BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN029G14

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011069394.1|  PREDICTED: proteasome subunit beta type-3-A        402   5e-140   Sesamum indicum [beniseed]
emb|CDP10945.1|  unnamed protein product                                400   2e-139   Coffea canephora [robusta coffee]
ref|XP_009616684.1|  PREDICTED: proteasome subunit beta type-3-A        399   7e-139   Nicotiana tomentosiformis
ref|XP_009798221.1|  PREDICTED: proteasome subunit beta type-3-A        399   7e-139   Nicotiana sylvestris
ref|XP_010539660.1|  PREDICTED: proteasome subunit beta type-3-A-...    399   9e-139   Tarenaya hassleriana [spider flower]
ref|XP_004149805.1|  PREDICTED: proteasome subunit beta type-3-A-...    398   1e-138   Cucumis sativus [cucumbers]
gb|ADR70868.1|  20S proteasome beta subunit C2                          398   2e-138   Hevea brasiliensis [jebe]
ref|XP_010063943.1|  PREDICTED: proteasome subunit beta type-3-A        398   2e-138   Eucalyptus grandis [rose gum]
gb|KJB64503.1|  hypothetical protein B456_010G052100                    398   2e-138   Gossypium raimondii
ref|XP_010521275.1|  PREDICTED: proteasome subunit beta type-3-A ...    397   3e-138   Tarenaya hassleriana [spider flower]
gb|AFK48891.1|  unknown                                                 397   3e-138   Lotus japonicus
gb|KDP32836.1|  hypothetical protein JCGZ_12128                         397   4e-138   Jatropha curcas
ref|XP_010243518.1|  PREDICTED: proteasome subunit beta type-3          397   4e-138   Nelumbo nucifera [Indian lotus]
ref|NP_001237278.1|  uncharacterized protein LOC100306084               397   5e-138   Glycine max [soybeans]
ref|XP_010539661.1|  PREDICTED: proteasome subunit beta type-3-A-...    397   5e-138   Tarenaya hassleriana [spider flower]
ref|XP_009769699.1|  PREDICTED: proteasome subunit beta type-3-A-...    397   5e-138   Nicotiana sylvestris
ref|XP_002285871.1|  PREDICTED: proteasome subunit beta type-3-A        397   6e-138   Vitis vinifera
ref|XP_004493306.1|  PREDICTED: proteasome subunit beta type-3-A-...    397   7e-138   Cicer arietinum [garbanzo]
gb|AFK33992.1|  unknown                                                 396   9e-138   Lotus japonicus
gb|KCW71243.1|  hypothetical protein EUGRSUZ_F04339                     398   1e-137   Eucalyptus grandis [rose gum]
ref|XP_010521276.1|  PREDICTED: proteasome subunit beta type-3-A ...    396   1e-137   Tarenaya hassleriana [spider flower]
gb|KJB29133.1|  hypothetical protein B456_005G088700                    395   2e-137   Gossypium raimondii
gb|ADR70867.1|  20S proteasome beta subunit C1                          395   4e-137   Hevea brasiliensis [jebe]
ref|XP_007019135.1|  Proteasome beta subunit C1                         394   4e-137   Theobroma cacao [chocolate]
gb|KJB59983.1|  hypothetical protein B456_009G283900                    394   5e-137   Gossypium raimondii
gb|KDP32966.1|  hypothetical protein JCGZ_12997                         394   6e-137   Jatropha curcas
ref|NP_001237990.1|  uncharacterized protein LOC100499664               394   1e-136   Glycine max [soybeans]
ref|XP_006595528.1|  PREDICTED: uncharacterized protein LOC100527...    393   1e-136   
gb|KCW71242.1|  hypothetical protein EUGRSUZ_F04339                     395   2e-136   Eucalyptus grandis [rose gum]
ref|XP_008352621.1|  PREDICTED: proteasome subunit beta type-3-A        393   2e-136   
ref|XP_010527680.1|  PREDICTED: proteasome subunit beta type-3-A-...    392   3e-136   Tarenaya hassleriana [spider flower]
gb|AFK33863.1|  unknown                                                 392   5e-136   Medicago truncatula
ref|XP_003624868.1|  Proteasome subunit beta type                       392   6e-136   Medicago truncatula
ref|XP_010268988.1|  PREDICTED: proteasome subunit beta type-3-like     391   7e-136   Nelumbo nucifera [Indian lotus]
ref|NP_564149.1|  proteasome beta subunit C1                            391   7e-136   Arabidopsis thaliana [mouse-ear cress]
gb|EPS70809.1|  proteasome subunit beta type                            391   1e-135   Genlisea aurea
ref|XP_010670575.1|  PREDICTED: proteasome subunit beta type-3-A        391   1e-135   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU31766.1|  hypothetical protein MIMGU_mgv1a013986mg                391   1e-135   Erythranthe guttata [common monkey flower]
ref|XP_006302830.1|  hypothetical protein CARUB_v10020962mg             391   1e-135   Capsella rubella
ref|XP_006416271.1|  hypothetical protein EUTSA_v10008793mg             390   2e-135   Eutrema salsugineum [saltwater cress]
ref|XP_008338662.1|  PREDICTED: proteasome subunit beta type-3-A        390   2e-135   
gb|AFK44934.1|  unknown                                                 390   2e-135   Medicago truncatula
ref|XP_009149692.1|  PREDICTED: proteasome subunit beta type-3-A        390   2e-135   Brassica rapa
ref|XP_006434244.1|  hypothetical protein CICLE_v10002515mg             390   2e-135   Citrus clementina [clementine]
ref|XP_002890456.1|  predicted protein                                  390   2e-135   
ref|XP_010428822.1|  PREDICTED: proteasome subunit beta type-3-B        390   3e-135   Camelina sativa [gold-of-pleasure]
ref|XP_009376873.1|  PREDICTED: proteasome subunit beta type-3-A        390   3e-135   Pyrus x bretschneideri [bai li]
ref|XP_002520338.1|  proteasome subunit beta type, putative             390   4e-135   Ricinus communis
emb|CDY01316.1|  BnaA07g10890D                                          390   4e-135   
ref|XP_006359316.1|  PREDICTED: proteasome subunit beta type-3-A-...    389   5e-135   Solanum tuberosum [potatoes]
ref|XP_004236827.1|  PREDICTED: proteasome subunit beta type-3-A        389   6e-135   Solanum lycopersicum
ref|NP_565156.1|  20S proteasome beta subunit C2                        389   7e-135   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00398.1|  BnaC07g14280D                                          389   8e-135   
ref|XP_007161473.1|  hypothetical protein PHAVU_001G072000g             389   8e-135   Phaseolus vulgaris [French bean]
ref|XP_009110172.1|  PREDICTED: proteasome subunit beta type-3-A-...    389   8e-135   Brassica rapa
ref|XP_010416685.1|  PREDICTED: proteasome subunit beta type-3-B-...    389   8e-135   Camelina sativa [gold-of-pleasure]
ref|XP_009112575.1|  PREDICTED: proteasome subunit beta type-3-A-...    389   1e-134   Brassica rapa
ref|XP_009128227.1|  PREDICTED: proteasome subunit beta type-3-A        389   1e-134   Brassica rapa
gb|AAM62756.1|  putative 20S proteasome beta subunit PBC2               389   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304134.1|  hypothetical protein CARUB_v10010099mg             390   1e-134   
ref|XP_002887683.1|  hypothetical protein ARALYDRAFT_895633             388   1e-134   Arabidopsis lyrata subsp. lyrata
ref|XP_006390090.1|  hypothetical protein EUTSA_v10019145mg             388   1e-134   Eutrema salsugineum [saltwater cress]
ref|XP_007223461.1|  hypothetical protein PRUPE_ppa011601mg             388   2e-134   Prunus persica
ref|XP_010471938.1|  PREDICTED: proteasome subunit beta type-3-B ...    388   2e-134   Camelina sativa [gold-of-pleasure]
gb|KFK44279.1|  hypothetical protein AALP_AA1G237600                    388   2e-134   Arabis alpina [alpine rockcress]
gb|ACJ85972.1|  unknown                                                 387   4e-134   Medicago truncatula
ref|XP_006838497.1|  hypothetical protein AMTR_s00002p00168080          387   5e-134   Amborella trichopoda
ref|XP_010416686.1|  PREDICTED: proteasome subunit beta type-3-B-...    387   5e-134   Camelina sativa [gold-of-pleasure]
ref|XP_009379033.1|  PREDICTED: proteasome subunit beta type-3-A-...    387   5e-134   Pyrus x bretschneideri [bai li]
gb|KFK42138.1|  hypothetical protein AALP_AA2G216100                    386   7e-134   Arabis alpina [alpine rockcress]
ref|XP_002307450.1|  Proteasome subunit beta type 3-2 family protein    386   7e-134   Populus trichocarpa [western balsam poplar]
ref|XP_008219606.1|  PREDICTED: proteasome subunit beta type-3-A        386   7e-134   Prunus mume [ume]
ref|XP_009103286.1|  PREDICTED: proteasome subunit beta type-3-A-...    385   2e-133   Brassica rapa
ref|XP_008347744.1|  PREDICTED: proteasome subunit beta type-3-A-...    385   4e-133   Malus domestica [apple tree]
sp|O65084.1|PSB3_PICMA  RecName: Full=Proteasome subunit beta typ...    384   4e-133   Picea mariana [black spruce]
ref|XP_004290891.1|  PREDICTED: proteasome subunit beta type-3-A        384   4e-133   Fragaria vesca subsp. vesca
ref|XP_010929114.1|  PREDICTED: proteasome subunit beta type-3          384   5e-133   Elaeis guineensis
ref|XP_008806302.1|  PREDICTED: proteasome subunit beta type-3          384   7e-133   Phoenix dactylifera
dbj|BAJ98022.1|  predicted protein                                      384   1e-132   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT19931.1|  Proteasome subunit beta type-3                          383   1e-132   
ref|XP_003570772.1|  PREDICTED: proteasome subunit beta type-3-like     383   1e-132   Brachypodium distachyon [annual false brome]
ref|XP_003563301.1|  PREDICTED: proteasome subunit beta type-3          383   1e-132   Brachypodium distachyon [annual false brome]
ref|XP_003608106.1|  Proteasome subunit beta type                       383   2e-132   Medicago truncatula
ref|XP_008784796.1|  PREDICTED: proteasome subunit beta type-3          382   5e-132   Phoenix dactylifera
ref|XP_002453412.1|  hypothetical protein SORBIDRAFT_04g005590          382   5e-132   Sorghum bicolor [broomcorn]
ref|XP_010942147.1|  PREDICTED: proteasome subunit beta type-3          381   7e-132   Elaeis guineensis
ref|XP_002300970.2|  Proteasome subunit beta type 3-2 family protein    380   2e-131   
ref|XP_009417439.1|  PREDICTED: proteasome subunit beta type-3          380   2e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394944.1|  PREDICTED: proteasome subunit beta type-3-like     380   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK95590.1|  unknown                                                 380   3e-131   Populus trichocarpa [western balsam poplar]
gb|EMS62704.1|  Proteasome subunit beta type-3                          379   7e-131   Triticum urartu
dbj|BAD25149.1|  Proteasome subunit beta type 3                         378   2e-130   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87014.1|  predicted protein                                      377   3e-130   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951671.1|  PREDICTED: proteasome subunit beta type-3-like     377   5e-130   Setaria italica
ref|NP_001140276.1|  uncharacterized protein LOC100272320               375   1e-129   Zea mays [maize]
gb|EAY84744.1|  hypothetical protein OsI_06114                          375   4e-129   Oryza sativa Indica Group [Indian rice]
ref|XP_002438734.1|  hypothetical protein SORBIDRAFT_10g025190          374   4e-129   Sorghum bicolor [broomcorn]
gb|AFW70451.1|  proteasome subunit beta type                            378   5e-129   
ref|XP_006648378.1|  PREDICTED: proteasome subunit beta type-3-like     374   9e-129   Oryza brachyantha
ref|XP_008649041.1|  PREDICTED: proteasome subunit beta type-3          372   2e-128   Zea mays [maize]
gb|KJB29135.1|  hypothetical protein B456_005G088700                    372   3e-128   Gossypium raimondii
gb|KJB64504.1|  hypothetical protein B456_010G052100                    371   4e-128   Gossypium raimondii
gb|KJB29136.1|  hypothetical protein B456_005G088700                    372   4e-128   Gossypium raimondii
ref|NP_001058176.1|  Os06g0643100                                       372   4e-128   
gb|AFW87307.1|  proteasome subunit beta type                            370   2e-127   
ref|NP_001141963.1|  uncharacterized protein LOC100274112               369   4e-127   Zea mays [maize]
gb|KJB59985.1|  hypothetical protein B456_009G283900                    368   6e-127   Gossypium raimondii
ref|XP_004965763.1|  PREDICTED: proteasome subunit beta type-3-like     369   8e-127   Setaria italica
gb|AEC11048.1|  20S proteasome beta subunit pbc2                        365   1e-125   Camellia sinensis [black tea]
emb|CDY38347.1|  BnaA02g18400D                                          365   2e-125   Brassica napus [oilseed rape]
gb|AAG51672.1|AC010704_16  putative 20S proteasome beta subunit P...    364   3e-125   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67773.1|  BnaAnng25130D                                          363   4e-125   Brassica napus [oilseed rape]
emb|CDY71260.1|  BnaAnng36740D                                          362   2e-124   Brassica napus [oilseed rape]
gb|KHG23898.1|  Proteasome subunit beta type-3-A -like protein          362   4e-124   Gossypium arboreum [tree cotton]
ref|XP_011027490.1|  PREDICTED: proteasome subunit beta type-3-A        360   1e-123   Populus euphratica
gb|KHG25919.1|  Proteasome subunit beta type-3-A -like protein          360   2e-122   Gossypium arboreum [tree cotton]
gb|EMS47536.1|  Proteasome subunit beta type-3                          355   7e-122   Triticum urartu
ref|XP_006656285.1|  PREDICTED: proteasome subunit beta type-3-like     352   1e-120   
gb|AGV54396.1|  proteasome subunit beta type-3-A isoform 1              350   1e-119   Phaseolus vulgaris [French bean]
emb|CAC43324.1|  putative beta 3 proteasome subunit                     346   2e-118   Nicotiana tabacum [American tobacco]
ref|XP_010095417.1|  Proteasome subunit beta type-3-A                   363   2e-118   
ref|XP_002965476.1|  hypothetical protein SELMODRAFT_266913             347   4e-118   Selaginella moellendorffii
ref|XP_001770816.1|  predicted protein                                  344   4e-117   
ref|XP_001771449.1|  predicted protein                                  339   3e-115   
gb|EMT12457.1|  Proteasome subunit beta type-3                          332   7e-113   
ref|XP_009601797.1|  PREDICTED: proteasome subunit beta type-3-A-...    308   2e-103   Nicotiana tomentosiformis
gb|KJB29134.1|  hypothetical protein B456_005G088700                    307   6e-103   Gossypium raimondii
ref|XP_006434245.1|  hypothetical protein CICLE_v10002515mg             304   1e-101   
ref|XP_005850127.1|  hypothetical protein CHLNCDRAFT_48590              297   7e-99    Chlorella variabilis
ref|XP_005646581.1|  N-terminal nucleophile aminohydrolase              296   4e-98    Coccomyxa subellipsoidea C-169
gb|EJK68962.1|  hypothetical protein THAOC_09830                        281   2e-92    Thalassiosira oceanica
ref|XP_011401184.1|  Proteasome subunit beta type-3                     281   2e-92    Auxenochlorella protothecoides
ref|XP_002679261.1|  predicted protein                                  280   8e-92    Naegleria gruberi strain NEG-M
gb|KIY94892.1|  hypothetical protein MNEG_13071                         278   2e-91    Monoraphidium neglectum
emb|CEG65349.1|  Putative Proteasome subunit beta type                  277   7e-91    Rhizopus microsporus
gb|EWM23143.1|  Proteasome, beta-type subunit, conserved site           278   3e-90    Nannochloropsis gaditana
ref|XP_001696254.1|  hypothetical protein CHLREDRAFT_187099             273   3e-89    Chlamydomonas reinhardtii
dbj|GAN06988.1|  20S proteasome subunit beta 3                          273   4e-89    Mucor ambiguus
ref|XP_002946290.1|  hypothetical protein VOLCADRAFT_78969              272   6e-89    Volvox carteri f. nagariensis
emb|CEP10278.1|  hypothetical protein                                   271   1e-88    Parasitella parasitica
ref|XP_006679179.1|  hypothetical protein BATDEDRAFT_88542              271   3e-88    Batrachochytrium dendrobatidis JAM81
ref|XP_002297096.1|  predicted protein                                  271   3e-88    Thalassiosira pseudonana CCMP1335
ref|XP_008877158.1|  hypothetical protein H310_12029                    270   7e-88    Aphanomyces invadans
gb|AAT09074.1|  proteasome beta subunit                                 268   2e-87    Bigelowiella natans
ref|XP_001635037.1|  predicted protein                                  268   4e-87    Nematostella vectensis
emb|CDH60663.1|  20s proteasome subunit beta 3                          267   5e-87    Lichtheimia corymbifera JMRC:FSU:9682
gb|EPB88707.1|  proteasome subunit beta type-3                          268   7e-87    Mucor circinelloides f. circinelloides 1006PhL
emb|CDS02721.1|  Putative Proteasome subunit beta type                  265   4e-86    Lichtheimia ramosa
gb|KFH62657.1|  proteasome subunit beta type-3                          265   7e-86    Mortierella verticillata NRRL 6337
gb|EIE91509.1|  hypothetical protein RO3G_16220                         263   2e-85    Rhizopus delemar RA 99-880
emb|CEI98111.1|  Putative Proteasome subunit beta type                  263   2e-85    Rhizopus microsporus
ref|XP_009824833.1|  hypothetical protein H257_02748                    263   3e-85    Aphanomyces astaci
emb|CBJ32446.1|  conserved unknown protein                              263   4e-85    Ectocarpus siliculosus
gb|KDQ16840.1|  hypothetical protein BOTBODRAFT_53901                   261   8e-85    Botryobasidium botryosum FD-172 SS1
ref|XP_002183677.1|  predicted protein                                  261   1e-84    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001745472.1|  hypothetical protein                               261   1e-84    Monosiga brevicollis MX1
gb|ESA23897.1|  hypothetical protein GLOINDRAFT_341917                  261   1e-84    
emb|CDY70670.1|  BnaCnng69300D                                          259   2e-84    Brassica napus [oilseed rape]
ref|XP_004998595.1|  proteasome subunit beta type-3                     261   2e-84    Salpingoeca rosetta
ref|XP_002904370.1|  proteasome subunit beta type-3, putative           260   3e-84    Phytophthora infestans T30-4
emb|CCA14375.1|  proteasome subunit beta type3 putative                 260   3e-84    Albugo laibachii Nc14
ref|XP_002508440.1|  predicted protein                                  260   3e-84    Micromonas commoda
gb|KFB35883.1|  hypothetical protein ZHAS_00002836                      260   4e-84    Anopheles sinensis
ref|XP_001651824.1|  AAEL006174-PA                                      260   4e-84    Aedes aegypti
gb|ABF18140.1|  20S proteasome regulatory subunit beta type PSMB3...    259   5e-84    Aedes aegypti
ref|XP_009536762.1|  hypothetical protein PHYSODRAFT_288866             259   6e-84    Phytophthora sojae
ref|XP_011428234.1|  PREDICTED: proteasome subunit beta type-3-like     259   8e-84    Crassostrea gigas
ref|XP_005711307.1|  20S core proteasome subunit beta                   259   1e-83    Chondrus crispus [carageen]
ref|XP_002732675.1|  PREDICTED: proteasome subunit beta type-3-li...    259   1e-83    Saccoglossus kowalevskii
gb|ETN62797.1|  proteasome subunit beta type                            258   2e-83    Anopheles darlingi [American malaria mosquito]
ref|NP_587985.1|  20S proteasome component beta 3, Pup3 (predicted)     258   2e-83    Schizosaccharomyces pombe
ref|XP_646265.1|  proteasome subunit beta type 3                        258   3e-83    Dictyostelium discoideum AX4
gb|KDD73458.1|  proteasome subunit protein                              258   3e-83    Helicosporidium sp. ATCC 50920
gb|EPX72025.1|  20S proteasome component beta 3                         257   7e-83    Schizosaccharomyces octosporus yFS286
ref|XP_321394.2|  AGAP001697-PA                                         256   1e-82    Anopheles gambiae str. PEST
ref|XP_011260355.1|  PREDICTED: proteasome subunit beta type-3          256   1e-82    Camponotus floridanus
ref|XP_006685609.1|  proteasome-domain-containing protein               256   2e-82    Yamadazyma tenuis ATCC 10573
ref|XP_007351158.1|  20S proteasome subunit beta 3                      256   2e-82    
ref|XP_008877157.1|  hypothetical protein, variant                      255   2e-82    Aphanomyces invadans
ref|XP_007377645.1|  hypothetical protein SPAPADRAFT_63501              255   3e-82    Spathaspora passalidarum NRRL Y-27907
dbj|GAM19772.1|  hypothetical protein SAMD00019534_029470               255   4e-82    Acytostelium subglobosum LB1
ref|XP_002599453.1|  hypothetical protein BRAFLDRAFT_281217             255   4e-82    Branchiostoma floridae
gb|EPY49805.1|  20S proteasome component beta 3                         254   6e-82    Schizosaccharomyces cryophilus OY26
emb|CCA71352.1|  probable PUP3-20S proteasome subunit beta3             254   6e-82    Serendipita indica DSM 11827
ref|XP_001843139.1|  proteasome subunit beta type 3                     254   9e-82    Culex quinquefasciatus
ref|XP_002175348.1|  20S proteasome component beta 3                    253   1e-81    Schizosaccharomyces japonicus yFS275
ref|XP_005818424.1|  proteasome subunit beta type 3                     253   2e-81    Guillardia theta CCMP2712
ref|XP_010730943.1|  PREDICTED: proteasome subunit beta type-3          253   2e-81    Larimichthys crocea [croceine croaker]
ref|XP_009052112.1|  hypothetical protein LOTGIDRAFT_226791             253   2e-81    Lottia gigantea
ref|XP_011347090.1|  PREDICTED: proteasome subunit beta type-3          253   2e-81    Ooceraea biroi
ref|XP_005767557.1|  hypothetical protein EMIHUDRAFT_459379             253   3e-81    Emiliania huxleyi CCMP1516
gb|EPZ36546.1|  putative proteasome subunit beta type-3                 253   3e-81    Rozella allomycis CSF55
gb|EFN65731.1|  Proteasome subunit beta type-3                          255   3e-81    Camponotus floridanus
gb|KDR23887.1|  Proteasome subunit beta type-3                          252   5e-81    Zootermopsis nevadensis
ref|XP_008219607.1|  PREDICTED: proteasome subunit beta type-3-A-...    249   5e-81    
ref|XP_008606850.1|  20S proteasome subunit beta 3                      252   5e-81    Saprolegnia diclina VS20
ref|XP_003400568.1|  PREDICTED: proteasome subunit beta type-3-like     252   5e-81    Bombus terrestris [large earth bumblebee]
ref|XP_007258523.1|  PREDICTED: proteasome subunit beta type-3-like     252   5e-81    
gb|KIO31342.1|  hypothetical protein M407DRAFT_241859                   252   7e-81    Tulasnella calospora MUT 4182
gb|ELU08769.1|  hypothetical protein CAPTEDRAFT_228896                  252   7e-81    Capitella teleta
ref|XP_002111242.1|  hypothetical protein TRIADDRAFT_50102              251   7e-81    Trichoplax adhaerens
ref|XP_005803095.1|  PREDICTED: proteasome subunit beta type-3-like     251   7e-81    Xiphophorus maculatus
ref|XP_011175200.1|  PREDICTED: proteasome subunit beta type-3          251   8e-81    Solenopsis invicta [imported red fire ant]
ref|XP_008292536.1|  PREDICTED: proteasome subunit beta type-3          251   9e-81    Stegastes partitus
ref|XP_418119.2|  PREDICTED: proteasome subunit beta type-3             251   1e-80    
ref|XP_007545257.1|  PREDICTED: proteasome subunit beta type-3          251   1e-80    Poecilia formosa
emb|CDY40893.1|  BnaCnng09840D                                          249   1e-80    Brassica napus [oilseed rape]
gb|KDO80554.1|  hypothetical protein CISIN_1g028737mg                   250   1e-80    Citrus sinensis [apfelsine]
ref|XP_006799729.1|  PREDICTED: proteasome subunit beta type-3-like     251   1e-80    Neolamprologus brichardi [lyretail cichlid]
gb|AEB53189.1|  proteasome subunit beta type 3                          251   1e-80    Holothuria glaberrima
ref|XP_011149990.1|  PREDICTED: proteasome subunit beta type-3          251   2e-80    Harpegnathos saltator
gb|EFZ21650.1|  hypothetical protein SINV_15015                         251   2e-80    
ref|NP_001040460.1|  proteasome beta 3 subunit                          251   2e-80    Bombyx mori [silk moth]
ref|XP_004538793.1|  PREDICTED: proteasome subunit beta type-3-like     251   2e-80    Maylandia zebra
ref|XP_003448021.2|  PREDICTED: proteasome subunit beta type-3-like     251   2e-80    Oreochromis niloticus
ref|XP_004085833.1|  PREDICTED: proteasome subunit beta type-3          251   2e-80    Oryzias latipes [Japanese rice fish]
ref|XP_003695002.1|  PREDICTED: proteasome subunit beta type-3-like     250   2e-80    Apis florea [dwarf honeybee]
ref|XP_010583832.1|  PREDICTED: proteasome subunit beta type-3          250   2e-80    Haliaeetus leucocephalus
gb|KIW26277.1|  proteasome subunit beta type-3                          250   2e-80    Cladophialophora immunda
gb|KIW72067.1|  proteasome subunit beta type-3                          250   3e-80    Phialophora americana
gb|KIV94470.1|  proteasome subunit beta type-3                          250   3e-80    Exophiala mesophila
gb|KFO73083.1|  Proteasome subunit beta type-3                          250   3e-80    Cuculus canorus
ref|XP_007870227.1|  20S proteasome subunit beta 3                      250   4e-80    Gloeophyllum trabeum ATCC 11539
ref|XP_011065729.1|  PREDICTED: proteasome subunit beta type-3          249   4e-80    Acromyrmex echinatior
gb|KDO80557.1|  hypothetical protein CISIN_1g028737mg                   248   5e-80    Citrus sinensis [apfelsine]
ref|NP_001016503.1|  proteasome subunit beta type-3                     249   5e-80    Xenopus tropicalis [western clawed frog]
ref|XP_009225804.1|  proteasome component PUP3                          249   5e-80    Gaeumannomyces tritici R3-111a-1
