKRVGITAGLCILI  477
            K+QEL VYE NE DR SPA L+L +            +   +   L +R           
Sbjct  79   KIQELNVYEFNEGDRNSPAVLKLGKNPQQ-------LSRSFHKQTLHRRS----------  121

Query  478  KHEEEKKGDRYEAIY--------SFYFGDYGHIAVQGQYLTYEDTYLA  597
              +E ++  R    +        SFYFGDYGHI+VQG YLTYEDT+LA
Sbjct  122  --QETRRNHRGTLRFDPTRSREESFYFGDYGHISVQGPYLTYEDTFLA  167



>ref|XP_003628626.1| Allene-oxide cyclase [Medicago truncatula]
 gb|AET03102.1| allene oxide cyclase [Medicago truncatula]
Length=119

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  286  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPF  408
            A   KVQE+ VYE NE DRGSPAY RLS KSVN+LGDLV F
Sbjct  68   ADTEKVQEMHVYEFNESDRGSPAYSRLSNKSVNSLGDLVSF  108



>ref|XP_007208176.1| hypothetical protein PRUPE_ppa022035mg [Prunus persica]
 gb|EMJ09375.1| hypothetical protein PRUPE_ppa022035mg [Prunus persica]
Length=197

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 1/33 (3%)
 Frame = +1

Query  502  DRYEAIY-SFYFGDYGHIAVQGQYLTYEDTYLA  597
            DR    Y SFYFGDYGHI+ QG YLTYED+YLA
Sbjct  97   DRASPAYLSFYFGDYGHISAQGAYLTYEDSYLA  129



>dbj|BAN45359.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45360.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45361.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45362.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45363.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45364.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45365.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45366.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45367.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45368.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45369.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45370.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45371.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45372.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45373.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45374.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45375.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45376.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45377.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45378.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45379.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45380.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45381.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45382.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45383.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45384.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45385.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45386.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45387.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45388.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45389.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45390.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45391.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45392.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45393.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45394.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45395.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45396.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45397.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45398.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45399.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45400.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45401.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45402.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45403.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45404.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45405.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45406.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45407.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45408.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45409.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45410.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45411.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45412.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45413.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45414.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45415.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45416.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45417.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45418.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45419.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45420.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45421.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45422.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45423.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45424.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45425.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45426.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45427.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45428.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45429.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45430.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45431.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45432.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45433.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45434.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45435.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45436.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45437.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45438.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45439.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45440.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45441.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45442.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45443.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45444.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45445.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45446.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45447.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45448.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45449.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45450.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45451.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45452.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45453.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45454.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45455.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45456.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45457.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45458.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45459.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45460.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45461.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45462.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45463.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45464.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45465.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45466.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45467.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45468.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45469.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45470.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45471.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45472.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45473.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45474.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45475.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45476.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45477.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45478.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45479.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45480.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45481.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45482.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45483.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45484.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45485.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45486.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45487.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45488.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45489.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45490.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45491.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45492.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45493.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45494.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45495.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45496.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45497.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45498.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45499.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45500.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45501.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45502.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45503.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45504.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45505.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45506.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45507.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45508.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45509.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45510.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45511.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45512.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45513.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45514.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45515.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45516.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45517.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45518.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45519.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45520.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45521.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45522.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45523.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45524.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45525.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45526.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45527.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45528.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45529.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45530.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45531.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45532.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45533.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45534.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45535.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45536.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45537.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45538.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45539.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45540.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45541.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45542.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45543.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45544.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45545.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45546.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45547.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45548.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45549.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45550.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45551.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45552.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45553.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45554.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45555.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45556.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45557.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45558.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45559.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45560.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45561.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45562.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45563.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45564.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45565.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45566.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45567.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45568.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45569.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45570.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45571.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45572.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45573.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45574.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45575.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45576.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45577.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45578.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45579.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45580.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45581.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45582.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45583.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45584.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45585.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45586.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45587.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45588.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45589.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45590.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45591.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45592.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45593.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45594.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45595.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45596.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45597.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45598.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45599.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45600.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45601.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45602.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45603.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45604.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45605.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45606.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45607.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45608.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45609.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45610.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45611.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45612.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45613.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45614.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45615.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45616.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45617.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45618.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45619.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45620.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45621.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45622.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45623.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45624.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45625.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45626.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45627.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45628.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45629.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45630.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45631.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45632.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45633.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45634.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45635.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45636.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45637.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45638.1| mangrin, partial [Bruguiera gymnorhiza]
 dbj|BAN45639.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45640.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45641.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45642.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45643.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45644.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45645.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45646.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45647.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45648.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45649.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45650.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45651.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45652.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45653.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45654.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45655.1| mangrin, partial [Bruguiera sexangula]
 dbj|BAN45656.1| mangrin, partial [Bruguiera sexangula]
Length=28

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  418  LYTGDLQKRVGITAGLCILIKHEEEKKG  501
            +Y+GDLQKR+G+TAG+CILI+++ EKKG
Sbjct  1    VYSGDLQKRIGVTAGICILIQNKPEKKG  28



Lambda      K        H        a         alpha
   0.317    0.136    0.393    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510