ref|XP_003972178.1|  PREDICTED: proteasome subunit beta type-3-like     249   5e-80    Takifugu rubripes [tiger puffer]
ref|XP_624958.3|  PREDICTED: proteasome subunit beta type-3-like        249   5e-80    Apis mellifera [bee]
ref|XP_003484954.1|  PREDICTED: proteasome subunit beta type-3-like     249   5e-80    Bombus impatiens
gb|KDQ53836.1|  hypothetical protein JAAARDRAFT_182602                  249   6e-80    Jaapia argillacea MUCL 33604
gb|ACO09022.1|  Proteasome subunit beta type 3                          249   6e-80    Osmerus mordax
emb|CEJ81669.1|  Putative Proteasome subunit beta type                  249   6e-80    Torrubiella hemipterigena
gb|ACI67569.1|  Proteasome subunit beta type-3                          249   6e-80    Salmo salar
ref|NP_001117722.1|  proteasome subunit beta type-3                     249   6e-80    Oncorhynchus mykiss
gb|ACH70865.1|  proteasome (prosome, macropain) subunit, beta type 3    249   7e-80    Salmo salar
gb|AAH87457.1|  Unknown (protein for MGC:99279)                         249   8e-80    Xenopus laevis [clawed frog]
gb|EDK40915.2|  hypothetical protein PGUG_05013                         249   9e-80    Meyerozyma guilliermondii ATCC 6260
ref|XP_007177581.1|  PREDICTED: proteasome subunit beta type-3          249   9e-80    Balaenoptera acutorostrata scammoni
ref|XP_008559789.1|  PREDICTED: proteasome subunit beta type-3          249   9e-80    Microplitis demolitor
gb|KIV78159.1|  proteasome subunit beta type-3                          249   1e-79    Exophiala sideris
gb|KFH45773.1|  Proteasome subunit beta type-like protein               249   1e-79    Acremonium chrysogenum ATCC 11550
gb|ADO27744.1|  proteasome subunit beta type-3                          248   1e-79    Ictalurus furcatus
ref|XP_002796904.1|  proteasome component PUP3                          249   1e-79    
ref|XP_780413.3|  PREDICTED: proteasome subunit beta type-3-like        248   1e-79    Strongylocentrotus purpuratus [purple urchin]
gb|EMF10284.1|  N-terminal nucleophile aminohydrolase                   248   1e-79    Sphaerulina musiva SO2202
gb|KFM04559.1|  Proteasome subunit beta type-3                          248   1e-79    Aptenodytes forsteri
gb|KJE95802.1|  proteasome subunit beta type-3                          249   2e-79    Capsaspora owczarzaki ATCC 30864
ref|XP_005301900.1|  PREDICTED: proteasome subunit beta type-3          248   2e-79    Chrysemys picta bellii
gb|ACO08764.1|  Proteasome subunit beta type 3                          248   2e-79    Oncorhynchus mykiss
ref|XP_003768326.1|  PREDICTED: proteasome subunit beta type-3          248   2e-79    Sarcophilus harrisii
ref|XP_003288673.1|  proteasome subunit beta type 3                     248   2e-79    Dictyostelium purpureum
ref|XP_002421515.1|  macropain subunit, putative; multicatalytic ...    248   2e-79    Candida dubliniensis CD36
ref|XP_006695754.1|  hypothetical protein CTHT_0054190                  248   2e-79    Chaetomium thermophilum var. thermophilum DSM 1495
ref|NP_001088741.1|  proteasome (prosome, macropain) subunit, bet...    248   2e-79    Xenopus laevis [clawed frog]
ref|NP_001123295.1|  proteasome subunit beta type-3                     248   2e-79    Danio rerio [leopard danio]
ref|XP_003054110.1|  predicted protein                                  248   3e-79    [Nectria] haematococca mpVI 77-13-4
gb|KFY87716.1|  hypothetical protein V498_07050                         248   3e-79    Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|XP_006259773.1|  PREDICTED: proteasome subunit beta type-3          248   3e-79    
ref|XP_003414726.1|  PREDICTED: proteasome subunit beta type-3          248   3e-79    Loxodonta africana [African bush elephant]
gb|ACI69598.1|  Proteasome subunit beta type-3                          248   3e-79    Salmo salar
gb|KII93673.1|  hypothetical protein PLICRDRAFT_49695                   248   3e-79    Plicaturopsis crispa FD-325 SS-3
gb|KFP34344.1|  Proteasome subunit beta type-3                          248   3e-79    Colius striatus
ref|NP_001188163.1|  proteasome subunit beta type-3                     247   3e-79    Ictalurus punctatus
gb|KFM57092.1|  Proteasome subunit beta type-3                          247   4e-79    Stegodyphus mimosarum
emb|CEL59602.1|  20S proteasome subunit beta 3                          247   4e-79    Rhizoctonia solani AG-1 IB
gb|KIW42643.1|  proteasome subunit beta type-3                          247   4e-79    Exophiala oligosperma
ref|XP_001939046.1|  proteasome subunit beta type-3                     247   4e-79    Pyrenophora tritici-repentis Pt-1C-BFP
gb|KIW61914.1|  proteasome subunit beta type-3                          247   4e-79    Exophiala xenobiotica
gb|EGI58480.1|  Proteasome subunit beta type-3                          248   4e-79    Acromyrmex echinatior
ref|XP_001599218.1|  PREDICTED: proteasome subunit beta type-3 is...    247   4e-79    Nasonia vitripennis
gb|EST06443.1|  putative PUP3-20S proteasome subunit beta3              247   4e-79    Kalmanozyma brasiliensis GHG001
ref|XP_006022632.1|  PREDICTED: proteasome subunit beta type-3          250   4e-79    Alligator sinensis
ref|XP_001501618.2|  PREDICTED: proteasome subunit beta type-3          247   4e-79    Equus caballus [domestic horse]
gb|EFQ29355.1|  proteasome A-type and B-type                            247   5e-79    Colletotrichum graminicola M1.001
ref|XP_008031341.1|  hypothetical protein SETTUDRAFT_166162             247   5e-79    Exserohilum turcica Et28A
ref|XP_001371633.2|  PREDICTED: proteasome subunit beta type-3          247   5e-79    Monodelphis domestica
ref|XP_004200900.1|  Piso0_003510                                       247   5e-79    
ref|XP_711676.1|  hypothetical protein CaO19.1336                       247   5e-79    Candida albicans SC5314
ref|XP_005098842.1|  PREDICTED: proteasome subunit beta type-3-like     247   6e-79    
ref|XP_009554975.1|  PREDICTED: proteasome subunit beta type-3          246   6e-79    
ref|XP_003710932.1|  proteasome component PUP3                          247   7e-79    
ref|XP_003702795.1|  PREDICTED: proteasome subunit beta type-3-like     247   7e-79    
gb|ETS63749.1|  hypothetical protein PaG_02065                          246   7e-79    
ref|NP_036101.1|  proteasome subunit beta type-3                        246   7e-79    
ref|XP_004434651.1|  PREDICTED: proteasome subunit beta type-3 is...    246   7e-79    
emb|CCX14240.1|  Similar to Proteasome component PUP3; acc. no. P...    246   7e-79    
gb|KEQ83381.1|  proteasome subunit beta type-3                          246   8e-79    
ref|XP_008401760.1|  PREDICTED: proteasome subunit beta type-3          246   8e-79    
ref|XP_003236876.1|  proteasome subunit beta                            247   8e-79    
ref|XP_004378066.1|  PREDICTED: proteasome subunit beta type-3          246   8e-79    
gb|EHK40665.1|  beta subunit Pup3 of the 20S proteasome                 246   8e-79    
gb|EWG38002.1|  proteasome component PUP3                               246   9e-79    
ref|XP_003850602.1|  proteasome core particle subunit beta 3            246   9e-79    
gb|EGD96721.1|  proteasome subunit beta type-3                          246   9e-79    
ref|XP_006638397.1|  PREDICTED: proteasome subunit beta type-3-like     246   9e-79    
ref|XP_004361687.1|  proteasome subunit beta type 3                     246   9e-79    
ref|XP_007702070.1|  hypothetical protein COCSADRAFT_38618              246   1e-78    
ref|XP_004608774.1|  PREDICTED: proteasome subunit beta type-3          246   1e-78    
ref|XP_001483058.1|  hypothetical protein PGUG_05013                    246   1e-78    
ref|NP_001277537.1|  proteasome (prosome, macropain) subunit, bet...    246   1e-78    
ref|XP_006214288.1|  PREDICTED: proteasome subunit beta type-3          246   1e-78    
emb|CDQ68912.1|  unnamed protein product                                246   1e-78    
ref|XP_011503711.1|  PREDICTED: proteasome subunit beta type-3 is...    246   1e-78    
ref|NP_001239086.1|  proteasome subunit beta type-3                     246   1e-78    
ref|XP_011386832.1|  putative proteasome core particle subunit be...    246   1e-78    
gb|KFY51320.1|  hypothetical protein V496_08868                         248   1e-78    
gb|EHK16581.1|  hypothetical protein TRIVIDRAFT_183933                  246   1e-78    
ref|XP_004041889.1|  PREDICTED: proteasome subunit beta type-3          246   1e-78    
ref|XP_011297407.1|  PREDICTED: proteasome subunit beta type-3          246   1e-78    
ref|NP_001138374.1|  proteasome subunit beta type-3                     246   1e-78    
emb|CCF41580.1|  proteasome component PUP3                              246   1e-78    
ref|XP_005182786.1|  PREDICTED: proteasome subunit beta type-3          246   2e-78    
ref|XP_004282754.1|  PREDICTED: proteasome subunit beta type-3          246   2e-78    
ref|XP_009858011.1|  PREDICTED: proteasome subunit beta type-3-like     246   2e-78    
ref|NP_058981.1|  proteasome subunit beta type-3                        246   2e-78    
ref|XP_458253.1|  DEHA2C13222p                                          246   2e-78    
gb|EME39641.1|  hypothetical protein DOTSEDRAFT_75329                   246   2e-78    
ref|XP_005531463.1|  PREDICTED: proteasome subunit beta type-3          245   2e-78    
gb|ELR06244.1|  proteasome component PUP3                               245   2e-78    
ref|NP_001279732.1|  proteasome (prosome, macropain) subunit, bet...    245   2e-78    
gb|KGQ84851.1|  proteasome component PUP3                               245   2e-78    
ref|XP_004641146.1|  PREDICTED: proteasome subunit beta type-3-like     245   2e-78    
ref|XP_005140622.1|  PREDICTED: proteasome subunit beta type-3          245   2e-78    
ref|XP_007581421.1|  putative proteasome component pup3 protein         245   2e-78    
ref|XP_008316071.1|  PREDICTED: proteasome subunit beta type-3          245   2e-78    
gb|KEZ44625.1|  hypothetical protein SAPIO_CDS3666                      245   3e-78    
ref|XP_002827712.1|  PREDICTED: proteasome subunit beta type-3          246   3e-78    
ref|XP_001401548.1|  proteasome component PUP3                          245   3e-78    
ref|XP_010722907.1|  PREDICTED: proteasome subunit beta type-3          245   3e-78    
gb|KFV84500.1|  Proteasome subunit beta type-3                          245   3e-78    
ref|XP_002719377.1|  PREDICTED: proteasome subunit beta type-3          245   3e-78    
ref|NP_001029768.1|  proteasome subunit beta type-3                     245   3e-78    
ref|XP_008076889.1|  N-terminal nucleophile aminohydrolases (Ntn ...    245   3e-78    
ref|XP_011184092.1|  PREDICTED: proteasome subunit beta type-3          245   3e-78    
gb|EFX67334.1|  hypothetical protein DAPPUDRAFT_231791                  245   3e-78    
dbj|GAD96386.1|  proteasome component Pup3, putative                    245   3e-78    
ref|XP_004707157.1|  PREDICTED: proteasome subunit beta type-3          245   3e-78    
ref|XP_003222559.1|  PREDICTED: proteasome subunit beta type-3          245   3e-78    
ref|XP_009273127.1|  PREDICTED: proteasome subunit beta type-3          245   3e-78    
ref|NP_001244746.1|  proteasome subunit beta type-3                     245   3e-78    
ref|XP_004344963.2|  proteasome subunit beta type-3                     245   3e-78    
gb|AEH41478.1|  proteasome component Pup3                               245   3e-78    
ref|XP_008152006.1|  PREDICTED: proteasome subunit beta type-3          245   3e-78    
ref|NP_001237521.1|  uncharacterized protein LOC100527027               242   4e-78    
gb|ACO07526.1|  Proteasome subunit beta type 3                          245   4e-78    
ref|XP_004454988.1|  PREDICTED: proteasome subunit beta type-3          246   4e-78    
gb|KIV99156.1|  proteasome subunit beta type-3                          245   4e-78    
gb|AEE62971.1|  unknown                                                 244   4e-78    
gb|EMP33809.1|  Proteasome subunit beta type-3                          245   4e-78    
ref|XP_009094713.1|  PREDICTED: proteasome subunit beta type-3          244   4e-78    
gb|KFQ01357.1|  Proteasome subunit beta type-3                          244   4e-78    
ref|XP_711658.1|  hypothetical protein CaO19.8916                       244   5e-78    
ref|XP_004519795.1|  PREDICTED: proteasome subunit beta type-3-like     244   5e-78    
ref|XP_010990150.1|  PREDICTED: proteasome subunit beta type-3          244   5e-78    
gb|KEQ69256.1|  proteasome subunit beta type-3                          244   5e-78    
gb|KGQ05025.1|  Proteasome component PUP3                               244   5e-78    
ref|XP_002565785.1|  Pc22g18820                                         244   5e-78    
ref|XP_004895163.1|  PREDICTED: proteasome subunit beta type-3 is...    244   5e-78    
ref|XP_007288366.1|  proteasome subunit beta type-3                     244   6e-78    
gb|EMD85122.1|  hypothetical protein COCHEDRAFT_1149474                 244   6e-78    
ref|XP_005236630.1|  PREDICTED: proteasome subunit beta type-3          244   6e-78    
gb|AFK10923.1|  proteasome (prosome, macropain) subunit, beta typ...    244   6e-78    
ref|XP_007681418.1|  hypothetical protein BAUCODRAFT_39558              244   6e-78    
ref|XP_004684325.1|  PREDICTED: proteasome subunit beta type-3          244   6e-78    
ref|XP_001271634.1|  proteasome component Pup3, putative                244   7e-78    
ref|XP_010206644.1|  PREDICTED: proteasome subunit beta type-3          244   7e-78    
gb|KIK77617.1|  hypothetical protein PAXRUDRAFT_36767                   244   8e-78    
gb|AAV38526.1|  proteasome (prosome, macropain) subunit, beta typ...    244   8e-78    
gb|KIP04077.1|  hypothetical protein PHLGIDRAFT_93948                   244   8e-78    
gb|ETS01765.1|  N-terminal nucleophile aminohydrolase                   244   8e-78    
ref|XP_007881899.1|  hypothetical protein PFL1_06169                    244   9e-78    
ref|XP_006889428.1|  PREDICTED: proteasome subunit beta type-3          244   9e-78    
gb|KDN63448.1|  putative proteasome A-type and B-type                   244   9e-78    
gb|KDN51012.1|  hypothetical protein RSAG8_00641                        244   9e-78    
emb|CBQ67918.1|  probable PUP3-20S proteasome subunit beta3             244   9e-78    
ref|XP_004368094.1|  20S proteasome subunit beta 3, putative            243   9e-78    
emb|CDQ69715.1|  unnamed protein product                                244   9e-78    
ref|XP_007940199.1|  PREDICTED: proteasome subunit beta type-3          244   1e-77    
gb|KIJ66203.1|  hypothetical protein HYDPIDRAFT_174366                  244   1e-77    
gb|EKV19776.1|  hypothetical protein PDIG_01170                         244   1e-77    
ref|XP_007429906.1|  PREDICTED: proteasome subunit beta type-3          244   1e-77    
ref|XP_005861974.1|  PREDICTED: proteasome subunit beta type-3          244   1e-77    
ref|XP_008687168.1|  PREDICTED: proteasome subunit beta type-3          244   1e-77    
ref|NP_002786.2|  proteasome subunit beta type-3                        243   1e-77    
ref|XP_002000340.1|  GI10178                                            243   1e-77    
gb|EHB09674.1|  Proteasome subunit beta type-3                          244   1e-77    
gb|EKG14765.1|  Proteasome subunit alpha/beta                           243   1e-77    
pdb|1IRU|J  Chain J, Crystal Structure Of The Mammalian 20s Prote...    243   1e-77    
ref|XP_002377110.1|  proteasome component Pup3, putative                243   1e-77    
emb|CDM27825.1|  Proteasome component PUP3                              243   1e-77    
ref|XP_010618373.1|  PREDICTED: proteasome subunit beta type-3          243   2e-77    
ref|XP_964481.3|  proteasome component PUP3                             243   2e-77    
gb|ELR54761.1|  Proteasome subunit beta type-3                          243   2e-77    
gb|KGO40172.1|  Proteasome B-type subunit                               243   2e-77    
ref|XP_011220101.1|  PREDICTED: proteasome subunit beta type-3          244   2e-77    
emb|CCG83935.1|  protein of unknown function                            243   2e-77    
gb|AFM87627.1|  proteasome (prosome, macropain) subunit, beta typ...    243   2e-77    
gb|EHH24734.1|  Proteasome subunit beta type-3                          243   2e-77    
ref|NP_649858.1|  proteasome beta3 subunit                              243   2e-77    
ref|XP_002056309.1|  GJ10880                                            243   2e-77    
ref|XP_004591290.1|  PREDICTED: proteasome subunit beta type-3          243   2e-77    
gb|KIN03984.1|  hypothetical protein OIDMADRAFT_102327                  243   2e-77    
ref|XP_005708496.1|  proteasome beta subunit                            243   2e-77    
gb|EJY87444.1|  Proteasome subunit beta type-3                          243   2e-77    
gb|EQL38733.1|  proteasome component PUP3                               243   3e-77    
emb|CBE67030.1|  CG11981-PA                                             243   3e-77    
ref|XP_001359838.1|  GA11308                                            243   3e-77    
gb|ETE71446.1|  Proteasome subunit beta type-3                          244   3e-77    
gb|EJU05191.1|  20S proteasome subunit beta 3                           242   3e-77    
ref|XP_007062009.1|  PREDICTED: proteasome subunit beta type-3          242   3e-77    
ref|XP_001586346.1|  hypothetical protein SS1G_12924                    242   3e-77    
ref|XP_001954770.1|  GF18436                                            242   4e-77    
ref|XP_010389682.1|  PREDICTED: proteasome subunit beta type-3          242   4e-77    
ref|XP_003062799.1|  predicted protein                                  242   4e-77    
ref|XP_007798858.1|  putative proteasome component pup3 protein         242   5e-77    
emb|CCO26430.1|  20S proteasome subunit beta 3                          242   5e-77    
ref|XP_006126284.1|  PREDICTED: proteasome subunit beta type-3          247   5e-77    
ref|XP_008521505.1|  PREDICTED: proteasome subunit beta type-3          242   5e-77    
gb|ELK01586.1|  Proteasome subunit beta type-3                          243   5e-77    
ref|XP_009679368.1|  PREDICTED: proteasome subunit beta type-3          242   5e-77    
ref|XP_001239915.1|  conserved hypothetical protein                     242   6e-77    
ref|XP_003466953.2|  PREDICTED: proteasome subunit beta type-3          242   6e-77    
pdb|4R3O|J  Chain J, Human Constitutive 20s Proteasome                  242   6e-77    
gb|EMR87453.1|  putative proteasome component pup3 protein              241   7e-77    
gb|ACO08515.1|  Proteasome subunit beta type 3                          241   7e-77    
ref|XP_008909010.1|  hypothetical protein, variant                      241   7e-77    
gb|KIJ22008.1|  hypothetical protein PAXINDRAFT_165321                  241   7e-77    
ref|XP_002550836.1|  proteasome component PUP3                          241   8e-77    
gb|KIM24960.1|  hypothetical protein M408DRAFT_331438                   241   8e-77    
gb|KIM88831.1|  hypothetical protein PILCRDRAFT_813813                  241   8e-77    
ref|XP_009957440.1|  PREDICTED: proteasome subunit beta type-3          241   8e-77    
ref|XP_003383125.1|  PREDICTED: proteasome subunit beta type-3-like     241   9e-77    
ref|XP_003023105.1|  hypothetical protein TRV_02795                     241   1e-76    
ref|XP_008064651.1|  PREDICTED: proteasome subunit beta type-3 is...    241   1e-76    
ref|XP_007388022.1|  20S proteasome subunit beta 3                      242   1e-76    
emb|CCF54255.1|  probable PUP3-20S proteasome subunit beta3             241   1e-76    
gb|EDM05877.1|  rCG33987, isoform CRA_d                                 241   1e-76    
ref|XP_003172105.1|  proteasome component PUP3                          241   1e-76    
ref|XP_007918271.1|  putative proteasome component pup3 protein         241   1e-76    
dbj|BAE59332.1|  unnamed protein product                                241   1e-76    
ref|XP_009496857.1|  20S proteasome subunit beta 3                      241   1e-76    
gb|EFX03233.1|  proteasome component                                    241   1e-76    
ref|XP_001990482.1|  GH18224                                            241   1e-76    
ref|XP_003012793.1|  hypothetical protein ARB_01044                     241   1e-76    
ref|XP_001385623.1|  hypothetical protein PICST_62487                   241   1e-76    
ref|XP_007003678.1|  hypothetical protein TREMEDRAFT_68051              241   1e-76    
ref|XP_002474405.1|  predicted protein                                  241   1e-76    
gb|EPE09432.1|  proteasome component                                    242   2e-76    
ref|XP_004633741.1|  PREDICTED: proteasome subunit beta type-3          240   2e-76    
emb|CCE45389.1|  hypothetical protein CPAR2_704030                      240   2e-76    
ref|XP_001874027.1|  20S proteasome subunit beta 3                      240   2e-76    
gb|EPS28720.1|  hypothetical protein PDE_03666                          240   2e-76    
gb|EYE94804.1|  putative proteasome component Pup3                      240   2e-76    
ref|XP_002485230.1|  proteasome component Pup3, putative                240   3e-76    
ref|XP_007531021.1|  PREDICTED: proteasome subunit beta type-3          241   3e-76    
ref|XP_002069722.1|  GK11424                                            240   3e-76    
ref|XP_002842287.1|  hypothetical protein                               252   3e-76    
ref|XP_011108888.1|  hypothetical protein H072_2903                     241   3e-76    
gb|EEH19146.2|  proteasome component PUP3                               241   3e-76    
ref|XP_002843416.1|  proteasome component PUP3                          240   3e-76    
ref|XP_010759304.1|  proteasome component PUP3                          241   3e-76    
gb|KJA28415.1|  hypothetical protein HYPSUDRAFT_33791                   240   3e-76    
dbj|GAM40446.1|  hypothetical protein TCE0_039r12802                    239   4e-76    
gb|KDR85748.1|  hypothetical protein GALMADRAFT_234809                  239   4e-76    
ref|XP_005139393.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    241   4e-76    
gb|KIY50514.1|  20S proteasome subunit beta 3                           239   5e-76    
gb|KHJ30610.1|  putative proteasome subunit beta type-3                 239   6e-76    
gb|KIK07242.1|  hypothetical protein K443DRAFT_200353                   239   6e-76    
ref|XP_009253167.1|  hypothetical protein FPSE_01773                    239   6e-76    
ref|XP_007262405.1|  20S proteasome subunit beta 3                      239   6e-76    
gb|KIK30157.1|  hypothetical protein PISMIDRAFT_671280                  239   7e-76    
ref|XP_011121014.1|  hypothetical protein AOL_s00076g159                239   7e-76    
ref|XP_007363430.1|  N-terminal nucleophile aminohydrolase              239   7e-76    
gb|KIM47479.1|  hypothetical protein M413DRAFT_439139                   239   7e-76    
ref|XP_007753875.1|  proteasome component PUP3                          238   9e-76    
ref|XP_007744933.1|  proteasome component PUP3                          238   9e-76    
ref|XP_011272941.1|  Proteasome component                               239   9e-76    
gb|KIY63673.1|  20S proteasome subunit beta 3                           239   9e-76    
gb|EKD04743.1|  proteasome subunit beta type 3                          239   1e-75    
gb|KIJ37723.1|  hypothetical protein M422DRAFT_781612                   238   1e-75    
ref|XP_007306903.1|  20S proteasome subunit beta 3                      239   1e-75    
emb|CEJ81670.1|  Putative Proteasome component PUP3                     238   1e-75    
gb|EMG47552.1|  Proteasome component PUP3                               238   1e-75    
gb|ACO11102.1|  Proteasome subunit beta type-3                          238   1e-75    
gb|KFR08355.1|  Proteasome subunit beta type-3                          238   1e-75    
ref|XP_002148948.1|  proteasome component Pup3, putative                238   1e-75    
ref|XP_002492139.1|  Beta 3 subunit of the 20S proteasome involve...    238   1e-75    
gb|KEF53834.1|  proteasome component PUP3                               238   2e-75    
gb|EMD36279.1|  20S proteasome subunit beta 3                           238   2e-75    
ref|XP_007312582.1|  hypothetical protein SERLADRAFT_454981             238   2e-75    
gb|EPY87176.1|  proteasome subunit beta type-3                          243   2e-75    
ref|XP_007929141.1|  hypothetical protein MYCFIDRAFT_189753             237   2e-75    
ref|XP_006672167.1|  proteasome component PUP3                          237   2e-75    
gb|KFO34910.1|  Proteasome subunit beta type-3                          238   2e-75    
gb|KIX00352.1|  proteasome subunit beta type-3                          237   3e-75    
ref|XP_003031638.1|  hypothetical protein SCHCODRAFT_15691              238   3e-75    
ref|XP_009552532.1|  20S proteasome, regulatory subunit beta type       238   3e-75    
gb|ACO11008.1|  Proteasome subunit beta type-3                          237   4e-75    
ref|XP_001415971.1|  predicted protein                                  237   4e-75    



>ref|XP_011069394.1| PREDICTED: proteasome subunit beta type-3-A [Sesamum indicum]
Length=204

 Score =   402 bits (1033),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF++IYKIH KLF+GLAGLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKIHDKLFIGLAGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTEVTERILKGR
Sbjct  181  GWGGHVYLVTPTEVTERILKGR  202



>emb|CDP10945.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   400 bits (1028),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIY+IH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYRIHDKLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLG+EDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGEEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_009616684.1| PREDICTED: proteasome subunit beta type-3-A [Nicotiana tomentosiformis]
Length=204

 Score =   399 bits (1025),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLFIGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLY+LREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYELREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACEAMFKPD+EPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACEAMFKPDLEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTE+ILKGR
Sbjct  181  GWGGHVYVVTPTEVTEKILKGR  202



>ref|XP_009798221.1| PREDICTED: proteasome subunit beta type-3-A [Nicotiana sylvestris]
Length=204

 Score =   399 bits (1025),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH K+F+GL+GL TDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKVFIGLSGLGTDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDM PEELFETISQAL+ASVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMGPEELFETISQALIASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTE+ILKGR
Sbjct  181  GWGGHVYVVTPTEVTEKILKGR  202



>ref|XP_010539660.1| PREDICTED: proteasome subunit beta type-3-A-like isoform X1 [Tarenaya 
hassleriana]
Length=204

 Score =   399 bits (1024),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVGERILKGR  202



>ref|XP_004149805.1| PREDICTED: proteasome subunit beta type-3-A-like [Cucumis sativus]
 gb|KGN47703.1| hypothetical protein Csa_6G382910 [Cucumis sativus]
Length=204

 Score =   398 bits (1023),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF++IY+IH KLFLGL+GL TD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYRIHDKLFLGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|ADR70868.1| 20S proteasome beta subunit C2 [Hevea brasiliensis]
Length=204

 Score =   398 bits (1022),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEA+FKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAVFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_010063943.1| PREDICTED: proteasome subunit beta type-3-A [Eucalyptus grandis]
Length=204

 Score =   398 bits (1022),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF++IYK+H KLFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKVHDKLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVS+ILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSSILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVT TE+ ERILKGR
Sbjct  181  GWGGHVYVVTSTEIRERILKGR  202



>gb|KJB64503.1| hypothetical protein B456_010G052100 [Gossypium raimondii]
Length=204

 Score =   398 bits (1022),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK +MEPEELFET+SQAL+ASVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKENMEPEELFETVSQALLASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_010521275.1| PREDICTED: proteasome subunit beta type-3-A isoform X1 [Tarenaya 
hassleriana]
Length=204

 Score =   397 bits (1021),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVRERILKGR  202



>gb|AFK48891.1| unknown [Lotus japonicus]
Length=204

 Score =   397 bits (1021),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFA+ASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAVASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVS+ILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSSILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVVAG+ASESLYGACEAMFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVAGSASESLYGACEAMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|KDP32836.1| hypothetical protein JCGZ_12128 [Jatropha curcas]
Length=204

 Score =   397 bits (1021),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KLFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CT DSIGAKELAKDFVVAGTASESLYGACE++FKPDME EELFET+SQAL++SVDRDCLS
Sbjct  121  CTTDSIGAKELAKDFVVAGTASESLYGACESLFKPDMEAEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTERILKGR
Sbjct  181  GWGGHVYVVTPTEVTERILKGR  202



>ref|XP_010243518.1| PREDICTED: proteasome subunit beta type-3 [Nelumbo nucifera]
Length=204

 Score =   397 bits (1020),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV ER LKGR
Sbjct  181  GWGGHVFVVTPTEVIERTLKGR  202



>ref|NP_001237278.1| uncharacterized protein LOC100306084 [Glycine max]
 gb|ACU14087.1| unknown [Glycine max]
 gb|KHN47019.1| Proteasome subunit beta type-3-A [Glycine soja]
Length=204

 Score =   397 bits (1020),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKP+TFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLLFRHKLYQLREERDMKPQTFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_010539661.1| PREDICTED: proteasome subunit beta type-3-A-like isoform X2 [Tarenaya 
hassleriana]
Length=204

 Score =   397 bits (1020),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVGERILKGR  202



>ref|XP_009769699.1| PREDICTED: proteasome subunit beta type-3-A-like [Nicotiana sylvestris]
Length=204

 Score =   397 bits (1019),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLFIGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETF+SLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFSSLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACEAMFKPDM PEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACEAMFKPDMGPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTE+ILKGR
Sbjct  181  GWGGHVYVVTPTEVTEKILKGR  202



>ref|XP_002285871.1| PREDICTED: proteasome subunit beta type-3-A [Vitis vinifera]
 emb|CBI18992.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   397 bits (1019),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRR GVQLQTVATDF++IY+IH ++FLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRFGVQLQTVATDFQKIYRIHDRVFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFE ISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFEIISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_004493306.1| PREDICTED: proteasome subunit beta type-3-A-like [Cicer arietinum]
Length=204

 Score =   397 bits (1019),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFK DMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKADMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|AFK33992.1| unknown [Lotus japonicus]
Length=204

 Score =   396 bits (1018),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+RI+K+H KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVQLQTVATDFQRIFKVHDKLFIALSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVVAG+ASESLYGACEAMFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVAGSASESLYGACEAMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|KCW71243.1| hypothetical protein EUGRSUZ_F04339 [Eucalyptus grandis]
Length=262

 Score =   398 bits (1023),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF++IYK+H KLFLGL+GLATD 
Sbjct  59   MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKVHDKLFLGLSGLATDA  118

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVS+ILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  119  QTLYQRLVFRHKLYQLREERDMKPETFANLVSSILYEKRFGPYFCQPVIAGLGDEDKPFI  178

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  179  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKPDMEPEELFETISQALLSSVDRDCLS  238

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVT TE+ ERILKGR
Sbjct  239  GWGGHVYVVTSTEIRERILKGR  260



>ref|XP_010521276.1| PREDICTED: proteasome subunit beta type-3-A isoform X2 [Tarenaya 
hassleriana]
Length=204

 Score =   396 bits (1017),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVRERILKGR  202



>gb|KJB29133.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=204

 Score =   395 bits (1016),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK  MEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEGMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|ADR70867.1| 20S proteasome beta subunit C1 [Hevea brasiliensis]
Length=204

 Score =   395 bits (1014),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKFHDRLFMGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DE+KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDENKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEA+FKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAVFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGH+YVVTPTE+ ERILKGR
Sbjct  181  GWGGHIYVVTPTEIKERILKGR  202



>ref|XP_007019135.1| Proteasome beta subunit C1 [Theobroma cacao]
 gb|EOY16360.1| Proteasome beta subunit C1 [Theobroma cacao]
Length=204

 Score =   394 bits (1013),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK DMEP+ELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEDMEPDELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|KJB59983.1| hypothetical protein B456_009G283900 [Gossypium raimondii]
 gb|KJB59984.1| hypothetical protein B456_009G283900 [Gossypium raimondii]
Length=204

 Score =   394 bits (1013),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++FLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK DMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|KDP32966.1| hypothetical protein JCGZ_12997 [Jatropha curcas]
Length=204

 Score =   394 bits (1013),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHHRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEA+FKPDME EEL ET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAIFKPDMEAEELSETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTEVTERILKGR
Sbjct  181  GWGGHVYIVTPTEVTERILKGR  202



>ref|NP_001237990.1| uncharacterized protein LOC100499664 [Glycine max]
 gb|ACU13164.1| unknown [Glycine max]
 gb|KHN05192.1| Proteasome subunit beta type-3-A [Glycine soja]
Length=204

 Score =   394 bits (1011),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIALSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACEAMFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACEAMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_006595528.1| PREDICTED: uncharacterized protein LOC100527027 isoform X1 [Glycine 
max]
 gb|KHN33974.1| Proteasome subunit beta type-3-A [Glycine soja]
Length=204

 Score =   393 bits (1010),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIALSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACEAMFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACEAMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP EV ERILKGR
Sbjct  181  GWGGHVYVVTPNEVKERILKGR  202



>gb|KCW71242.1| hypothetical protein EUGRSUZ_F04339 [Eucalyptus grandis]
Length=262

 Score =   395 bits (1015),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF++IYK+H KLFLGL+GLATD 
Sbjct  59   MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKVHDKLFLGLSGLATDA  118

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVS+ILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  119  QTLYQRLVFRHKLYQLREERDMKPETFANLVSSILYEKRFGPYFCQPVIAGLGDEDKPFI  178

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAK LAKDFVVAGTASESLYGACE+MFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  179  CTMDSIGAKYLAKDFVVAGTASESLYGACESMFKPDMEPEELFETISQALLSSVDRDCLS  238

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVT TE+ ERILKGR
Sbjct  239  GWGGHVYVVTSTEIRERILKGR  260



>ref|XP_008352621.1| PREDICTED: proteasome subunit beta type-3-A [Malus domestica]
Length=204

 Score =   393 bits (1009),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV E+ILKGR
Sbjct  181  GWGGHVFVVTPTEVQEKILKGR  202



>ref|XP_010527680.1| PREDICTED: proteasome subunit beta type-3-A-like [Tarenaya hassleriana]
Length=204

 Score =   392 bits (1007),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIY+IH +LF+GL+GLATDV
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYRIHDRLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV E ILKGR
Sbjct  181  GWGGHVYVVTPTEVREGILKGR  202



>gb|AFK33863.1| unknown [Medicago truncatula]
Length=206

 Score =   392 bits (1006),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_003624868.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES81086.1| proteasome beta type-3 subunit [Medicago truncatula]
Length=204

 Score =   392 bits (1006),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_010268988.1| PREDICTED: proteasome subunit beta type-3-like [Nelumbo nucifera]
Length=204

 Score =   391 bits (1005),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL FRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLFFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M+KPDMEPEELFET+SQAL++S+DRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYKPDMEPEELFETVSQALLSSMDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+V+TPTEV ER LKGR
Sbjct  181  GWGGHVFVITPTEVIERTLKGR  202



>ref|NP_564149.1| proteasome beta subunit C1 [Arabidopsis thaliana]
 ref|XP_010498627.1| PREDICTED: proteasome subunit beta type-3-A [Camelina sativa]
 ref|XP_010459893.1| PREDICTED: proteasome subunit beta type-3-A [Camelina sativa]
 ref|XP_010477418.1| PREDICTED: proteasome subunit beta type-3-A [Camelina sativa]
 sp|Q9XI05.2|PSB3A_ARATH RecName: Full=Proteasome subunit beta type-3-A; AltName: Full=20S 
proteasome beta subunit C-1; AltName: Full=Proteasome component 
T [Arabidopsis thaliana]
 gb|AAL38246.1| proteasome subunit [Arabidopsis thaliana]
 gb|AAM47947.1| proteasome subunit [Arabidopsis thaliana]
 dbj|BAE98543.1| 20S proteasome beta subunit PBC2 like protein [Arabidopsis thaliana]
 gb|AEE30146.1| proteasome beta subunit C1 [Arabidopsis thaliana]
Length=204

 Score =   391 bits (1005),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTE+ ERILKGR
Sbjct  181  GWGGHVYIVTPTEIKERILKGR  202



>gb|EPS70809.1| proteasome subunit beta type, partial [Genlisea aurea]
Length=204

 Score =   391 bits (1005),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            + IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT++TDF++IY IH KLF+GL+GLATD 
Sbjct  1    LQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTISTDFQKIYTIHDKLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLY+LREER+MKPETFASLVS+ILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYELREERNMKPETFASLVSSILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACE+MFKPDMEP+ELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACESMFKPDMEPDELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTERILKGR
Sbjct  181  GWGGHVYVVTPTEVTERILKGR  202



>ref|XP_010670575.1| PREDICTED: proteasome subunit beta type-3-A [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   391 bits (1004),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIY+IH +LF+GL+GL TD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYQIHDRLFIGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLY LREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYHLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M+KPDMEPE+LFET+SQAL AS+DRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYKPDMEPEDLFETVSQALQASIDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTE+ ERILKGR
Sbjct  181  GWGGHVYLVTPTEIKERILKGR  202



>gb|EYU31766.1| hypothetical protein MIMGU_mgv1a013986mg [Erythranthe guttata]
Length=204

 Score =   391 bits (1004),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF++IY+IH KLF+GLAGLATD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYRIHDKLFIGLAGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL+QRLVFRHKLY+LREERDMKPETFASLVSAI YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLHQRLVFRHKLYKLREERDMKPETFASLVSAIQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M++PDME EELFETISQAL++S+DRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYRPDMEAEELFETISQALISSIDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTEVTER+LKGR
Sbjct  181  GWGGHVYLVTPTEVTERVLKGR  202



>ref|XP_006302830.1| hypothetical protein CARUB_v10020962mg [Capsella rubella]
 gb|EOA35728.1| hypothetical protein CARUB_v10020962mg [Capsella rubella]
Length=204

 Score =   391 bits (1004),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP E+ ERILKGR
Sbjct  181  GWGGHVYVVTPNEIKERILKGR  202



>ref|XP_006416271.1| hypothetical protein EUTSA_v10008793mg [Eutrema salsugineum]
 gb|ESQ34624.1| hypothetical protein EUTSA_v10008793mg [Eutrema salsugineum]
Length=204

 Score =   390 bits (1003),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVG+NCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGRNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_008338662.1| PREDICTED: proteasome subunit beta type-3-A [Malus domestica]
Length=204

 Score =   390 bits (1003),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFAS VSAILYEKRFGPYF QPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASXVSAILYEKRFGPYFTQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV E+ILKGR
Sbjct  181  GWGGHVFVVTPTEVQEKILKGR  202



>gb|AFK44934.1| unknown [Medicago truncatula]
Length=204

 Score =   390 bits (1003),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDM+PETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMRPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_009149692.1| PREDICTED: proteasome subunit beta type-3-A [Brassica rapa]
 emb|CDY08181.1| BnaA06g15450D [Brassica napus]
 emb|CDY04667.1| BnaC05g17050D [Brassica napus]
Length=204

 Score =   390 bits (1002),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTE+ ERILKGR
Sbjct  181  GWGGHVYVVTPTEIKERILKGR  202



>ref|XP_006434244.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 ref|XP_006472814.1| PREDICTED: proteasome subunit beta type-3-A-like [Citrus sinensis]
 gb|ESR47484.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 gb|KDO80553.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=204

 Score =   390 bits (1002),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTA ESLYGACEAMFKPDMEP+ELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTAGESLYGACEAMFKPDMEPDELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTE+ ERILKGR
Sbjct  181  GWGGHVYIVTPTEIKERILKGR  202



>ref|XP_002890456.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AAD41426.1|AC007727_15 Identical to gb|Y13173 Arabidopsis thaliana mRNA for proteasome 
subunit. EST gb|T76747 comes from this gene [Arabidopsis 
thaliana]
 gb|AAK06878.1|AF344327_1 putative 20S proteasome beta subunit PBC2 [Arabidopsis thaliana]
 gb|EFH66715.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   390 bits (1002),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTE+ ERILKGR
Sbjct  181  GWGGHVYIVTPTEIKERILKGR  202



>ref|XP_010428822.1| PREDICTED: proteasome subunit beta type-3-B [Camelina sativa]
 ref|XP_010471937.1| PREDICTED: proteasome subunit beta type-3-B isoform X1 [Camelina 
sativa]
Length=204

 Score =   390 bits (1001),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP E+ E+ILKGR
Sbjct  181  GWGGHVYVVTPNEIKEKILKGR  202



>ref|XP_009376873.1| PREDICTED: proteasome subunit beta type-3-A [Pyrus x bretschneideri]
Length=204

 Score =   390 bits (1001),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSISEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV E+ILKGR
Sbjct  181  GWGGHVFVVTPTEVQEKILKGR  202



>ref|XP_002520338.1| proteasome subunit beta type, putative [Ricinus communis]
 gb|EEF42124.1| proteasome subunit beta type, putative [Ricinus communis]
Length=204

 Score =   390 bits (1001),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDM PETFASLVSA+LYEKRFGPYFCQPVIAGL DE+KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMNPETFASLVSALLYEKRFGPYFCQPVIAGLSDENKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELA+DFVVAGTASESLYGACE+MFKPD+E EEL E ISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELARDFVVAGTASESLYGACESMFKPDLEAEELTEIISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTERILKGR
Sbjct  181  GWGGHVYVVTPTEVTERILKGR  202



>emb|CDY01316.1| BnaA07g10890D [Brassica napus]
Length=206

 Score =   390 bits (1001),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = +2

Query  23   LRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLAT  202
            + M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLAT
Sbjct  1    MSMQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLAT  60

Query  203  DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKP  382
            DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKP
Sbjct  61   DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKP  120

Query  383  FICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDC  562
            FICTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDC
Sbjct  121  FICTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDC  180

Query  563  LSGWGGHVYVVTPTEVTERILKGR  634
            LSGWGGHVYVVTPTE+ ERILKGR
Sbjct  181  LSGWGGHVYVVTPTEIKERILKGR  204



>ref|XP_006359316.1| PREDICTED: proteasome subunit beta type-3-A-like [Solanum tuberosum]
Length=204

 Score =   389 bits (1000),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRR GVQLQT+ATDF+RIYKIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRFGVQLQTIATDFQRIYKIHEKLFIGLSGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL QRL+FRHKLY+LRE+RDMKPETFASLVSA+LYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLQQRLMFRHKLYELREDRDMKPETFASLVSAMLYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDM PEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMGPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTERILKGR
Sbjct  181  GWGGHVYVVTPTEVTERILKGR  202



>ref|XP_004236827.1| PREDICTED: proteasome subunit beta type-3-A [Solanum lycopersicum]
Length=204

 Score =   389 bits (999),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRR GVQLQT+ATDF+RIYKIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRFGVQLQTIATDFQRIYKIHDKLFIGLSGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL+QRL+FRHKLY+LRE+RDMKPETFASLVSA+LYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLHQRLMFRHKLYELREDRDMKPETFASLVSAMLYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDM PEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMGPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEVTERILKGR
Sbjct  181  GWGGHVYVVTPTEVTERILKGR  202



>ref|NP_565156.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
 ref|NP_001031294.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
 sp|O81153.1|PSB3B_ARATH RecName: Full=Proteasome subunit beta type-3-B; AltName: Full=20S 
proteasome beta subunit C-2 [Arabidopsis thaliana]
 gb|AAK60320.1|AF385730_1 At1g77440/T5M16_3 [Arabidopsis thaliana]
 gb|AAC32069.1| 20S proteasome beta subunit PBC2 [Arabidopsis thaliana]
 gb|AAL87388.1| At1g77440/T5M16_3 [Arabidopsis thaliana]
 gb|AEE35977.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
 gb|AEE35978.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
Length=204

 Score =   389 bits (999),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGP+ CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP EV ERILKGR
Sbjct  181  GWGGHVYVVTPKEVKERILKGR  202



>emb|CDY00398.1| BnaC07g14280D [Brassica napus]
Length=204

 Score =   389 bits (999),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP E+ ERILKGR
Sbjct  181  GWGGHVYVVTPNEIKERILKGR  202



>ref|XP_007161473.1| hypothetical protein PHAVU_001G072000g [Phaseolus vulgaris]
 gb|ESW33467.1| hypothetical protein PHAVU_001G072000g [Phaseolus vulgaris]
Length=204

 Score =   389 bits (999),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKLFIALSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL QRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLNQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+MFKPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMFKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ER+LKGR
Sbjct  181  GWGGHVYVVTPTEVKERLLKGR  202



>ref|XP_009110172.1| PREDICTED: proteasome subunit beta type-3-A-like [Brassica rapa]
Length=204

 Score =   389 bits (998),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+ L+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIALSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTE+ ERILKGR
Sbjct  181  GWGGHVYVVTPTEIKERILKGR  202



>ref|XP_010416685.1| PREDICTED: proteasome subunit beta type-3-B-like isoform X1 [Camelina 
sativa]
Length=204

 Score =   389 bits (998),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP E+ E+ILKGR
Sbjct  181  GWGGHVYVVTPDEIKEKILKGR  202



>ref|XP_009112575.1| PREDICTED: proteasome subunit beta type-3-A-like [Brassica rapa]
Length=204

 Score =   389 bits (998),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTE+ ERILKGR
Sbjct  181  GWGGHVYVVTPTEIKERILKGR  202



>ref|XP_009128227.1| PREDICTED: proteasome subunit beta type-3-A [Brassica rapa]
Length=204

 Score =   389 bits (998),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFKRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP E+ ERILKGR
Sbjct  181  GWGGHVYVVTPNEIKERILKGR  202



>gb|AAM62756.1| putative 20S proteasome beta subunit PBC2 [Arabidopsis thaliana]
Length=204

 Score =   389 bits (998),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYN SA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNVSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTE+ ERILKGR
Sbjct  181  GWGGHVYIVTPTEIKERILKGR  202



>ref|XP_006304134.1| hypothetical protein CARUB_v10010099mg, partial [Capsella rubella]
 gb|EOA37032.1| hypothetical protein CARUB_v10010099mg, partial [Capsella rubella]
Length=251

 Score =   390 bits (1002),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  48   MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  107

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  108  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  167

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  168  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  227

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVY+VTPTE+ ERILKGR
Sbjct  228  GWGGHVYIVTPTEIKERILKGR  249



>ref|XP_002887683.1| hypothetical protein ARALYDRAFT_895633 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63942.1| hypothetical protein ARALYDRAFT_895633 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score =   388 bits (997),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGP+ CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP EV ERILKGR
Sbjct  181  GWGGHVYVVTPNEVKERILKGR  202



>ref|XP_006390090.1| hypothetical protein EUTSA_v10019145mg [Eutrema salsugineum]
 gb|ESQ27376.1| hypothetical protein EUTSA_v10019145mg [Eutrema salsugineum]
Length=204

 Score =   388 bits (997),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKP+TFASLVSAILYEKRFGPY CQPVIAGLG+++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPDTFASLVSAILYEKRFGPYLCQPVIAGLGEDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP EV ERILKGR
Sbjct  181  GWGGHVYVVTPNEVKERILKGR  202



>ref|XP_007223461.1| hypothetical protein PRUPE_ppa011601mg [Prunus persica]
 gb|EMJ24660.1| hypothetical protein PRUPE_ppa011601mg [Prunus persica]
Length=204

 Score =   388 bits (997),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTVATDFKRINQVHDRLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDRPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDME EELFE +SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEAEELFEIVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV ERILKGR
Sbjct  181  GWGGHVFVVTPTEVKERILKGR  202



>ref|XP_010471938.1| PREDICTED: proteasome subunit beta type-3-B isoform X2 [Camelina 
sativa]
Length=204

 Score =   388 bits (996),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP E+ E+ILKGR
Sbjct  181  GWGGHVYVVTPNEIKEKILKGR  202



>gb|KFK44279.1| hypothetical protein AALP_AA1G237600 [Arabis alpina]
Length=204

 Score =   388 bits (996),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL QRL FRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLNQRLAFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>gb|ACJ85972.1| unknown [Medicago truncatula]
Length=204

 Score =   387 bits (994),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREE DMKPETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREECDMKPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_006838497.1| hypothetical protein AMTR_s00002p00168080 [Amborella trichopoda]
 gb|ERN01066.1| hypothetical protein AMTR_s00002p00168080 [Amborella trichopoda]
Length=204

 Score =   387 bits (993),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF++IYKIHG+LF+GLAGLATD 
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKIHGRLFIGLAGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLG +DKPFI
Sbjct  61   QTLYQRLIFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGKDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELA+DFVV GTASESLYGACE+M+KPDM+PEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAEDFVVGGTASESLYGACESMYKPDMKPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV VVTP ++TER LKGR
Sbjct  181  GWGGHVIVVTPDDITERTLKGR  202



>ref|XP_010416686.1| PREDICTED: proteasome subunit beta type-3-B-like isoform X2 [Camelina 
sativa]
Length=204

 Score =   387 bits (993),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP E+ E+ILKGR
Sbjct  181  GWGGHVYVVTPDEIKEKILKGR  202



>ref|XP_009379033.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
 ref|XP_009379034.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
 ref|XP_009347267.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
 ref|XP_009347269.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
Length=204

 Score =   387 bits (993),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLSDEDRPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV E+ILKGR
Sbjct  181  GWGGHVFVVTPTEVQEKILKGR  202



>gb|KFK42138.1| hypothetical protein AALP_AA2G216100 [Arabis alpina]
Length=204

 Score =   386 bits (992),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREER+MKPETFASLVSA+LYEKRFGPY CQPVIAGLG+++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERNMKPETFASLVSAVLYEKRFGPYLCQPVIAGLGEDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTP EV ERILKGR
Sbjct  181  GWGGHVYVVTPNEVKERILKGR  202



>ref|XP_002307450.1| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
 ref|XP_011003432.1| PREDICTED: proteasome subunit beta type-3-A [Populus euphratica]
 gb|EEE94446.1| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
Length=204

 Score =   386 bits (992),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH K+F+GL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKVFVGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVVAG+ASESLYGACEA+FKPDMEPEELFE +SQAL+ASVDRDCLS
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEALFKPDMEPEELFEVVSQALLASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGH+Y+VTP E+ E+ILKGR
Sbjct  181  GWGGHIYIVTPDEIREKILKGR  202



>ref|XP_008219606.1| PREDICTED: proteasome subunit beta type-3-A [Prunus mume]
Length=204

 Score =   386 bits (992),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+G++GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTVATDFKRINQVHDRLFIGISGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDRPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDME EELFE +SQAL +SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEAEELFEIVSQALFSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV ERILKGR
Sbjct  181  GWGGHVFVVTPTEVKERILKGR  202



>ref|XP_009103286.1| PREDICTED: proteasome subunit beta type-3-A-like [Brassica rapa]
Length=204

 Score =   385 bits (990),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M IFEYNGSA+VAM GKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMGGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTE+ ERILKGR
Sbjct  181  GWGGHVYVVTPTEIKERILKGR  202



>ref|XP_008347744.1| PREDICTED: proteasome subunit beta type-3-A-like [Malus domestica]
Length=204

 Score =   385 bits (988),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLSDEDRPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CT DSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTTDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV E+ILKGR
Sbjct  181  GWGGHVFVVTPTEVQEKILKGR  202



>sp|O65084.1|PSB3_PICMA RecName: Full=Proteasome subunit beta type-3; AltName: Full=20S 
proteasome alpha subunit C; AltName: Full=20S proteasome 
subunit beta-3 [Picea mariana]
 gb|AAC32146.1| probable proteasome subunit [Picea mariana]
 gb|ABK23292.1| unknown [Picea sitchensis]
Length=204

 Score =   384 bits (987),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYVGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQR  FRHKLYQLREER+M+PETFASLVSA+LYEKRFGPYFCQPVIAGLG++DKPFI
Sbjct  61   QTLYQRFAFRHKLYQLREERNMRPETFASLVSALLYEKRFGPYFCQPVIAGLGEDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTA+ESLYGACE+M+KPDMEPEELFETISQAL++S+DRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTAAESLYGACESMYKPDMEPEELFETISQALLSSIDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVV+P +V ER LKGR
Sbjct  181  GWGGHVYVVSPNQVIERTLKGR  202



>ref|XP_004290891.1| PREDICTED: proteasome subunit beta type-3-A [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   384 bits (987),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNG A++AMVGKNCFAIASDRRLGVQLQT+ATDF++IY++  +LFLGL+GLATD 
Sbjct  1    MSIFEYNGGAIIAMVGKNCFAIASDRRLGVQLQTIATDFKKIYRVSDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL+QRL+F+HKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGLGD DKPFI
Sbjct  61   QTLFQRLMFKHKLYQLREERDMKPETFASLVSAILYEKRFGPYFIQPVIAGLGDGDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGH+YVVTPTEV ERILKGR
Sbjct  181  GWGGHIYVVTPTEVKERILKGR  202



>ref|XP_010929114.1| PREDICTED: proteasome subunit beta type-3 [Elaeis guineensis]
Length=204

 Score =   384 bits (987),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++S+DRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSIDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV ER LKGR
Sbjct  181  GWGGHVFVVTPTEVQERTLKGR  202



>ref|XP_008806302.1| PREDICTED: proteasome subunit beta type-3 [Phoenix dactylifera]
Length=204

 Score =   384 bits (985),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+  PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDSVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV+VVTPTEV ER LKGR
Sbjct  181  GWGGHVFVVTPTEVQERTLKGR  202



>dbj|BAJ98022.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95982.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   384 bits (985),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVF+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG+ D+PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGENDQPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV ER+LKGR
Sbjct  181  GWGGYVLIVTPTEVQERVLKGR  202



>gb|EMT19931.1| Proteasome subunit beta type-3 [Aegilops tauschii]
Length=204

 Score =   383 bits (984),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL F+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG++D+PFI
Sbjct  61   QTLYQRLAFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGEKDQPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV ER+LKGR
Sbjct  181  GWGGYVLIVTPTEVQERVLKGR  202



>ref|XP_003570772.1| PREDICTED: proteasome subunit beta type-3-like [Brachypodium 
distachyon]
 ref|XP_010233916.1| PREDICTED: proteasome subunit beta type-3-like [Brachypodium 
distachyon]
Length=204

 Score =   383 bits (984),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKVHEKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVF+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLGD D+PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGDNDQPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V VVTPTEV ER+LKGR
Sbjct  181  GWGGYVLVVTPTEVQERVLKGR  202



>ref|XP_003563301.1| PREDICTED: proteasome subunit beta type-3 [Brachypodium distachyon]
Length=204

 Score =   383 bits (984),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL+LGL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVF+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG++++PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGEDNEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V VVTPTEV ER+LKGR
Sbjct  181  GWGGYVLVVTPTEVQERVLKGR  202



>ref|XP_003608106.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES90303.1| proteasome beta type-3 subunit [Medicago truncatula]
 gb|AFK36937.1| unknown [Medicago truncatula]
Length=204

 Score =   383 bits (983),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            M+IF++NGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KL++GL+GLATD 
Sbjct  1    MTIFKHNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLYIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREE DMKPETFASLVSA+ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREELDMKPETFASLVSAMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPDME EELFETISQAL++SVDRDCLS
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPDMEAEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHVYVVTPTEV ERILKGR
Sbjct  181  GWGGHVYVVTPTEVKERILKGR  202



>ref|XP_008784796.1| PREDICTED: proteasome subunit beta type-3 [Phoenix dactylifera]
Length=204

 Score =   382 bits (980),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYVGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV VVTPTEV ER LKGR
Sbjct  181  GWGGHVLVVTPTEVQERTLKGR  202



>ref|XP_002453412.1| hypothetical protein SORBIDRAFT_04g005590 [Sorghum bicolor]
 gb|EES06388.1| hypothetical protein SORBIDRAFT_04g005590 [Sorghum bicolor]
Length=204

 Score =   382 bits (980),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD ++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDNNEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL ASVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALQASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV ER+LKGR
Sbjct  181  GWGGYVLIVTPTEVQERVLKGR  202



>ref|XP_010942147.1| PREDICTED: proteasome subunit beta type-3 [Elaeis guineensis]
Length=204

 Score =   381 bits (979),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKVHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+D PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV +VTPTEV ER LKGR
Sbjct  181  GWGGHVLLVTPTEVQERTLKGR  202



>ref|XP_002300970.2| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
 gb|EEE80243.2| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
Length=204

 Score =   380 bits (977),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKLFVGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGL D+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAVLYEKRFGPYFCQPVIAGLDDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVVAG+ASESLYGACEA FKPDMEP+ELFE +SQAL+ASVDRDCLS
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEAFFKPDMEPDELFEVVSQALLASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGH+Y+VTP ++ E+ILKGR
Sbjct  181  GWGGHIYIVTPDDIKEKILKGR  202



>ref|XP_009417439.1| PREDICTED: proteasome subunit beta type-3 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   380 bits (976),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGV LQTVATDF+RI+KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVNLQTVATDFQRIFKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QT+YQRLVFRHKLYQLREERDMKP+TFASLVSA+LYEKRFGPYFCQPVIAGLGD+D PFI
Sbjct  61   QTMYQRLVFRHKLYQLREERDMKPQTFASLVSALLYEKRFGPYFCQPVIAGLGDDDVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV +VTPTEV ER LKGR
Sbjct  181  GWGGHVLLVTPTEVQERTLKGR  202



>ref|XP_009394944.1| PREDICTED: proteasome subunit beta type-3-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   380 bits (975),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVNLQTIATDFQRIFKIHDKLYIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKP+TFASLVSA+LYEKRFGPYFC PVIAGLGD+D PFI
Sbjct  61   QTLYQRLIFRHKLYQLREERDMKPQTFASLVSALLYEKRFGPYFCMPVIAGLGDDDAPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGHV +VTPTEV ER LKGR
Sbjct  181  GWGGHVLLVTPTEVQERTLKGR  202



>gb|ABK95590.1| unknown [Populus trichocarpa]
Length=204

 Score =   380 bits (975),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKLFVGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHK+YQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGL D+DKPFI
Sbjct  61   QTLYQRLVFRHKMYQLREERDMKPETFANLVSAVLYEKRFGPYFCQPVIAGLDDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVVAG+ASESLYGACEA FKPDMEP+ELFE +SQAL+ASVDRDCLS
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEAFFKPDMEPDELFEVVSQALLASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGH+Y+VTP ++ E+ILKGR
Sbjct  181  GWGGHIYIVTPDDIKEKILKGR  202



>gb|EMS62704.1| Proteasome subunit beta type-3 [Triticum urartu]
Length=204

 Score =   379 bits (972),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL F+HKLYQLR ERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG++D+PFI
Sbjct  61   QTLYQRLGFKHKLYQLRGERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGEKDQPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPDMEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPDMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV ER+LKGR
Sbjct  181  GWGGYVLIVTPTEVQERVLKGR  202



>dbj|BAD25149.1| Proteasome subunit beta type 3 [Oryza sativa Japonica Group]
 dbj|BAH01224.1| unnamed protein product [Oryza sativa Japonica Group]
Length=204

 Score =   378 bits (970),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKP+ FASLVSA+LYEKRFGPYFCQPVIAGLGD D+PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPQAFASLVSALLYEKRFGPYFCQPVIAGLGDNDEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP MEPEELFETISQAL ASVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPSMEPEELFETISQALQASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV ER++KGR
Sbjct  181  GWGGYVLLVTPTEVQERVIKGR  202



>dbj|BAJ87014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   377 bits (969),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVF+HKLYQLREERDMKPETFASLVS++LYEKRFGPYFCQP+IAGLG +D+PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSSMLYEKRFGPYFCQPIIAGLGQDDEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VT TEV ER+LKGR
Sbjct  181  GWGGYVLIVTATEVQERVLKGR  202



>ref|XP_004951671.1| PREDICTED: proteasome subunit beta type-3-like [Setaria italica]
Length=204

 Score =   377 bits (967),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKVHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLG+ ++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGENNEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GT+SESLYGACE+M+KP+MEPEELFET+SQAL+ASVDRDCL+
Sbjct  121  CTMDCIGAKELAKDFVVSGTSSESLYGACESMYKPNMEPEELFETVSQALMASVDRDCLA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV ER++KGR
Sbjct  181  GWGGYVVIVTPTEVQERVVKGR  202



>ref|NP_001140276.1| uncharacterized protein LOC100272320 [Zea mays]
 gb|ACF83488.1| unknown [Zea mays]
Length=204

 Score =   375 bits (964),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFRRVFKVHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQL EERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD D+PFI
Sbjct  61   QTLYQRLVFRHKLYQLMEERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDNDEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL ASVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALQASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V VVT TEV ER+LKGR
Sbjct  181  GWGGYVLVVTHTEVQERVLKGR  202



>gb|EAY84744.1| hypothetical protein OsI_06114 [Oryza sativa Indica Group]
 gb|EAZ21982.1| hypothetical protein OsJ_05637 [Oryza sativa Japonica Group]
Length=213

 Score =   375 bits (962),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  23   LRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLAT  202
            + + IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLAT
Sbjct  8    VSLQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLAT  67

Query  203  DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKP  382
            D QTLYQRLVFRHKLYQLREERDMKP+ FASLVSA+LYEKRFGPYFCQPVIAGLGD D+P
Sbjct  68   DAQTLYQRLVFRHKLYQLREERDMKPQAFASLVSALLYEKRFGPYFCQPVIAGLGDNDEP  127

Query  383  FICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDC  562
            FICTMD IGAKELAKDFVV+GTASESLYGACE+M+KP MEPEELFETISQAL ASVDRDC
Sbjct  128  FICTMDCIGAKELAKDFVVSGTASESLYGACESMYKPSMEPEELFETISQALQASVDRDC  187

Query  563  LSGWGGHVYVVTPTEVTERILKGR  634
            LSGWGG+V +VTPTEV ER++KGR
Sbjct  188  LSGWGGYVLLVTPTEVQERVIKGR  211



>ref|XP_002438734.1| hypothetical protein SORBIDRAFT_10g025190 [Sorghum bicolor]
 gb|EER90101.1| hypothetical protein SORBIDRAFT_10g025190 [Sorghum bicolor]
Length=204

 Score =   374 bits (961),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+D PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEP+ELFETISQAL +SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPDELFETISQALNSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV E ++K R
Sbjct  181  GWGGYVLIVTPTEVREHVIKSR  202



>gb|AFW70451.1| proteasome subunit beta type [Zea mays]
Length=305

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF R++K+H KL++GL+GLATD 
Sbjct  102  MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFRRVFKVHDKLYIGLSGLATDA  161

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQL EERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD D+PFI
Sbjct  162  QTLYQRLVFRHKLYQLMEERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDNDEPFI  221

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL ASVDRDCLS
Sbjct  222  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALQASVDRDCLS  281

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V VVT TEV ER+LKGR
Sbjct  282  GWGGYVLVVTHTEVQERVLKGR  303



>ref|XP_006648378.1| PREDICTED: proteasome subunit beta type-3-like [Oryza brachyantha]
Length=204

 Score =   374 bits (959),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKVHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKP+TFASLVSA+LYE+RFGPYFCQPVIAGLGD D+PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPQTFASLVSALLYERRFGPYFCQPVIAGLGDNDEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP MEPEELFETISQAL ASVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPGMEPEELFETISQALQASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV E ++KGR
Sbjct  181  GWGGYVLLVTPTEVRESVIKGR  202



>ref|XP_008649041.1| PREDICTED: proteasome subunit beta type-3 [Zea mays]
 gb|AFW76218.1| hypothetical protein ZEAMMB73_756098 [Zea mays]
Length=204

 Score =   372 bits (956),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KPDM+P+ELFETISQAL +SVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPDMQPDELFETISQALNSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV E ++K R
Sbjct  181  GWGGYVLIVTPTEVREHVIKSR  202



>gb|KJB29135.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=189

 Score =   372 bits (954),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK  MEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEGMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVV  595
            GWGGHVYVV
Sbjct  181  GWGGHVYVV  189



>gb|KJB64504.1| hypothetical protein B456_010G052100 [Gossypium raimondii]
Length=191

 Score =   371 bits (953),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LFLGL+GLATD QTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFLGLSGLATDAQTLYQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVVAGTASESLYGACE+MFK +MEPEELFET+SQAL+ASVDRDCLSGWGGHVYVVTPTE
Sbjct  121  DFVVAGTASESLYGACESMFKENMEPEELFETVSQALLASVDRDCLSGWGGHVYVVTPTE  180

Query  608  VTERILKGR  634
            V ERILKGR
Sbjct  181  VKERILKGR  189



>gb|KJB29136.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=223

 Score =   372 bits (956),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK  MEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEGMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILK  628
            GWGGHVYVV        I K
Sbjct  181  GWGGHVYVVRENTDVRCIFK  200



>ref|NP_001058176.1| Os06g0643100 [Oryza sativa Japonica Group]
 sp|Q9LST7.1|PSB3_ORYSJ RecName: Full=Proteasome subunit beta type-3; AltName: Full=20S 
proteasome alpha subunit C; AltName: Full=20S proteasome 
subunit beta-3 [Oryza sativa Japonica Group]
 dbj|BAA96836.1| beta 3 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAD37365.1| 20S proteasome subunit beta type 3 [Oryza sativa Japonica Group]
 dbj|BAF20090.1| Os06g0643100 [Oryza sativa Japonica Group]
 gb|EEC81061.1| hypothetical protein OsI_23870 [Oryza sativa Indica Group]
 gb|EEE66098.1| hypothetical protein OsJ_22127 [Oryza sativa Japonica Group]
Length=204

 Score =   372 bits (954),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKP+TFASLVSA+LYEKRFGPYFCQPVIAGLG++++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPQTFASLVSALLYEKRFGPYFCQPVIAGLGEDNEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL +SVDRDCLS
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALQSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V +VTPTEV E ++KGR
Sbjct  181  GWGGFVLLVTPTEVKECVIKGR  202



>gb|AFW87307.1| proteasome subunit beta type [Zea mays]
Length=204

 Score =   370 bits (950),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKVHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+MEP+ELFET+SQAL +S+DRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPNMEPDELFETVSQALNSSIDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV E ++K R
Sbjct  181  GWGGYVLIVTPTEVREHVIKSR  202



>ref|NP_001141963.1| uncharacterized protein LOC100274112 [Zea mays]
 gb|ACF87384.1| unknown [Zea mays]
Length=204

 Score =   369 bits (948),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKVHDKLYIGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M++P+MEP+ELFET+SQAL +S+DRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYRPNMEPDELFETVSQALNSSIDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV E ++K R
Sbjct  181  GWGGYVLIVTPTEVREHVIKSR  202



>gb|KJB59985.1| hypothetical protein B456_009G283900 [Gossypium raimondii]
Length=191

 Score =   368 bits (945),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++FLGL+GLATD QTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFLGLSGLATDAQTLYQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFANLVSALLYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVVAGTASESLYGACE+MFK DMEPEELFET+SQAL++SVDRDCLSGWGGHVYVVTPTE
Sbjct  121  DFVVAGTASESLYGACESMFKEDMEPEELFETVSQALLSSVDRDCLSGWGGHVYVVTPTE  180

Query  608  VTERILKGR  634
            V ERILKGR
Sbjct  181  VKERILKGR  189



>ref|XP_004965763.1| PREDICTED: proteasome subunit beta type-3-like [Setaria italica]
Length=204

 Score =   369 bits (946),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA++AMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GL TD 
Sbjct  1    MSIFEYNGSAVMAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPY CQPVIAGLG++++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYLCQPVIAGLGEDNEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+MEP+ELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPNMEPDELFETVSQALMSSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG+V +VTPTEV E ++KGR
Sbjct  181  GWGGYVVIVTPTEVREHVVKGR  202



>gb|AEC11048.1| 20S proteasome beta subunit pbc2, partial [Camellia sinensis]
Length=187

 Score =   365 bits (936),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +2

Query  80   NCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKLYQLR  259
            NCFAIASDRRLGVQLQT+ATDF+RIYKIH KL +GLAGLATD QT+YQRLVFRHKLYQLR
Sbjct  1    NCFAIASDRRLGVQLQTIATDFQRIYKIHDKLSIGLAGLATDSQTMYQRLVFRHKLYQLR  60

Query  260  EERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAKDFVV  439
            EERDMKP+TFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFICTMDSIGAKELAKDFVV
Sbjct  61   EERDMKPQTFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFICTMDSIGAKELAKDFVV  120

Query  440  AGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTEVTER  619
            AGTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLSGWGGHVYVVTPTEVTER
Sbjct  121  AGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLSGWGGHVYVVTPTEVTER  180

Query  620  ILKGR  634
            ILKGR
Sbjct  181  ILKGR  185



>emb|CDY38347.1| BnaA02g18400D [Brassica napus]
Length=191

 Score =   365 bits (936),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFKRISKIHDRLFIGLSGLATDVQTLYQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFICTMDSIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLSGWGGHVYVVTP E
Sbjct  121  DFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLSGWGGHVYVVTPNE  180

Query  608  VTERILKGR  634
            + ERILKGR
Sbjct  181  IKERILKGR  189



>gb|AAG51672.1|AC010704_16 putative 20S proteasome beta subunit PBC2; 7006-8626 [Arabidopsis 
thaliana]
Length=191

 Score =   364 bits (934),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDVQTLYQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVSAILYEKRFGP+ CQPVIAGLGD++KPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFICTMDSIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVV+GTASESLYGACEAMFKPDME EELFETISQAL++SVDRDCLSGWGGHVYVVTP E
Sbjct  121  DFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLSGWGGHVYVVTPKE  180

Query  608  VTERILKGR  634
            V ERILKGR
Sbjct  181  VKERILKGR  189



>emb|CDY67773.1| BnaAnng25130D [Brassica napus]
Length=191

 Score =   363 bits (933),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+ L+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIALSGLATDVQTLYQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFICTMDSIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLSGWGGHVYVVTPTE
Sbjct  121  DFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLSGWGGHVYVVTPTE  180

Query  608  VTERILKGR  634
            + ERILKGR
Sbjct  181  IKERILKGR  189



>emb|CDY71260.1| BnaAnng36740D [Brassica napus]
Length=191

 Score =   362 bits (929),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+ L+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIALSGLATDVQTLYQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG+++KPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDEKPFICTMDSIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLSGWGGHVYVVTPTE
Sbjct  121  DFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLSGWGGHVYVVTPTE  180

Query  608  VTERILKGR  634
            + ERILKGR
Sbjct  181  IKERILKGR  189



>gb|KHG23898.1| Proteasome subunit beta type-3-A -like protein [Gossypium arboreum]
Length=227

 Score =   362 bits (930),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK  MEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEGMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGH  583
            GWGGH
Sbjct  181  GWGGH  185



>ref|XP_011027490.1| PREDICTED: proteasome subunit beta type-3-A [Populus euphratica]
Length=204

 Score =   360 bits (925),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH KL LGL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHHKLLLGLSGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQP+IAGL  +DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAVLYEKRFGPYFCQPIIAGLDGDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMD IGAKELAKDFVVAG+ASESLYGACEA FKPDMEP+ELFE +SQAL+ASVDRDCLS
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEAFFKPDMEPDELFEVVSQALLASVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGGH+Y+VTP ++ E+ILKGR
Sbjct  181  GWGGHIYIVTPDDIKEKILKGR  202



>gb|KHG25919.1| Proteasome subunit beta type-3-A -like protein [Gossypium arboreum]
Length=274

 Score =   360 bits (924),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++FLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+ VSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANHVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK DMEPEELFET+SQAL++SVDRDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEDMEPEELFETVSQALLSSVDRDCLS  180

Query  569  GWGGH  583
            GWGGH
Sbjct  181  GWGGH  185



>gb|EMS47536.1| Proteasome subunit beta type-3 [Triticum urartu]
Length=191

 Score =   355 bits (912),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D QTLYQRLVF+HKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDAQTLYQRLVFKHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVS++LYEKRFGPYFCQP+IAGLG +D+PFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSSMLYEKRFGPYFCQPIIAGLGQDDEPFICTMDCIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLSGWGG+V +VTPTE
Sbjct  121  DFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLSGWGGYVLIVTPTE  180

Query  608  VTERILKGR  634
            V ER+LKGR
Sbjct  181  VQERVLKGR  189



>ref|XP_006656285.1| PREDICTED: proteasome subunit beta type-3-like [Oryza brachyantha]
Length=191

 Score =   352 bits (904),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLATD QTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDAQTLYQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKP+TFASLVSA+LYE+RFGPYFCQPVIAGLG++++PFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPQTFASLVSALLYERRFGPYFCQPVIAGLGEDNEPFICTMDCIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLSGWGG+V VVTPTE
Sbjct  121  DFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLSGWGGYVMVVTPTE  180

Query  608  VTERILKGR  634
            V ER+LK R
Sbjct  181  VQERVLKAR  189



>gb|AGV54396.1| proteasome subunit beta type-3-A isoform 1 [Phaseolus vulgaris]
Length=208

 Score =   350 bits (899),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 183/206 (89%), Gaps = 17/206 (8%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH KLF+ L+GLATD QTL QRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKLFIALSGLATDAQTLNQRLVFRHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFICTMDCIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDR-----------------  556
            DFVV+GTASESLYGACE+MFKPDMEPEELFETISQAL++SV+R                 
Sbjct  121  DFVVSGTASESLYGACESMFKPDMEPEELFETISQALLSSVNRGLFKWVGPKHCYLPQIV  180

Query  557  DCLSGWGGHVYVVTPTEVTERILKGR  634
            DCLSGWGGHVYVVTPTEV ER+LKGR
Sbjct  181  DCLSGWGGHVYVVTPTEVKERLLKGR  206



>emb|CAC43324.1| putative beta 3 proteasome subunit [Nicotiana tabacum]
Length=178

 Score =   346 bits (888),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH K+F+GL+GL TDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKVFIGLSGLGTDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   LTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDC  562
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDM PEELFETISQAL+ASVDRDC
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMGPEELFETISQALIASVDRDC  178



>ref|XP_010095417.1| Proteasome subunit beta type-3-A [Morus notabilis]
 gb|EXB60109.1| Proteasome subunit beta type-3-A [Morus notabilis]
Length=693

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF++IYKIH +L+LGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKIHDRLYLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAVLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD+EPEELFE +SQAL++SV+RDCLS
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDLEPEELFEVVSQALLSSVNRDCLS  180

Query  569  GWGGH  583
            GWGGH
Sbjct  181  GWGGH  185



>ref|XP_002965476.1| hypothetical protein SELMODRAFT_266913 [Selaginella moellendorffii]
 ref|XP_002993203.1| hypothetical protein SELMODRAFT_272317 [Selaginella moellendorffii]
 gb|EFJ05723.1| hypothetical protein SELMODRAFT_272317 [Selaginella moellendorffii]
 gb|EFJ32896.1| hypothetical protein SELMODRAFT_266913 [Selaginella moellendorffii]
Length=204

 Score =   347 bits (889),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIF YNGSALVAMVGK+CFAIASDRRLGV  QT+ATDF+RI+KIH KL++GLAGLA+DV
Sbjct  1    MSIFTYNGSALVAMVGKDCFAIASDRRLGVNFQTIATDFQRIFKIHDKLYVGLAGLASDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL +RH L+QL+EERDM+PETF++ VSA LYEKRFGPYF QP+IAGLG ++KP+I
Sbjct  61   QTLYQRLKYRHNLFQLQEERDMRPETFSNFVSATLYEKRFGPYFVQPLIAGLGADNKPYI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CTMDSIGA E +KDFVV GTASESLYGACE+M+KPDMEPE+LFETISQAL++SVDRDCLS
Sbjct  121  CTMDSIGAIEHSKDFVVGGTASESLYGACESMYKPDMEPEDLFETISQALISSVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG VYVVTP +V  R LKGR
Sbjct  181  GWGGIVYVVTPDQVIVRTLKGR  202



>ref|XP_001770816.1| predicted protein [Physcomitrella patens]
 gb|EDQ64340.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   344 bits (882),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNGSAL+AMVGKNCFAIASDRRLGV  QT+A DF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSITSYNGSALIAMVGKNCFAIASDRRLGVNFQTIACDFQRIFKIHDKLYIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QT++QRL FRHKLYQLREER+M+PETFASLVSAILYEKRFGPYFC+P+IAGL D+  PFI
Sbjct  61   QTMHQRLQFRHKLYQLREERNMRPETFASLVSAILYEKRFGPYFCEPIIAGLNDDGTPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CT D IGAK+LAKDFVV+GTASESLYGACE+M+KPD+ P+ELFE ISQAL+ASVDRDC+S
Sbjct  121  CTTDLIGAKQLAKDFVVSGTASESLYGACESMYKPDLGPDELFEVISQALLASVDRDCIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+VVTP +V  + LKGR
Sbjct  181  GWGGIVHVVTPDQVITKTLKGR  202



>ref|XP_001771449.1| predicted protein [Physcomitrella patens]
 gb|EDQ63649.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   339 bits (870),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNGSAL+AMVGK+CFAIASDRRLGV  QT+A DF+RI+KIH  L++GL+GLATDV
Sbjct  1    MSITSYNGSALIAMVGKDCFAIASDRRLGVNFQTIACDFQRIFKIHDHLYIGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QT++QRL FRHKLYQLREER+M+PETFASLVSA+LYEKRFGPYFC+P+IAGL D+  PFI
Sbjct  61   QTMHQRLNFRHKLYQLREERNMRPETFASLVSAMLYEKRFGPYFCEPIIAGLNDDGTPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            CT D IGAK+LAKDFVV+GTASESLYGACE+M+KPD+ P+ELFE ISQAL+ASVDRDC+S
Sbjct  121  CTTDLIGAKQLAKDFVVSGTASESLYGACESMYKPDLGPDELFEVISQALLASVDRDCIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+VVTP +V  + LKGR
Sbjct  181  GWGGIVHVVTPNQVITKTLKGR  202



>gb|EMT12457.1| Proteasome subunit beta type-3 [Aegilops tauschii]
Length=176

 Score =   332 bits (851),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D QTLYQRLVF+HKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDAQTLYQRLVFKHKL  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVS++LYEKRFGPYFCQP+IAGLG +D+PFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSSMLYEKRFGPYFCQPIIAGLGQDDEPFICTMDCIGAKELAK  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVV  595
            DFVV+GTASESLYGACE+M+KP+MEPEELFETISQAL++SVDRDCLSGWGG+V +V
Sbjct  121  DFVVSGTASESLYGACESMYKPNMEPEELFETISQALLSSVDRDCLSGWGGYVLIV  176



>ref|XP_009601797.1| PREDICTED: proteasome subunit beta type-3-A-like [Nicotiana tomentosiformis]
Length=167

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH K+F+GL+GL TDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKVFIGLSGLGTDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   LTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDM  499
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDM
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDM  157



>gb|KJB29134.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=178

 Score =   307 bits (786),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDM  499
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK  M
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEGM  157



>ref|XP_006434245.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 gb|ESR47485.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 gb|KDO80555.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
 gb|KDO80556.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=185

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDM  499
            CTMDSIGAKELAKDFVVAGTA ESLYGACEAMFKPDM
Sbjct  121  CTMDSIGAKELAKDFVVAGTAGESLYGACEAMFKPDM  157



>ref|XP_005850127.1| hypothetical protein CHLNCDRAFT_48590 [Chlorella variabilis]
 gb|EFN58025.1| hypothetical protein CHLNCDRAFT_48590 [Chlorella variabilis]
Length=204

 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSA+VAM GK C AI SD R GVQLQT+ATD++++YKIH +LF+GLAGL TD 
Sbjct  1    MSIFEYNGSAIVAMAGKECVAIGSDLRFGVQLQTLATDYKKVYKIHDQLFIGLAGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            +TL QR  F+H LY+LREERD+KP  F  LVSA LYE+RFGPYFCQPVIAGL  +  P++
Sbjct  61   ETLSQRFAFKHNLYKLREERDIKPSAFGQLVSATLYERRFGPYFCQPVIAGLEPDGSPYL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C MDSIGA+E AKDF+VAGTA++SL G CE++++PD+ PEELFET+SQAL++  DRDCL+
Sbjct  121  CGMDSIGAQETAKDFMVAGTATDSLLGICESLWRPDLGPEELFETLSQALLSGQDRDCLA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  VYV+T  +V  R LKGR
Sbjct  181  GWGAVVYVITKDKVIARTLKGR  202



>ref|XP_005646581.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22037.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
Length=205

 Score =   296 bits (757),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNG+A+VAM GK C AI SD R GVQ QT+ATD++++YKIH KLF+GLAGL TD 
Sbjct  1    MSIFEYNGAAIVAMAGKECVAIGSDLRFGVQFQTLATDYKKVYKIHDKLFIGLAGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPF  385
            QT++Q+L FRH LY+LREER++KP TF  LVS++LYEKRFGPYF  PVIAGL D+ + P+
Sbjct  61   QTMHQKLKFRHNLYKLREERNIKPSTFGELVSSMLYEKRFGPYFVSPVIAGLEDKTNVPY  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD+IGA E A DF+VAGTA +SLYG CE+MF+PDMEPEELFET++Q L++  DRD L
Sbjct  121  ICGMDTIGAIETANDFMVAGTAPDSLYGMCESMFRPDMEPEELFETVTQCLMSGADRDAL  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VYV+T   V  R LKGR
Sbjct  181  SGWGAIVYVITKDAVVARTLKGR  203



>gb|EJK68962.1| hypothetical protein THAOC_09830 [Thalassiosira oceanica]
Length=204

 Score =   281 bits (720),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG+A++AM GK+C AIASD RLG+  QTVA DF++++K++ +L +GLAGLATDV
Sbjct  1    MSILEYNGAAIIAMAGKDCVAIASDNRLGISYQTVAMDFKKVFKMNDRLMVGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL Q L FR  LY+LREER+M PE F +L+S +LYEKRFGPYFC+PVIAGL  + KPF+
Sbjct  61   QTLDQLLRFRMNLYELREEREMTPEVFTNLMSNMLYEKRFGPYFCEPVIAGLDPKGKPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             TMD IGA+ +AKDF VAGT   ++YG CE ++KPDME EELFET++QAL+ASVDRD LS
Sbjct  121  GTMDLIGAQAMAKDFCVAGTCDGNMYGMCETLWKPDMEKEELFETLAQALLASVDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+++T   +T R LKGR
Sbjct  181  GWGGVVHIITKEGITSRELKGR  202



>ref|XP_011401184.1| Proteasome subunit beta type-3 [Auxenochlorella protothecoides]
 gb|KFM28171.1| Proteasome subunit beta type-3 [Auxenochlorella protothecoides]
Length=216

 Score =   281 bits (720),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = +2

Query  35   IFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQT  214
            IFEYNGSA++AM GK C AIASD R GVQLQT+ATD +++YKIH +LFLGL+GLA+D +T
Sbjct  15   IFEYNGSAIIAMAGKECVAIASDLRFGVQLQTLATDHKKVYKIHDQLFLGLSGLASDAET  74

Query  215  LYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICT  394
            L QR  F+H LY+LREERD+KP  FA LVSA LYEKRFGPYFCQPVIAGL  +  P++C 
Sbjct  75   LSQRFKFKHTLYKLREERDIKPSAFAQLVSATLYEKRFGPYFCQPVIAGLEPDGTPYLCG  134

Query  395  MDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGW  574
            MDSIGA E AKDF++AGTAS++L G CE++++PDM PEELFE  ++AL++   RDCL+GW
Sbjct  135  MDSIGAIETAKDFMIAGTASDALLGICESLWRPDMGPEELFEVTAEALLSGQGRDCLAGW  194

Query  575  GGHVYVVTPTEVTERILKGR  634
            G  VYV+T  ++  R LK R
Sbjct  195  GAVVYVITKDQIIARQLKER  214



>ref|XP_002679261.1| predicted protein [Naegleria gruberi]
 gb|EFC46517.1| predicted protein [Naegleria gruberi]
Length=205

 Score =   280 bits (715),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG+ +VAM GKNC AIA+D R G++ QTV TD ++I+KIH KLF+GL GLATDV
Sbjct  1    MSILEYNGAGIVAMTGKNCVAIAADTRYGIRQQTVGTDMQKIFKIHDKLFIGLNGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL-GDEDKPF  385
            QT+ ++L FR  +Y L+EERD+KP +FA+L+S ILYEKRFGP+F +PVIAGL G E+KPF
Sbjct  61   QTVNEKLKFRMNMYNLKEERDIKPSSFANLMSNILYEKRFGPWFIEPVIAGLEGPENKPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC  D IGA     +FVV+GT SE+LYG CE+++KPDMEPE+LFE ISQ L+A+VDRDC+
Sbjct  121  ICAQDLIGAPCFTDNFVVSGTCSEALYGMCESLYKPDMEPEDLFEVISQCLLAAVDRDCI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+V+TP  +T + LK R
Sbjct  181  SGWGAVVHVITPDSITTKRLKVR  203



>gb|KIY94892.1| hypothetical protein MNEG_13071 [Monoraphidium neglectum]
Length=205

 Score =   278 bits (712),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 164/203 (81%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI+ YNG+A++AM GK+C AI SD R GVQLQT+ TD++++++IH +LF+GL GLATD 
Sbjct  1    MSIYTYNGAAIIAMAGKDCVAIGSDLRFGVQLQTMTTDYKKVFQIHDRLFVGLGGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL++RLVFRH +Y+LREERDMK  TF +L+S++LYEKRFGPYF  PV+AGL  + KPF+
Sbjct  61   QTLFERLVFRHNMYKLREERDMKASTFGNLLSSMLYEKRFGPYFASPVVAGLEPDGKPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C MDSIGA E A DF+V GT SESL+G CE+M++PD+E +ELFET++Q L++ +DRD L+
Sbjct  121  CGMDSIGALETAADFIVTGTNSESLFGMCESMWRPDLEADELFETLAQCLLSGIDRDALA  180

Query  569  GWGGHVYVVTPTE-VTERILKGR  634
            GWG  VYV+   + V  R LKGR
Sbjct  181  GWGAVVYVIDKNKGVIARTLKGR  203



>emb|CEG65349.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
 emb|CEI90725.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=204

 Score =   277 bits (709),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K F+GLAGLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFKKIFKASEKTFIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL  R  F+  +Y++REERD++P+TFA +VS+ LYE+RFGPYF +PVIAGLG ++KPFI
Sbjct  61   LTLADRFRFKTNMYKMREERDVEPKTFAHMVSSTLYERRFGPYFVEPVIAGLGKDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+MD IG    AKDFVVAGTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LS
Sbjct  121  CSMDLIGCINFAKDFVVAGTAGPNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  VYV+TP EV  R LK R
Sbjct  181  GWGAVVYVITPNEVICRSLKAR  202



>gb|EWM23143.1| Proteasome, beta-type subunit, conserved site [Nannochloropsis 
gaditana]
Length=280

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 162/202 (80%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            SI EYNG A+VAMVGKNC AIASD R GVQ QTVA +F +++K+  +LF+GL+GLATD+Q
Sbjct  77   SILEYNGGAVVAMVGKNCVAIASDLRYGVQAQTVACNFPKVHKMSDRLFVGLSGLATDIQ  136

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDK-PFI  388
            TL Q L FR  LY+LREERD+KPETF++L+S ILYEKRFGPYF +P++AGL  ED  PFI
Sbjct  137  TLEQLLRFRLNLYKLREERDIKPETFSALLSHILYEKRFGPYFVEPLVAGLRAEDNTPFI  196

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
              MD IGA   AKDFVVAGT + +LYG CE+ FKPD+EPE+LFE +SQ+L+ASVDRD LS
Sbjct  197  SGMDLIGAPVFAKDFVVAGTCAANLYGLCESFFKPDLEPEQLFEVLSQSLLASVDRDALS  256

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+TP  VT R LK R
Sbjct  257  GWGAVVHVITPDGVTSRTLKAR  278



>ref|XP_001696254.1| hypothetical protein CHLREDRAFT_187099 [Chlamydomonas reinhardtii]
 gb|EDP08231.1| predicted protein [Chlamydomonas reinhardtii]
Length=204

 Score =   273 bits (698),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIF YNG+A+VAM GK C AI SD R GVQLQT+  D  ++YKIH KL+LGL+GL TD 
Sbjct  1    MSIFSYNGAAIVAMAGKECVAIGSDLRFGVQLQTMTCDTPKVYKIHDKLYLGLSGLQTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL+Q+L FRH LY+LREERDMKP TF  ++S  LYE+RFGPYF  PV+AGL  +  P++
Sbjct  61   TTLHQKLQFRHNLYKLREERDMKPSTFGHMLSNALYERRFGPYFAAPVVAGLEPDGTPYL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C MD+IGA E AKDF++ GT+ ESLYG CE+M++PDMEP+ELFET++Q L++  DRD L+
Sbjct  121  CGMDTIGAIESAKDFMITGTSPESLYGMCESMWRPDMEPDELFETVAQCLMSGCDRDALA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+T  +V  R LK R
Sbjct  181  GWGAVVHVITKDKVVSRTLKTR  202



>dbj|GAN06988.1| 20S proteasome subunit beta 3 [Mucor ambiguus]
Length=204

 Score =   273 bits (697),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++++K   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKMFKASEKTFIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL  R  F+  +Y++REER+M+P+T A +VS+ LYEKRFGPYF +P++AGLG ++KPFI
Sbjct  61   LTLADRFRFKTNMYKMREEREMEPKTLAHMVSSTLYEKRFGPYFVEPIVAGLGKDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C MD IG    AKDFVV+GTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LS
Sbjct  121  CAMDLIGCINFAKDFVVSGTAGSNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+TPTE+  R LK R
Sbjct  181  GWGAVVHVITPTEIITRTLKSR  202



>ref|XP_002946290.1| hypothetical protein VOLCADRAFT_78969 [Volvox carteri f. nagariensis]
 gb|EFJ53285.1| hypothetical protein VOLCADRAFT_78969 [Volvox carteri f. nagariensis]
Length=204

 Score =   272 bits (696),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIF YNGSA+VAM GK C AI SD R GVQ QT++ D  +++KIH KL+LGL+GL TD 
Sbjct  1    MSIFSYNGSAIVAMAGKECVAIGSDLRFGVQYQTISCDTPKVFKIHDKLYLGLSGLLTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL+Q+L+FRH LY+LREERDMKP TF  ++S  LYE+RFGPYF  PV+AGL  +  P++
Sbjct  61   QTLHQKLLFRHNLYKLREERDMKPSTFGHMLSNALYERRFGPYFAAPVVAGLEPDGTPYL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
              MD+IGA E AKDF++ GT+ ESLYG CE+M++PDMEPEELFET++Q L++  DRD L+
Sbjct  121  SGMDTIGAIETAKDFMIGGTSPESLYGMCESMWRPDMEPEELFETVAQCLMSGFDRDALA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  ++V+T  +V  R LK R
Sbjct  181  GWGAVIHVITKDKVITRTLKTR  202



>emb|CEP10278.1| hypothetical protein [Parasitella parasitica]
Length=204

 Score =   271 bits (694),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKIFKASEKTFIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL  R  F+  +Y++REER+M+P+T A +VS+ LYEKRFGPYF +PV+AGLG ++ PFI
Sbjct  61   LTLADRFRFKTNMYKMREEREMEPKTLAHMVSSTLYEKRFGPYFVEPVVAGLGKDNVPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C MD IG    AKDFVV+GTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LS
Sbjct  121  CAMDLIGCINFAKDFVVSGTAGSNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+TPTE+  R LK R
Sbjct  181  GWGAVVHVITPTEIITRTLKSR  202



>ref|XP_006679179.1| hypothetical protein BATDEDRAFT_88542 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80126.1| hypothetical protein BATDEDRAFT_88542 [Batrachochytrium dendrobatidis 
JAM81]
Length=204

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSA++AM GKNC AIA+DRR GVQ  T+ TDF++I+ I  K +LGLAGLATDV
Sbjct  1    MSIMEYNGSAIIAMAGKNCVAIAADRRFGVQALTLGTDFQKIFPITDKTYLGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL  R  ++  +Y L EER++ P+TF+ +VS+  YEKRFGPYF +P++AGL  ++ PFI
Sbjct  61   TTLKDRFRYKVNMYHLEEEREISPKTFSHMVSSTQYEKRFGPYFVEPIVAGLEKDNTPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+MD+IG    AKDFVV GTAS+ + G CE++++PD+EPEELFE ISQAL+ ++DRD +S
Sbjct  121  CSMDTIGCINFAKDFVVCGTASDQMNGMCESLWEPDLEPEELFEVISQALLNAIDRDAIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+++TPT V  R LKGR
Sbjct  181  GWGGIVHIITPTSVITRTLKGR  202



>ref|XP_002297096.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED86564.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=204

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG+A++AM GK+C  IASD R+G+  QTV+ DF++I++++ KLF+GLAGLA+DV
Sbjct  1    MSILEYNGAAIIAMSGKDCVGIASDNRMGISYQTVSMDFKKIFQMNEKLFVGLAGLASDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL Q L FR  LY+LREER+M P+ F +L+S +LYEKRFGPYF +PV+AGL + DKP++
Sbjct  61   QTLDQLLRFRMNLYELREEREMTPKVFTNLLSNMLYEKRFGPYFAEPVVAGLDENDKPYL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             TMD IGA    +DFVVAGT + +LYG CE ++K DME EELFET++QAL+ASVDRD LS
Sbjct  121  ATMDLIGATSSTEDFVVAGTCAGNLYGMCETLYKKDMEQEELFETLAQALLASVDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+++T   +  R LKGR
Sbjct  181  GWGGVVHIITKEGIISRELKGR  202



>ref|XP_008877158.1| hypothetical protein H310_12029 [Aphanomyces invadans]
 gb|ETV94395.1| hypothetical protein H310_12029 [Aphanomyces invadans]
Length=204

 Score =   270 bits (689),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AM GKNC AIASD RLGVQ QT+ATDF+++++++ K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKNCVAIASDTRLGVQGQTIATDFQKVFRLNDKTFLGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            Q++ Q L F+  +Y++REERDMK +T ++++S ++YEKRFGP+F +P++AGL D+++PF+
Sbjct  61   QSVSQLLRFKLNMYKMREERDMKAKTLSAMISNMMYEKRFGPWFVEPIVAGLTDDNQPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             +MD +G +   KD+V AGT  E+L+G CE++F+PD+EPE+LFETISQ L+++ +RD L+
Sbjct  121  SSMDCLGCEMFTKDYVCAGTMEEALHGMCESLFRPDLEPEDLFETISQCLLSACNRDALA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG VY++TP  VT ++LK R
Sbjct  181  GWGGVVYILTPQGVTTKVLKTR  202



>gb|AAT09074.1| proteasome beta subunit [Bigelowiella natans]
Length=204

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNGSA+VAMVGK+C AIASD R G+Q QT+A D ++++++  KLF+GL+GL TDV
Sbjct  1    MSILQYNGSAIVAMVGKDCVAIASDMRYGIQQQTIACDMKKVFQMGDKLFIGLSGLLTDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL Q+  F+ K+Y LRE R M+P+ F+SLVS+ LYEKRFGPYF +PV+AGL  ++ PFI
Sbjct  61   QTLKQKFDFKLKMYSLRENRPMRPKVFSSLVSSTLYEKRFGPYFVEPVVAGLDAKEGPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
              MD IGA   AKDFVV+GT S+ LYG CEA +KP+M P+ELFETISQ+L+A+VDRDCL+
Sbjct  121  AAMDLIGAPVFAKDFVVSGTTSDELYGVCEAFWKPNMGPDELFETISQSLLAAVDRDCLA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+T   VT + LK R
Sbjct  181  GWGAIVHVITKDGVTTKQLKSR  202



>ref|XP_001635037.1| predicted protein [Nematostella vectensis]
 gb|EDO42974.1| predicted protein [Nematostella vectensis]
Length=205

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG+A++AMVGKNC AIA+DRRLG+Q QTV+ DF++I+++  KLF+GL GLATDV
Sbjct  1    MSIMEYNGAAIIAMVGKNCVAIAADRRLGIQAQTVSCDFQKIFQMGEKLFVGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPF  385
            QT+  RL FR  LY+LRE R +KP+TF S+VS +LYE+RFGPYF +PVIAGL  + ++PF
Sbjct  61   QTISSRLKFRLNLYELREGRPIKPKTFLSMVSNLLYERRFGPYFVEPVIAGLDPKTNEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I +MD IG     KDFVV+GT SE +YG CE+++ PD+EP++LFETISQAL+ +VDRD +
Sbjct  121  ISSMDLIGCPMETKDFVVSGTCSEQMYGMCESLWVPDLEPDDLFETISQALLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+V+ P +VT R LK R
Sbjct  181  SGWGAVVHVIEPDKVTTRTLKAR  203



>emb|CDH60663.1| 20s proteasome subunit beta 3 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=204

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNG ++VAMVGKNC AIA+D+RLG Q  TV+T+F++I++   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKNCVAIAADKRLGQQFMTVSTEFQKIFRGAEKSFIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL +R  F+  +Y++REER+++P+T A +VS+ LYE+RFGPYF +PV+AGLG +++PFI
Sbjct  61   LTLAERFRFKINMYKMREEREIEPKTLAHMVSSTLYERRFGPYFVEPVVAGLGKDNQPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+MD IG    AKDFVV+GTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LS
Sbjct  121  CSMDLIGCINFAKDFVVSGTAGPNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+TP ++  R LKGR
Sbjct  181  GWGAVVHVITPDQIITRTLKGR  202



>gb|EPB88707.1| proteasome subunit beta type-3 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=218

 Score =   268 bits (684),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = +2

Query  38   FEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTL  217
             +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++++K   K F+GL GLATDV TL
Sbjct  1    MQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKMFKASEKTFIGLPGLATDVLTL  60

Query  218  YQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTM  397
              R  F+  +Y++REER+M+P+T A +VS+ LYEKRFGPYF +P++AGLG ++KPFIC M
Sbjct  61   ADRFRFKTNMYKMREEREMEPKTLAHMVSSTLYEKRFGPYFVEPIVAGLGKDNKPFICAM  120

Query  398  DSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWG  577
            D IG    AKDFVV+GTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LSGWG
Sbjct  121  DLIGCINFAKDFVVSGTAGSNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALSGWG  180

Query  578  GHVYVVTPTEVTERILKGR  634
              V+V+TPTE+  R LK R
Sbjct  181  AVVHVITPTEIITRTLKSR  199



>emb|CDS02721.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=204

 Score =   265 bits (678),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNG ++VAMVGKNC AIA+D+RLG Q  TV+T+F++I+K   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKNCVAIAADKRLGQQFMTVSTEFQKIFKGAEKSFIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL +R  F+  +Y++REER+++P+T A +VS+ LYE+RFGPYF +PV+AGL   ++PFI
Sbjct  61   LTLAERFRFKINMYKMREEREIEPKTLAHMVSSTLYERRFGPYFVEPVVAGLDKNNEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+MD IG    AKDFVV+GTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LS
Sbjct  121  CSMDLIGCINFAKDFVVSGTAGPNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+TP ++  R LKGR
Sbjct  181  GWGAVVHVITPDQIITRTLKGR  202



>gb|KFH62657.1| proteasome subunit beta type-3 [Mortierella verticillata NRRL 
6337]
Length=204

 Score =   265 bits (676),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG A+VAMVGKNC AIA D+RLGVQ  T++T+F++ ++   K ++GL GLATDV
Sbjct  1    MSIMEYNGGAVVAMVGKNCVAIACDKRLGVQAMTISTEFKKTFQATPKTYIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL ++  F+  +Y+L+EER+++P   A LVS+ LYE+RFGP+F +PVIAGL  E++PFI
Sbjct  61   QTLAEKFRFKVNMYRLKEEREIEPRALAHLVSSTLYERRFGPWFVEPVIAGLDKENRPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+ D IG    AKDFVV+GT S  LYG CE++++PD+EPE+LFETISQ+L+ +VDRDCLS
Sbjct  121  CSTDLIGCINFAKDFVVSGTTSNQLYGMCESLWEPDLEPEDLFETISQSLMNAVDRDCLS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V V+TP ++  R L+ R
Sbjct  181  GWGAEVTVITPEKIITRTLRSR  202



>gb|EIE91509.1| hypothetical protein RO3G_16220 [Rhizopus delemar RA 99-880]
Length=204

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K  +GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKIFKATEKTLIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL  R  F+  +Y++REER+++P+  A +VS+ LYE+RFGPYF +PVIAGL   +KPFI
Sbjct  61   ITLADRFRFKTNMYKMREEREIEPKALAHMVSSTLYERRFGPYFVEPVIAGLDKHNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+MD IG    AKDFVV+GTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LS
Sbjct  121  CSMDLIGCINFAKDFVVSGTAGPNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  VY++T TEVT R LK R
Sbjct  181  GWGAVVYIITSTEVTVRSLKSR  202



>emb|CEI98111.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=189

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K F+GLAGLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFKKIFKASEKTFIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL  R  F+  +Y++REERD++P+TFA +VS+ LYE+RFGPYF +PVIAGLG ++KPFI
Sbjct  61   LTLADRFRFKTNMYKMREERDVEPKTFAHMVSSTLYERRFGPYFVEPVIAGLGKDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+MD IG    AKDFVVAGTA  +LYG CE++++PD+EPE+LFETISQAL+ + DRD LS
Sbjct  121  CSMDLIGCINFAKDFVVAGTAGPNLYGMCESLWEPDLEPEDLFETISQALLNAQDRDALS  180

Query  569  GWGGHVYVV  595
            GWG  VYV+
Sbjct  181  GWGAVVYVM  189



>ref|XP_009824833.1| hypothetical protein H257_02748 [Aphanomyces astaci]
 gb|ETV86361.1| hypothetical protein H257_02748 [Aphanomyces astaci]
Length=204

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AM GKNC AIASD RLGVQ QT+ATDF+++++++ K FLGLAGLATDV
Sbjct  1    MSILAYNGAAVIAMAGKNCVAIASDTRLGVQGQTIATDFQKVFRLNDKTFLGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            Q++ Q L F+  +Y++REER++K +T ++L+S ++YEKRFGP+F +P++AGL ++++PF+
Sbjct  61   QSVSQLLRFKLNMYKMREEREIKAKTLSALISNLMYEKRFGPWFVEPLVAGLTEDNQPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             +MD +G +   KD+V AGT  E+L+G CE++F+PDMEPE+LFETISQ L+++ +RD L+
Sbjct  121  SSMDCLGCEMFTKDYVCAGTMEEALHGMCESLFRPDMEPEDLFETISQCLLSACNRDALA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+++TP  VT ++LK R
Sbjct  181  GWGGVVHILTPQGVTTKVLKTR  202



>emb|CBJ32446.1| conserved unknown protein [Ectocarpus siliculosus]
Length=204

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG+A++AM GKNC  I SD RLG Q QTVATDFE+I+K+  KL +GL GLATDV
Sbjct  1    MSILEYNGAAILAMTGKNCVGICSDSRLGNQAQTVATDFEKIFKMGDKLMVGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             T+ + L FR  LY+LREER++KPETF++L+S ILY+KRFGPYF +P++AGL +++ PFI
Sbjct  61   ITMKELLTFRLNLYRLREEREIKPETFSALMSHILYQKRFGPYFVEPIVAGLKEDNTPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
               D IGA  +  DFVV GT + +LYG CE+ ++PDM+ +ELFET++Q L+ SVDRD LS
Sbjct  121  SAFDLIGAPVVTDDFVVGGTCTNNLYGMCESFYRPDMDKDELFETMAQCLLTSVDRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+++TP  +  + LKGR
Sbjct  181  GWGGVVHIITPEGIMSKTLKGR  202



>gb|KDQ16840.1| hypothetical protein BOTBODRAFT_53901 [Botryobasidium botryosum 
FD-172 SS1]
Length=204

 Score =   261 bits (668),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG ++VAMVGKNC AIASD RLG Q  TVATDF++I+ +  ++FLGL GLATDV
Sbjct  1    MSIMSYNGGSVVAMVGKNCVAIASDLRLGSQALTVATDFQKIFPVTDRIFLGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL +R  FR  +Y ++EER+++PETFA LVS+ LYE+RFGPYF +PVIAGLG ++KPFI
Sbjct  61   LTLKERFRFRVNMYTIKEEREIEPETFAHLVSSTLYERRFGPYFVEPVIAGLGKDNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
               D IG   L KDF V+GTAS+ ++G  E +++PD+EPE+LFETISQ L+ +VDRD  S
Sbjct  121  AATDLIGCLTLPKDFAVSGTASDKMFGVAEGLWEPDLEPEDLFETISQTLMNAVDRDAYS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+V+TP +V  R LK R
Sbjct  181  GWGAIVHVITPDKVITRTLKSR  202



>ref|XP_002183677.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44859.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=204

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG+A++AM GK+C  IA+DRRLGVQLQTVATDF +++ +  K ++GLAGLATDV
Sbjct  1    MSILEYNGAAMIAMAGKDCVGIAADRRLGVQLQTVATDFNKVFAMGPKSYVGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL   L FR  LY+L+EER+M P T + L+S +LYEKRFGPYF +P++AGL +++KPF+
Sbjct  61   QTLKNILEFRKNLYELKEEREMSPATLSHLLSTLLYEKRFGPYFVEPIVAGLNEKNKPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
              MD IGA   A DFVV+GT + +LYG CE++++PD+EPEELFETI+QAL++SVDRD +S
Sbjct  121  SAMDLIGAPVQADDFVVSGTCTGNLYGMCESLYRPDLEPEELFETIAQALLSSVDRDAIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+++T   VT + LKGR
Sbjct  181  GWGGVVHIITKDGVTTKELKGR  202



>ref|XP_001745472.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89443.1| predicted protein [Monosiga brevicollis MX1]
Length=211

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 158/201 (79%), Gaps = 0/201 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            SI EYNGSA+VAM GK C AIA+DRRLG Q QTVATDF++++++   LF+GL GLATDVQ
Sbjct  9    SIMEYNGSAMVAMTGKGCIAIAADRRLGAQAQTVATDFQKLFQMGPTLFVGLPGLATDVQ  68

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFIC  391
            T  QRL F+ KLY+LREERD++P+   +L+S++LYEKRFGPYF +P+IAGL  + +P++ 
Sbjct  69   TFSQRLTFKLKLYKLREERDIEPKALTNLISSMLYEKRFGPYFIEPLIAGLDKDGQPYVA  128

Query  392  TMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSG  571
            + D IG      DFVV GT+S+ L+G CE+++KP+MEP+ELFE +SQAL+ + DRD L+G
Sbjct  129  STDVIGCPMETTDFVVGGTSSDQLFGMCESLYKPNMEPDELFEVVSQALLNAQDRDALAG  188

Query  572  WGGHVYVVTPTEVTERILKGR  634
            WGG V++V   +VT R L+GR
Sbjct  189  WGGVVHIVEKDKVTTRTLRGR  209



>gb|ESA23897.1| hypothetical protein GLOINDRAFT_341917 [Rhizophagus irregularis 
DAOM 181602]
Length=204

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG A+VAM GKNC AI SD+RLGVQL TV+T+F +++    K F+GL GLATD+
Sbjct  1    MSIMEYNGGAIVAMAGKNCVAIGSDKRLGVQLMTVSTEFPKVFPATDKTFIGLPGLATDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            +TL +R  F+  +Y+L EER+++P T A +VS+ LYE+RFGPYF +P+IAGL   ++PFI
Sbjct  61   RTLSERFRFKINMYKLSEEREIEPRTLAHMVSSTLYERRFGPYFVEPIIAGLDKNNQPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C MD IG    AKDFVV G+ ++SL+G CE++++PD+EPE+LFETISQ+L+ +VDRD L+
Sbjct  121  CGMDLIGCINFAKDFVVGGSTTDSLFGVCESLWEPDLEPEDLFETISQSLLNAVDRDSLA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+VVTP  V  R LK R
Sbjct  181  GWGAVVHVVTPERVITRTLKTR  202



>emb|CDY70670.1| BnaCnng69300D [Brassica napus]
Length=160

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +2

Query  218  YQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTM  397
            YQRLVFRHKLYQLREERDMKPETFASLVSAI+YEKRFGPY CQPVIAGLG++DKPFI TM
Sbjct  21   YQRLVFRHKLYQLREERDMKPETFASLVSAIIYEKRFGPYLCQPVIAGLGEDDKPFIYTM  80

Query  398  DSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWG  577
            DSIGAKELAKDFVV+GTASESLYGACEAM+KPDME EELFETISQAL++SVDRDCLSGWG
Sbjct  81   DSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLSGWG  140

Query  578  GHVYVVTPTEVTERILKGR  634
            GHVYV T  E+ ERILKGR
Sbjct  141  GHVYVNT-KEIKERILKGR  158



>ref|XP_004998595.1| proteasome subunit beta type-3 [Salpingoeca rosetta]
 gb|EGD72023.1| proteasome subunit beta type-3 [Salpingoeca rosetta]
Length=204

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSA+VAM GK C AIA+DRRLG Q QTV+TDF++++++  KLF+GL GL TD 
Sbjct  1    MSIMEYNGSAVVAMTGKECVAIAADRRLGAQAQTVSTDFQKVFQMGPKLFVGLPGLGTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             T+ QRL FR  +Y LREERD++P+T  +LVS+ LYE+RFGPYF +PV+AGL  +++P++
Sbjct  61   ITVSQRLKFRLNMYTLREERDIEPKTMINLVSSFLYERRFGPYFVEPVVAGLDSKNQPYV  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             + D IG      DFVV GT+SE LYG CE+++KPDM P++LFETISQAL+ +VDRDCL+
Sbjct  121  ASTDLIGCPMETSDFVVGGTSSEQLYGMCESLYKPDMAPDDLFETISQALMNAVDRDCLA  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+++   ++T R LK R
Sbjct  181  GWGAIVHIIEKDKITTRELKAR  202



>ref|XP_002904370.1| proteasome subunit beta type-3, putative [Phytophthora infestans 
T30-4]
 ref|XP_008909009.1| hypothetical protein PPTG_14216 [Phytophthora parasitica INRA-310]
 gb|EEY54548.1| proteasome subunit beta type-3, putative [Phytophthora infestans 
T30-4]
 gb|ETI42173.1| hypothetical protein F443_12663 [Phytophthora parasitica P1569]
 gb|ETK82199.1| hypothetical protein L915_12386 [Phytophthora parasitica]
 gb|ETL88820.1| hypothetical protein L917_12140 [Phytophthora parasitica]
 gb|ETM42081.1| hypothetical protein L914_12222 [Phytophthora parasitica]
 gb|ETN05487.1| hypothetical protein PPTG_14216 [Phytophthora parasitica INRA-310]
 gb|ETO70792.1| hypothetical protein F444_12772 [Phytophthora parasitica P1976]
 gb|ETP11913.1| hypothetical protein F441_12625 [Phytophthora parasitica CJ01A1]
 gb|ETP40027.1| hypothetical protein F442_12574 [Phytophthora parasitica P10297]
Length=204

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AM GK+C  IA D RLG+Q QTVA DF++++++  K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKDCVGIACDTRLGMQAQTVAMDFQKVFRVTDKTFLGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            Q++ Q L F+  +Y++ EERD+KP+T ++L+S ++YEKRFGP+F +PVIAGL +++KPF+
Sbjct  61   QSVSQLLKFKINMYKMNEERDIKPKTLSALLSNMMYEKRFGPWFVEPVIAGLTEDNKPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             +MD +G + + KDFVVAGT  E+LYG CE+M+KPDME E+LFET+SQ L+++ +RD LS
Sbjct  121  SSMDCLGCEMMTKDFVVAGTMEEALYGMCESMYKPDMEEEDLFETLSQCLLSACNRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+++TP  +T + L+ R
Sbjct  181  GWGAVVHIITPKGITSKKLQSR  202



>emb|CCA14375.1| proteasome subunit beta type3 putative [Albugo laibachii Nc14]
Length=204

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNGSA++AM GK+C  IA D RLG+Q QT++T+F++++++  K+FLGLAGLATDV
Sbjct  1    MSILSYNGSAIIAMAGKDCVGIACDTRLGLQAQTISTNFQKVFRVSDKIFLGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QT+ Q L F+  +Y++ EERD+KPET +S +SA++Y+KRFGP+F +PVIAGL  +++PF+
Sbjct  61   QTVSQLLKFKVNMYKMNEERDLKPETLSSYLSAMMYKKRFGPWFIEPVIAGLTADNQPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             +MD +G +   KDFVVAGT  E+LYG CE+M++PDME E+LFET+SQ L+++ +RD LS
Sbjct  121  SSMDCLGCEMKTKDFVVAGTMEEALYGMCESMYRPDMESEDLFETLSQCLLSACNRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+++TP  +  R LK R
Sbjct  181  GWGAVVHIITPKGIMSRTLKSR  202



>ref|XP_002508440.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69698.1| predicted protein [Micromonas sp. RCC299]
Length=207

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGV-QLQTVATDFERIYKIHGKLFLGLAGLATD  205
            MSI  YNG+A++AM GK C AIASD R G+ Q QT A D ++IYKIH  L++GL+GLATD
Sbjct  1    MSIMSYNGAAIIAMCGKECVAIASDLRFGINQQQTTAVDMKKIYKIHDHLYVGLSGLATD  60

Query  206  VQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED--K  379
              TL QR  FRH +Y+LRE R M+PETFA+LVS +LYEKRFGPY+ +P++AGL   +  K
Sbjct  61   QATLAQRFKFRHNMYELRESRKMRPETFANLVSTMLYEKRFGPYYAEPIVAGLDATNGYK  120

Query  380  PFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRD  559
            PFI  MD IGA     +FVV G   ESL+G CE+M+KPD+EPEELFE I+Q ++A V+RD
Sbjct  121  PFITGMDLIGAMAPTDNFVVCGNNEESLFGVCESMYKPDLEPEELFEVIAQCILAGVNRD  180

Query  560  CLSGWGGHVYVVTPTEVTERILKGR  634
            CLSGWGG V+V++  +V  R LKGR
Sbjct  181  CLSGWGGVVHVISKDKVITRTLKGR  205



>gb|KFB35883.1| hypothetical protein ZHAS_00002836 [Anopheles sinensis]
Length=205

 Score =   260 bits (664),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE+I++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKIFEINPHMYLGLVGLQTDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
             T+YQRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVYQRLLFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG   L  DFVVAGT +E LYG CE ++KPD+EP  LFE ISQALV + DRD +
Sbjct  121  ICNMDLIGCPNLPNDFVVAGTCAEQLYGMCETLWKPDLEPNNLFEVISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   ++T + LK R
Sbjct  181  SGWGATVYIIEKEKITVKKLKTR  203



>ref|XP_001651824.1| AAEL006174-PA [Aedes aegypti]
 gb|EAT42270.1| AAEL006174-PA [Aedes aegypti]
Length=205

 Score =   260 bits (664),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 154/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
             T++QRL+FR  LY++RE R+M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVHQRLLFRKNLYEVRENREMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLNPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG   +  DFVVAGT +E LYG CE ++KPD+EPE+LFE ISQALV + DRD +
Sbjct  121  ICNMDLIGCPNMPNDFVVAGTCAEQLYGMCETLWKPDLEPEKLFEVISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY+V   ++T + LK R
Sbjct  181  SGWGATVYIVEKEKLTVKKLKTR  203



>gb|ABF18140.1| 20S proteasome regulatory subunit beta type PSMB3/PUP3 [Aedes 
aegypti]
Length=205

 Score =   259 bits (663),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 154/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
             T++QRL+FR  LY++RE R+M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVHQRLLFRKNLYEVRENREMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLNPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG   +  DFVVAGT +E LYG CE ++KPD+EPE+LFE ISQALV + DRD +
Sbjct  121  ICNMDLIGCPNMPNDFVVAGTCAEQLYGMCETLWKPDLEPEKLFEVISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY+V   ++T + LK R
Sbjct  181  SGWGATVYIVEKDKLTVKKLKTR  203



>ref|XP_009536762.1| hypothetical protein PHYSODRAFT_288866 [Phytophthora sojae]
 gb|EGZ07196.1| hypothetical protein PHYSODRAFT_288866 [Phytophthora sojae]
Length=204

 Score =   259 bits (663),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AM GK+C  IA D RLG+Q QTVA DF++++++  K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKDCVGIACDTRLGMQAQTVAMDFQKVFRVTDKTFLGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            Q++ Q L F+  +Y++ EER++KP+T ++L+S+++YEKRFGP+F +PVIAGL +++KPF+
Sbjct  61   QSVSQLLKFKLNMYKMNEEREIKPKTLSALLSSMMYEKRFGPWFVEPVIAGLTEDNKPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             +MD +G + + KDFVVAGT  E+LYG CE+M+KPDME E+LFET+SQ L+++ +RD LS
Sbjct  121  SSMDCLGCEMMTKDFVVAGTMEEALYGMCESMYKPDMEEEDLFETLSQCLLSACNRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+++TP  +T + L+ R
Sbjct  181  GWGAVVHIITPKGITSKKLQSR  202



>ref|XP_011428234.1| PREDICTED: proteasome subunit beta type-3-like [Crassostrea gigas]
Length=205

 Score =   259 bits (662),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 164/203 (81%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG+A++AM G++C AIASDRR G+Q QTV+T+F++I+++  +L++GL GLATDV
Sbjct  1    MSILEYNGAAIIAMKGRDCVAIASDRRFGIQAQTVSTNFQKIFEMGPRLYIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT++QRL FR  LY+LRE R +KP+TF S+VS +LYE+RFGPYF +PVIAGL  +  +PF
Sbjct  61   QTVHQRLQFRLNLYELRENRRIKPKTFLSMVSNLLYERRFGPYFVEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I +MD IG   +  DFVV+GT SE +YG CE++++P+M+P+ELFE+ISQAL+ +VDRD +
Sbjct  121  IASMDLIGCPMVTDDFVVSGTCSEQMYGMCESVWEPNMDPQELFESISQALLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWGG V+++   +VT   LKGR
Sbjct  181  SGWGGIVHIIEKDQVTTTELKGR  203



>ref|XP_005711307.1| 20S core proteasome subunit beta [Chondrus crispus]
 emb|CDF41013.1| 20S core proteasome subunit beta [Chondrus crispus]
Length=204

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG  ++AM GK+C AIASD RLGVQL TVA D  RI+ +H KL+LGL GL TD+
Sbjct  1    MSILEYNGGCVIAMAGKDCVAIASDHRLGVQLTTVAMDATRIFPMHDKLYLGLTGLMTDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
             TL Q   FR ++Y++RE R +KP+TF++LVS+ LY KRFGPYF +PVIAGL  ++KPF+
Sbjct  61   TTLDQLFRFRLEMYEMRENRKIKPKTFSNLVSSTLYGKRFGPYFSEPVIAGLDKDNKPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C+MD +G    A DF VAGT +ESL G CE  ++P++EPE+LFET+SQ+L+A++DRDC+S
Sbjct  121  CSMDLLGCIAEADDFAVAGTCAESLLGTCETFYRPNLEPEDLFETVSQSLLAALDRDCIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V+++T   VT R L GR
Sbjct  181  GWGAVVHIITKDGVTTRELDGR  202



>ref|XP_002732675.1| PREDICTED: proteasome subunit beta type-3-like isoform X1 [Saccoglossus 
kowalevskii]
Length=205

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNGSA+VAM GK+C AIA+DRR G+Q QTV+ DF++I+++  +L+LGL GLATDV
Sbjct  1    MSIMSYNGSAVVAMKGKDCVAIAADRRFGIQAQTVSMDFQKIFEMGPRLYLGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL-GDEDKPF  385
            QT+  RL FR  LY LRE R +KP+TF S+VS +LYE+RFGPYF +P+IAGL  D  +PF
Sbjct  61   QTVSNRLKFRLNLYTLRENRKIKPKTFMSMVSNLLYERRFGPYFVEPIIAGLEPDTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVVAGT+SE LYG CE+++ PDM  EELFET+SQAL+ +VDRD L
Sbjct  121  ICSLDLIGCPMVPEDFVVAGTSSEQLYGMCESLWLPDMNSEELFETVSQALLNAVDRDAL  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            +GWG  V+++   ++T R LK R
Sbjct  181  AGWGAVVHIIEKDKITTRTLKAR  203



>gb|ETN62797.1| proteasome subunit beta type [Anopheles darlingi]
Length=205

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
             T+YQRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVYQRLIFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG   L  DFVVAGT +E LYG CE ++KP++EP+ LFE ISQALV + DRD +
Sbjct  121  ICNMDLIGCPNLPNDFVVAGTCAEQLYGMCETLWKPELEPDNLFEVISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++    +T + LK R
Sbjct  181  SGWGATVYIIEKERITVKKLKTR  203



>ref|NP_587985.1| 20S proteasome component beta 3, Pup3 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|Q9Y7T8.1|PSB3_SCHPO RecName: Full=Probable proteasome subunit beta type-3 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB40016.1| 20S proteasome component beta 3, Pup3 (predicted) [Schizosaccharomyces 
pombe]
Length=204

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG + VAM GKNC AIASD RLGVQ  ++  +F +++ +  K +LGL GLATDV
Sbjct  1    MSIMEYNGGSCVAMAGKNCVAIASDLRLGVQSISLTNNFPKVFAMGDKTYLGLTGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLY+   ++  LY+ REER ++P+TFA+LVS+ LYEKRFGPYF  PV+AG+ +++ PFI
Sbjct  61   QTLYELFRYKVNLYKFREERQIQPKTFANLVSSTLYEKRFGPYFSFPVVAGVSNDNTPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + A+DF+V+GTA+E LYG CE++++P++EP++LFETISQAL+ + DRDC+S
Sbjct  121  CGFDSIGCIDFAEDFIVSGTATEQLYGMCESVYEPNLEPDDLFETISQALLNAQDRDCIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  VYV+T  +  +R++KGR
Sbjct  181  GWGCVVYVITADKCIKRLVKGR  202



>ref|XP_646265.1| proteasome subunit beta type 3 [Dictyostelium discoideum AX4]
 sp|Q55D66.1|PSB3_DICDI RecName: Full=Proteasome subunit beta type-3 [Dictyostelium discoideum]
 gb|EAL72236.1| proteasome subunit beta type 3 [Dictyostelium discoideum AX4]
Length=205

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A + MVGKNC AIASD R G+Q QT++ DF ++Y+I+ K F+G++GL TD 
Sbjct  1    MSIMAYNGGACIVMVGKNCVAIASDLRFGIQQQTISNDFPKVYRINDKCFVGISGLVTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL-GDEDKPF  385
            QTLYQ+LVFRH LY+LREERDM P   ++L++ +LYEKRFGPYF +P+I GL G ++ PF
Sbjct  61   QTLYQKLVFRHNLYKLREERDMSPRVVSNLLTNMLYEKRFGPYFTEPLICGLEGPDNTPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I  MD IGA     DF+V GT + ++YG CE ++K DM  ++LFETISQ ++AS+DRD L
Sbjct  121  ISGMDLIGASVATDDFLVVGTMTPAMYGVCETLYKKDMNEDDLFETISQCMLASLDRDAL  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+V+TPT+V  + L GR
Sbjct  181  SGWGAIVHVITPTQVITKKLLGR  203



>gb|KDD73458.1| proteasome subunit protein, partial [Helicosporidium sp. ATCC 
50920]
Length=202

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 152/200 (76%), Gaps = 0/200 (0%)
 Frame = +2

Query  35   IFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQT  214
            I EYNG A++AM GK C AIASD RLGVQLQ +ATD++++YKIH +LFLGL+GLATD  T
Sbjct  1    ISEYNGGAIIAMAGKECVAIASDLRLGVQLQHLATDYKKVYKIHDQLFLGLSGLATDATT  60

Query  215  LYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICT  394
            L     FR+ LY+LREERD+ P  FA LVS+ LY  RFG YFCQPVIAGL  +  P++C 
Sbjct  61   LSNLFKFRYNLYKLREERDISPPAFAQLVSSTLYSHRFGSYFCQPVIAGLQADGVPYLCG  120

Query  395  MDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGW  574
            MDSIGA E AKDF+VAGT+ +SL G CE+++KP M+ +ELFET+S+A++    RDCL+GW
Sbjct  121  MDSIGAIETAKDFMVAGTSPDSLLGICESLWKPGMDEDELFETVSEAMLTGQGRDCLAGW  180

Query  575  GGHVYVVTPTEVTERILKGR  634
            G  VYV+T  ++  R LK R
Sbjct  181  GAVVYVITKDKIVGRQLKSR  200



>gb|EPX72025.1| 20S proteasome component beta 3 [Schizosaccharomyces octosporus 
yFS286]
Length=204

 Score =   257 bits (656),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG + VAM GKNC AIASD RLGVQ  ++A +F +++ +  K +LGL G A+DV
Sbjct  1    MSIMEYNGGSCVAMTGKNCVAIASDLRLGVQSISLANNFPKVFPMTDKTYLGLTGFASDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLY+   ++  +Y+ REER ++P+TFA+LVS  LYEKRFGPYF  PV+AGL  +D PFI
Sbjct  61   QTLYELFRYKVNMYKFREERQIEPKTFANLVSTSLYEKRFGPYFSFPVVAGLAKDDNPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + A DF+V+GTA+E LYG CE++++P++EPE+LFETISQAL+ + DRD +S
Sbjct  121  CGFDSIGCIDFADDFIVSGTAAEQLYGMCESVYEPNLEPEDLFETISQALLNAQDRDAIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  VY++TP +  +R++KGR
Sbjct  181  GWGCIVYIITPDKCVKRLVKGR  202



>ref|XP_321394.2| AGAP001697-PA [Anopheles gambiae str. PEST]
 ref|XP_003435908.1| AGAP001697-PB [Anopheles gambiae str. PEST]
 gb|EAA00889.2| AGAP001697-PA [Anopheles gambiae str. PEST]
 gb|EGK97505.1| AGAP001697-PB [Anopheles gambiae str. PEST]
Length=205

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
             T+YQRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVYQRLLFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG   L  DFVVAGT +E LYG CE ++KPD+E + LFE ISQALV + DRD +
Sbjct  121  ICNMDLIGCPNLPNDFVVAGTCAEQLYGMCETLWKPDLESDSLFEVISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   ++T + LK R
Sbjct  181  SGWGATVYIIEKEKITVKKLKTR  203



>ref|XP_011260355.1| PREDICTED: proteasome subunit beta type-3 [Camponotus floridanus]
Length=205

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++   LF+ L GLATD 
Sbjct  1    MSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTIMCDFQKIFEMEPHLFISLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ +RL FR  LY+L+E R + P+TF ++VS +LYEKRFGPYF +P+IAGL     +PF
Sbjct  61   QTVMERLRFRLNLYELKENRKIHPKTFTAMVSNLLYEKRFGPYFVEPIIAGLDPVTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG++ +A+DFVV GT +E LYG CE++++PD+EP ELFETISQALV + DRD +
Sbjct  121  ICNMDLIGSRNMAEDFVVGGTCTEQLYGMCESLYEPDLEPNELFETISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT+R +K R
Sbjct  181  SGWGAVVYIIEKDKVTKRTIKTR  203



>ref|XP_006685609.1| proteasome-domain-containing protein [Candida tenuis ATCC 10573]
 ref|XP_006685610.1| hypothetical protein CANTEDRAFT_113576 [Candida tenuis ATCC 10573]
 gb|EGV64803.1| proteasome-domain-containing protein [Candida tenuis ATCC 10573]
 gb|EGV64804.1| hypothetical protein CANTEDRAFT_113576 [Candida tenuis ATCC 10573]
Length=205

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = +2

Query  47   NGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQR  226
            NG + VAMVGK+C AIA D RLG Q   +A +FE+I+ I+ K+ LGL GLATDV TL + 
Sbjct  8    NGGSAVAMVGKDCVAIACDLRLGSQSLGLANNFEKIFTINDKVMLGLTGLATDVTTLNEV  67

Query  227  LVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSI  406
              F++ LY+LREER ++P+TFA+LVS+ LYEKRFGPYFC PV+AGL  E+KPFIC  D I
Sbjct  68   FRFKNNLYELREERKIEPQTFANLVSSTLYEKRFGPYFCGPVVAGLNKENKPFICGFDLI  127

Query  407  GAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHV  586
            G  + AKDF+V+GTASE LYG CE++++P++E ++LFETISQAL+ + DRD +SGWG  V
Sbjct  128  GCIDFAKDFIVSGTASEQLYGMCESLYEPNLEADDLFETISQALLNAADRDTMSGWGAVV  187

Query  587  YVVTPTEVTERILKGR  634
            YVVT   VT+R+LK R
Sbjct  188  YVVTKDSVTKRVLKTR  203



>ref|XP_007351158.1| 20S proteasome subunit beta 3 [Auricularia delicata TFB-10046 
SS5]
 gb|EJD40772.1| 20S proteasome subunit beta 3 [Auricularia delicata TFB-10046 
SS5]
Length=207

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG +++AMVGKNC AIASD RLG Q  TVAT+FE+++ +  +++LGL GLATDV
Sbjct  1    MSIMEYNGGSVIAMVGKNCVAIASDLRLGNQALTVATNFEKVFPVTDRIYLGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE---DK  379
             TL +R  +R  +Y ++EER+++PETFA LVS+ LYE+RFGPYF +PVIAGL       K
Sbjct  61   ATLRERFRYRVNMYTIKEEREIEPETFAHLVSSTLYERRFGPYFIEPVIAGLTSPARGSK  120

Query  380  PFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRD  559
            PFI   D IG    AKDFVV GTAS  L+G  E +++PD+EPEELFETISQ L+ +VDRD
Sbjct  121  PFIAATDLIGCLNFAKDFVVCGTASSKLFGVAEGLWEPDLEPEELFETISQTLLNAVDRD  180

Query  560  CLSGWGGHVYVVTPTEVTERILKGR  634
              SGWG  V+V+TP +V  R LKGR
Sbjct  181  AFSGWGAIVHVITPEKVVTRTLKGR  205



>ref|XP_008877157.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETV94396.1| hypothetical protein, variant [Aphanomyces invadans]
Length=189

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AM GKNC AIASD RLGVQ QT+ATDF+++++++ K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKNCVAIASDTRLGVQGQTIATDFQKVFRLNDKTFLGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            Q++ Q L F+  +Y++REERDMK +T ++++S ++YEKRFGP+F +P++AGL D+++PF+
Sbjct  61   QSVSQLLRFKLNMYKMREERDMKAKTLSAMISNMMYEKRFGPWFVEPIVAGLTDDNQPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             +MD +G +   KD+V AGT  E+L+G CE++F+PD+EPE+LFETISQ L+++ +RD L+
Sbjct  121  SSMDCLGCEMFTKDYVCAGTMEEALHGMCESLFRPDLEPEDLFETISQCLLSACNRDALA  180

Query  569  GWGGHVYVV  595
            GWGG VY++
Sbjct  181  GWGGVVYIL  189



>ref|XP_007377645.1| hypothetical protein SPAPADRAFT_63501 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW29879.1| hypothetical protein SPAPADRAFT_63501 [Spathaspora passalidarum 
NRRL Y-27907]
Length=206

 Score =   255 bits (652),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 154/200 (77%), Gaps = 1/200 (1%)
 Frame = +2

Query  38   FEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTL  217
            F  NG + VAMVGK+C AIASD RLG Q   V+ +FE+I+    K FLGL GLATDV TL
Sbjct  5    FSINGGSAVAMVGKDCIAIASDLRLGNQSLGVSNNFEKIFGFGDKCFLGLTGLATDVLTL  64

Query  218  YQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFICT  394
             +   F+  LY+LREER ++PET A+LVS+ LYE+RFGPYF  P++AGLG +D KPFIC 
Sbjct  65   KETFRFKTNLYKLREERSIEPETLANLVSSTLYERRFGPYFVSPIVAGLGHKDNKPFICG  124

Query  395  MDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGW  574
             DSIG  + AKDF+V+GTAS+ LYG CE++++PD+EPE+LFETISQAL+ +VDRD LSGW
Sbjct  125  FDSIGCIDFAKDFIVSGTASDQLYGMCESLYEPDLEPEQLFETISQALLNAVDRDALSGW  184

Query  575  GGHVYVVTPTEVTERILKGR  634
            G  VY+VT  +V +R+LK R
Sbjct  185  GAVVYIVTKDKVVKRVLKTR  204



>dbj|GAM19772.1| hypothetical protein SAMD00019534_029470, partial [Acytostelium 
subglobosum LB1]
Length=204

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG A++ M GKNC AIASD R G+Q QT++ +F ++Y+I+ K F+G+AGL TD 
Sbjct  1    MSIMEYNGGAVIVMTGKNCVAIASDLRYGIQHQTISNNFPKVYRINEKCFVGIAGLVTDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQ+L+FRH LY+LREERDM P+   +L++ +LYEKRFGPYF +PVI GL + +KPFI
Sbjct  61   QTLYQKLMFRHNLYKLREERDMTPQVLTNLIANMLYEKRFGPYFTEPVICGLDENNKPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
              MD IGA     DF++ GT + ++YG CE +++ DM  EELFETISQ ++++++RD +S
Sbjct  121  SGMDLIGALVSTDDFLLVGTMTPAMYGLCETLYRKDMNEEELFETISQCMLSALERDAMS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  V V+TP +V  R L GR
Sbjct  181  GWGAEVTVITPEKVFRRRLLGR  202



>ref|XP_002599453.1| hypothetical protein BRAFLDRAFT_281217 [Branchiostoma floridae]
 gb|EEN55465.1| hypothetical protein BRAFLDRAFT_281217 [Branchiostoma floridae]
Length=205

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 160/203 (79%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AMVGK+C AIA+DRR GVQ QTV+ DF++I+++  +LFLGL GLATDV
Sbjct  1    MSIMSYNGAAIIAMVGKDCVAIAADRRFGVQAQTVSMDFQKIFQMGDRLFLGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+  R+ FR  LY+LRE R +KP+TF S+VS +LYE+RFGPYF +PV+AGL  +  +PF
Sbjct  61   QTVSNRMKFRLNLYELREARQVKPKTFLSMVSNLLYERRFGPYFVEPVVAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I + D IG   + +DFVV+GT SE +YG CE++++P++EP++LFETISQAL+ + DRD +
Sbjct  121  IASCDLIGCPMIPEDFVVSGTCSEQMYGMCESLWEPNLEPDDLFETISQALLNAADRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+V+   +VT R LKGR
Sbjct  181  SGWGAVVHVIEKDKVTTRTLKGR  203



>gb|EPY49805.1| 20S proteasome component beta 3 [Schizosaccharomyces cryophilus 
OY26]
Length=204

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG + VAM GKNC AIASD RLGVQ  ++A +F +++ +  K +LGL G A+DV
Sbjct  1    MSIMEYNGGSCVAMAGKNCVAIASDLRLGVQSISLANNFPKVFPMTDKTYLGLTGFASDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLY+   ++  +Y+ REER ++P+TF +LVS  LYEKRFGPYF  PV+AGL  +D PFI
Sbjct  61   QTLYELFRYKVNMYKFREERQIEPKTFGNLVSTSLYEKRFGPYFSFPVVAGLSKDDNPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + A DF+V+GTA E LYG CE++++P++EPE+LFETISQAL+ + DRD +S
Sbjct  121  CGFDSIGCIDFADDFIVSGTAVEQLYGMCESVYEPNLEPEDLFETISQALLNAQDRDAIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  VYV+TP +  +R++KGR
Sbjct  181  GWGCLVYVITPDKCIKRLVKGR  202



>emb|CCA71352.1| probable PUP3-20S proteasome subunit beta3 [Piriformospora indica 
DSM 11827]
Length=205

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG ++VAM GK+C AIASD RLG Q  T+AT+FE+++ +  ++ LG+AGLATDV
Sbjct  1    MSIMEYNGGSVVAMAGKDCVAIASDLRLGNQALTIATNFEKVFPVTERIMLGMAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPF  385
             TL  R  FR  +Y ++EER+++PETFA LVS+ LYE+RFGPYF +PVIAGLG   +KPF
Sbjct  61   LTLRDRFRFRVNMYTIKEEREIEPETFAHLVSSTLYERRFGPYFIEPVIAGLGKGTNKPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I + D IG    AKDFVVAGTA++ L+G  E++++PD+EPE+LFETISQ L+ +VDRD  
Sbjct  121  IASTDVIGCINFAKDFVVAGTATDKLFGVAESLWEPDLEPEDLFETISQTLMNAVDRDAF  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+++TP +V  R LK R
Sbjct  181  SGWGAVVHIITPEKVITRHLKAR  203



>ref|XP_001843139.1| proteasome subunit beta type 3 [Culex quinquefasciatus]
 gb|EDS30763.1| proteasome subunit beta type 3 [Culex quinquefasciatus]
Length=205

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 150/203 (74%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE+I++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKIFEINPHMYLGLVGLQTDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
             T++QRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVHQRLLFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKSYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG      DFVVAGT +E LYG CE ++KPD+EP  LFE ISQALV + DRD +
Sbjct  121  ICNMDLIGCPNKPNDFVVAGTCAEQLYGMCETLWKPDLEPTALFEVISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   ++T + LK R
Sbjct  181  SGWGATVYIIEKEKLTVKKLKTR  203



>ref|XP_002175348.1| 20S proteasome component beta 3 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB09055.1| 20S proteasome component beta 3 [Schizosaccharomyces japonicus 
yFS275]
Length=204

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG + +AMVGK C AIASD RLG Q  ++  +F +I+ +  K +LGL GLATDV
Sbjct  1    MSIMEYNGGSCIAMVGKECVAIASDLRLGAQSVSLTNNFPKIFSMTEKTYLGLTGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTL++   ++  +Y+LREER ++P+TFA+LVS+ LYEKRF PYF  P++AGL   ++PFI
Sbjct  61   QTLHELFRYKINMYKLREERQIEPKTFANLVSSTLYEKRFAPYFTFPIVAGLSKTNEPFI  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF V+GTAS+ LYG CE +++PD+EPE+LFETISQAL+ ++DRDC+S
Sbjct  121  CGFDSIGCIDFAKDFAVSGTASDHLYGICEDLYEPDLEPEDLFETISQALLNAIDRDCIS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG  VYV++  +  +R++KGR
Sbjct  181  GWGCVVYVISKDKCMKRLVKGR  202



>ref|XP_005818424.1| proteasome subunit beta type 3 [Guillardia theta CCMP2712]
 gb|EKX31444.1| proteasome subunit beta type 3 [Guillardia theta CCMP2712]
Length=208

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 151/206 (73%), Gaps = 4/206 (2%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG  ++ M GKNC AIA D+R G Q QT+ATD  ++YK+H +LF+GLAGLATD 
Sbjct  1    MSITEYNGGCVIGMAGKNCVAIACDKRYGAQYQTLATDKTKVYKMHDQLFIGLAGLATDQ  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QT Y+RL FR  +Y LREER +KP +F  +VS +LYEKRFGPYF +PVIAGL  E+KP++
Sbjct  61   QTFYERLKFRLAMYSLREERLIKPASFGKMVSTLLYEKRFGPYFIEPVIAGLDKENKPYL  120

Query  389  CTMDSIGAKEL----AKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDR  556
             + D IGA  L       FVVAGT +E L G CE+M++ D+EPEELFET+SQ L+A  DR
Sbjct  121  FSSDFIGAPLLPDMDTNGFVVAGTCTEQLMGMCESMWRKDLEPEELFETVSQCLLAGQDR  180

Query  557  DCLSGWGGHVYVVTPTEVTERILKGR  634
            DCLSGWG  V+++ P  V  R L+GR
Sbjct  181  DCLSGWGAVVHIICPDRVITRTLRGR  206



>ref|XP_010730943.1| PREDICTED: proteasome subunit beta type-3 [Larimichthys crocea]
Length=205

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDFE+I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFEKIFPMGERLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTLEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>ref|XP_009052112.1| hypothetical protein LOTGIDRAFT_226791 [Lottia gigantea]
 gb|ESO97202.1| hypothetical protein LOTGIDRAFT_226791 [Lottia gigantea]
Length=205

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AM GK+C AIA+DRR GVQ QTV+ DF++I+++   L++GL GLATDV
Sbjct  1    MSILAYNGAAIIAMNGKDCVAIAADRRFGVQAQTVSMDFDKIFEMGPHLYIGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPF  385
            QT+ QRL FR K+Y+LRE R ++P+TF S+VS +LYE+RFGPYF +PV+AGL  +  +PF
Sbjct  61   QTVSQRLNFRLKMYELRENRRIRPKTFMSMVSNLLYERRFGPYFVEPVVAGLDPKTHQPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I +MD IG   +  DFVV+GT SE +YG CE++++P++EP++LFETISQAL+ + DRD +
Sbjct  121  IASMDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPNLEPDDLFETISQALMNAFDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT+++LK R
Sbjct  181  SGWGAVVYIIEKDKVTKKLLKTR  203



>ref|XP_011347090.1| PREDICTED: proteasome subunit beta type-3 [Cerapachys biroi]
 gb|EZA49149.1| Proteasome subunit beta type-3 [Cerapachys biroi]
Length=205

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++IYK+   L+L L GLATD 
Sbjct  1    MSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTITCDFQKIYKMGPHLYLSLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ +RL FR  LY+L+E R + P+TF ++VS +LYE+RFGPYF +P++AGL     +PF
Sbjct  61   QTVMERLRFRLNLYELKENRKIHPKTFTAMVSNLLYERRFGPYFVEPIVAGLDPVTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG++ +A+DFVV GT +E LYG CE++++ D+EPEELFET+SQALV + DRD +
Sbjct  121  ICNMDLIGSRNMAEDFVVGGTCTEQLYGMCESLYELDLEPEELFETVSQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT+R +K R
Sbjct  181  SGWGAVVYIIEKDKVTKRSIKTR  203



>ref|XP_005767557.1| hypothetical protein EMIHUDRAFT_459379 [Emiliania huxleyi CCMP1516]
 gb|EOD15128.1| hypothetical protein EMIHUDRAFT_459379 [Emiliania huxleyi CCMP1516]
Length=207

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 158/203 (78%), Gaps = 2/203 (1%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            SI +YNG+A++AM GK+C AIASD+R G++ QT+    ++I+++  K F+GL GLATD+Q
Sbjct  3    SIMQYNGAAIIAMAGKDCIAIASDKRYGIRNQTMGCQMKKIFQVGDKTFVGLTGLATDMQ  62

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED--KPF  385
            TL Q+  FR  +Y+LREER+M  E FA++V+++LYE RFGPYFC+P++AGLG ED   PF
Sbjct  63   TLDQKFRFRSNMYRLREEREMSTEAFANMVTSLLYEHRFGPYFCEPIVAGLGGEDGKSPF  122

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            +C MD +GA+   +DF+V G  +E+LYG CE+M++PD+ P+ELFE I+Q L++ VDRDCL
Sbjct  123  LCGMDLLGAQVRTEDFMVGGDCTEALYGLCESMYRPDLGPDELFEVIAQCLLSGVDRDCL  182

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            +GWG  V+V+TP  VT R LKGR
Sbjct  183  AGWGCVVHVLTPEGVTTRDLKGR  205



>gb|EPZ36546.1| putative proteasome subunit beta type-3 [Rozella allomycis CSF55]
Length=202

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 153/200 (77%), Gaps = 1/200 (1%)
 Frame = +2

Query  38   FEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTL  217
             +YNG A+VAM GK C AIASD+RLG Q  TV+T+F +++ IH KL+LGL+GLATDV TL
Sbjct  1    MQYNGGAVVAMKGKGCVAIASDKRLGQQALTVSTEFPKVFPIHDKLYLGLSGLATDVITL  60

Query  218  YQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPFICT  394
             +   ++  +Y L  ERD++P TFA++VS+ LYEKRFGPY+C+P++AGL  + ++PFIC+
Sbjct  61   SETFRYKVNMYSLNHERDIEPVTFANMVSSTLYEKRFGPYYCEPIVAGLNSKTNEPFICS  120

Query  395  MDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGW  574
            MD IG    AKDFVV GT   +LYG CE++++PD+EPEELFE +SQALV +VDRD LSGW
Sbjct  121  MDVIGCINFAKDFVVGGTCGPNLYGMCESLYEPDLEPEELFEIVSQALVNAVDRDALSGW  180

Query  575  GGHVYVVTPTEVTERILKGR  634
            G  VY++T  +V  R LK R
Sbjct  181  GAVVYIITADKVITRTLKCR  200



>gb|EFN65731.1| Proteasome subunit beta type-3 [Camponotus floridanus]
Length=286

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 162/218 (74%), Gaps = 7/218 (3%)
 Frame = +2

Query  2    RFLSSACL--RM----SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKI  163
            RF SS+ +  RM    SI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++
Sbjct  67   RFESSSAILDRMYDPQSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTIMCDFQKIFEM  126

Query  164  HGKLFLGLAGLATDVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFC  343
               LF+ L GLATD QT+ +RL FR  LY+L+E R + P+TF ++VS +LYEKRFGPYF 
Sbjct  127  EPHLFISLPGLATDTQTVMERLRFRLNLYELKENRKIHPKTFTAMVSNLLYEKRFGPYFV  186

Query  344  QPVIAGLGDED-KPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFE  520
            +P+IAGL     +PFIC MD IG++ +A+DFVV GT +E LYG CE++++PD+EP ELFE
Sbjct  187  EPIIAGLDPVTFEPFICNMDLIGSRNMAEDFVVGGTCTEQLYGMCESLYEPDLEPNELFE  246

Query  521  TISQALVASVDRDCLSGWGGHVYVVTPTEVTERILKGR  634
            TISQALV + DRD +SGWG  VY++   +VT+R +K R
Sbjct  247  TISQALVNAFDRDAISGWGAVVYIIEKDKVTKRTIKTR  284



>gb|KDR23887.1| Proteasome subunit beta type-3 [Zootermopsis nevadensis]
Length=205

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A+VAM GKNC AIA+D+R G+Q QT+A DF++I+++   LF+GL GLATD 
Sbjct  1    MSIMSYNGGAIVAMKGKNCVAIAADKRFGIQAQTLALDFQKIFEMGPHLFIGLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT++QRL FR  LY+L+E R + P+TFA++VS +LYE+RFGPYF +P+IAGL  +  +P+
Sbjct  61   QTVHQRLKFRLNLYELKENRHINPKTFAAMVSNLLYERRFGPYFIEPIIAGLDPKTFEPY  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            +C MD IG     +DFVV GT +E LYG CE +++PD+EP++LFETISQAL+++VDRD +
Sbjct  121  VCNMDLIGCPNEPEDFVVGGTCTEQLYGMCETLWEPDLEPDDLFETISQALISAVDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+++   ++T + LK R
Sbjct  181  SGWGAVVHIIEKDKITTKSLKTR  203



>ref|XP_008219607.1| PREDICTED: proteasome subunit beta type-3-A-like [Prunus mume]
Length=129

 Score =   249 bits (636),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+G++GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTVATDFKRINQVHDRLFIGISGLATDA  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDRPFI  120

Query  389  CTMDSIGAK  415
            CTMDSIGAK
Sbjct  121  CTMDSIGAK  129



>ref|XP_008606850.1| 20S proteasome subunit beta 3 [Saprolegnia diclina VS20]
 gb|EQC39578.1| 20S proteasome subunit beta 3 [Saprolegnia diclina VS20]
 gb|KDO31954.1| hypothetical protein SPRG_03169 [Saprolegnia parasitica CBS 223.65]
Length=204

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG+A++AM GK+C AIA D R+GVQ QT++TDF+++++++ K FLGL+GLATDV
Sbjct  1    MSIMAYNGAAIIAMAGKDCVAIACDTRMGVQGQTISTDFQKVFRLNDKTFLGLSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            Q++ Q L F+  +Y+++EER++K +T ++++S ++YEKRFGP+F +P++AGL  E+KPF+
Sbjct  61   QSVSQLLRFKLNMYKMQEEREIKAKTLSAMISNMMYEKRFGPWFVEPIVAGLTPENKPFL  120

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
             +MD +G +   KD+VVAGT  E+L+G CE++++PD+EPE+LFETISQ L+++ +RD LS
Sbjct  121  SSMDCLGCELFTKDYVVAGTMEEALHGMCESLYRPDLEPEDLFETISQCLLSACNRDALS  180

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWGG V+++T   VT ++LK R
Sbjct  181  GWGGVVHILTKDGVTTKVLKTR  202



>ref|XP_003400568.1| PREDICTED: proteasome subunit beta type-3-like [Bombus terrestris]
Length=205

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 152/203 (75%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++   L+L L GLATD 
Sbjct  1    MSILAYNGGAIIAMKGKNCVAIAADRRFGIQAQTITCDFQKIFEMGSHLYLSLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ ++L FR  LY+L+E R + P+TFAS+VS +LYE+RFGPYF +PVIAGL     +PF
Sbjct  61   QTVMEKLRFRLNLYELKENRKIHPKTFASMVSNLLYERRFGPYFVEPVIAGLSPVTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC +D IG    + DFVV GT SE LYG CE++F+PDMEP++LFETISQALV + DRD +
Sbjct  121  ICNVDLIGCISPSNDFVVGGTCSEQLYGMCESLFEPDMEPDDLFETISQALVNACDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT R +K R
Sbjct  181  SGWGAIVYIIEKDKVTTRTIKTR  203



>ref|XP_007258523.1| PREDICTED: proteasome subunit beta type-3-like [Astyanax mexicanus]
Length=205

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEP++LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPDDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVIVHVIEKDKITTRTLKAR  203



>gb|KIO31342.1| hypothetical protein M407DRAFT_241859 [Tulasnella calospora MUT 
4182]
Length=205

 Score =   252 bits (643),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 154/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG ++VAMVGK+C AIASD RLG Q  T+AT+FE+++ +  +L++GL GLATDV
Sbjct  1    MSIMSYNGGSIVAMVGKDCVAIASDLRLGNQALTIATNFEKVFPVTDRLYVGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL-GDEDKPF  385
             TL +R  FR  +Y ++EER+++PETFA LVS+ LYE+RFGPYF +PVIAGL    +KPF
Sbjct  61   VTLRERFRFRVNMYTIKEEREIEPETFAHLVSSTLYERRFGPYFVEPVIAGLEKGTNKPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I T D IG   L KDF VAGTAS+ L+G  E +++PD+EPE+LFETISQ L+ +VDRD  
Sbjct  121  IATTDLIGCLTLPKDFAVAGTASDKLFGVAEGLWEPDLEPEDLFETISQTLMNAVDRDAF  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+++TP +V  R LK R
Sbjct  181  SGWGAIVHLITPDQVITRTLKAR  203



>gb|ELU08769.1| hypothetical protein CAPTEDRAFT_228896 [Capitella teleta]
Length=205

 Score =   252 bits (643),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 154/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNGSA+VAM GK+C AIA+DRR G+Q QTVA DF++IY+    L++GL GLATDV
Sbjct  1    MSILSYNGSAIVAMAGKDCVAIAADRRFGIQGQTVALDFQKIYEYGPNLYMGLPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPF  385
            QT+ QRL FR  +Y+LRE R MKP+T  S+VS +LYE+RFGPYF +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRVNMYELRENRKMKPQTMLSVVSNLLYERRFGPYFVEPVIAGLDPKTSKPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            I ++D IG   + +DFV+ GT +E LYG CEA+++PDM P+ LFE +SQA+++S DRD +
Sbjct  121  IASLDLIGCPMITEDFVINGTCAEQLYGMCEALWEPDMSPDVLFEKVSQAMMSSCDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+++   +VT R LK R
Sbjct  181  SGWGVVVHIIEKDKVTTRTLKAR  203



>ref|XP_002111242.1| hypothetical protein TRIADDRAFT_50102 [Trichoplax adhaerens]
 gb|EDV27246.1| hypothetical protein TRIADDRAFT_50102 [Trichoplax adhaerens]
Length=191

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            M GKNC AIA+DRR G+Q QT+  +F+RIY +   L++G +GLATDV T+  +L FR  +
Sbjct  1    MTGKNCVAIAADRRFGIQAQTIGHEFQRIYGMSDHLYIGFSGLATDVTTVSNKLKFRLNM  60

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            Y LRE R+MKPETF SLVS++LYEKRFGPYF +PVIAGL    KPF+ ++D IG   + +
Sbjct  61   YMLRENREMKPETFMSLVSSLLYEKRFGPYFVEPVIAGLDKNAKPFVGSLDLIGCPMITE  120

Query  428  DFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVTPTE  607
            DFVV+GTASE LYG CE++++PD+E ++LFE+ISQAL+ +VDRDC+SGWGG VYV+   +
Sbjct  121  DFVVSGTASEQLYGMCESLWEPDLEADDLFESISQALLNAVDRDCVSGWGGIVYVIEKDK  180

Query  608  VTERILKGR  634
            VTE+ILK R
Sbjct  181  VTEKILKAR  189



>ref|XP_005803095.1| PREDICTED: proteasome subunit beta type-3-like [Xiphophorus maculatus]
Length=205

 Score =   251 bits (642),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++++ +  +L++GLAGLATDV
Sbjct  1    MSIMNYNGGAVMAMRGKNCVAIAADRRYGIQAQMVTTDFQKVFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+VV   ++T R LK R
Sbjct  181  SGMGVVVHVVEKDKITTRTLKAR  203



>ref|XP_011175200.1| PREDICTED: proteasome subunit beta type-3 [Solenopsis invicta]
Length=205

 Score =   251 bits (642),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++IY++   L++ L GLATD 
Sbjct  1    MSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTIMCDFQKIYEMGPHLYVSLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ +RL FR  LY+L+E R + P+TF +++S +LYEKRFGPYF +P++AGL     +PF
Sbjct  61   QTVMERLRFRLNLYELKENRKIHPKTFTAMISNLLYEKRFGPYFVEPIVAGLDPVTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG++ +A+DFVV GT +E LYG CE++++P++EP ELFET+SQALV + DRD +
Sbjct  121  ICNMDLIGSRNMAEDFVVGGTCTEQLYGMCESLYEPNLEPTELFETVSQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT+R +K R
Sbjct  181  SGWGAVVYIIEKDKVTKRTIKTR  203



>ref|XP_008292536.1| PREDICTED: proteasome subunit beta type-3 [Stegastes partitus]
Length=205

 Score =   251 bits (642),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRYGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTLEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>ref|XP_418119.2| PREDICTED: proteasome subunit beta type-3 [Gallus gallus]
Length=205

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIASDRRFGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEP+ LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMITEDFVVSGTCSEQMYGMCESLWEPDMEPDHLFETISQAMLNAVDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+++   ++T R LK R
Sbjct  181  SGMGVVVHIIEKDKITTRTLKAR  203



>ref|XP_007545257.1| PREDICTED: proteasome subunit beta type-3 [Poecilia formosa]
Length=205

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++++ +  +L++GLAGLATDV
Sbjct  1    MSIMNYNGGAVMAMRGKNCVAIAADRRYGIQAQMVTTDFQKVFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>emb|CDY40893.1| BnaCnng09840D [Brassica napus]
Length=165

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 143/192 (74%), Gaps = 32/192 (17%)
 Frame = +2

Query  68   MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  247
            MVGKNCFAIA+ R          +   R ++                   YQRLVFRHKL
Sbjct  1    MVGKNCFAIANPR----------SSLHRPFR-------------------YQRLVFRHKL  31

Query  248  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  427
            YQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFICTMDSIGAKELAK
Sbjct  32   YQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFICTMDSIGAKELAK  91

Query  428  DFVVAGTASES---LYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGGHVYVVT  598
            DFVV+GTASES    +   +A +K   E EELFETISQAL++SVDRDCLSGWGGHVYVVT
Sbjct  92   DFVVSGTASESNQIWFEIQKASYKKCNEAEELFETISQALLSSVDRDCLSGWGGHVYVVT  151

Query  599  PTEVTERILKGR  634
            P E+ ERILKGR
Sbjct  152  PNEIKERILKGR  163



>gb|KDO80554.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=181

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAK  415
            CTMDSIGAK
Sbjct  121  CTMDSIGAK  129



>ref|XP_006799729.1| PREDICTED: proteasome subunit beta type-3-like [Neolamprologus 
brichardi]
Length=214

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  10   MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  69

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  70   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  129

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEP++LFETISQA++ +VDRD +
Sbjct  130  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPDDLFETISQAMLNAVDRDAV  189

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  190  SGMGVVVHVIEKDKITTRTLKAR  212



>gb|AEB53189.1| proteasome subunit beta type 3 [Holothuria glaberrima]
Length=202

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = +2

Query  44   YNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQ  223
            YNGSA+VAM GK+C AIASDRR G+Q QTV+ + ++I+++  +L++GL+GLATDVQT+  
Sbjct  3    YNGSAIVAMRGKDCVAIASDRRFGIQAQTVSMECQKIFEMAPRLYIGLSGLATDVQTVSN  62

Query  224  RLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFICTMD  400
            RL FR  LY LRE RD+KP+TF S+V+ +LYE+RFGPYF +PVIAGL  +  +PFIC +D
Sbjct  63   RLKFRLNLYTLRENRDIKPKTFMSMVANLLYERRFGPYFTEPVIAGLDPKTFEPFICNLD  122

Query  401  SIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWGG  580
             IG   + +DFVVAGT +E LYG CE+++KPD+EP++LFETISQAL+ +VDRD +SGWG 
Sbjct  123  LIGCPMITEDFVVAGTCTEQLYGMCESLWKPDLEPDDLFETISQALLNAVDRDAVSGWGV  182

Query  581  HVYVVTPTEVTERILKGR  634
             V+V+   ++T R +K R
Sbjct  183  IVHVIEKDKITTRTVKAR  200



>ref|XP_011149990.1| PREDICTED: proteasome subunit beta type-3 [Harpegnathos saltator]
Length=205

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++IY++   L++ L GLA+D 
Sbjct  1    MSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTIMCDFQKIYEMGSHLYVSLPGLASDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPF  385
            QT+ +RL FR  LY+L+E R + P+TF +++S +LYE+RFGPYF +P++AGL     +PF
Sbjct  61   QTVMERLRFRLNLYELKENRKIHPKTFTAMISNLLYERRFGPYFVEPIVAGLDPVTSEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG++ +A+DFVV GT +E LYG CE++++PD+ PE+LFETISQALV + DRD +
Sbjct  121  ICNMDLIGSRNIAEDFVVGGTCTEQLYGMCESLYEPDLGPEDLFETISQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT+R +K R
Sbjct  181  SGWGAVVYIIEKDKVTKRTIKTR  203



>gb|EFZ21650.1| hypothetical protein SINV_15015 [Solenopsis invicta]
Length=218

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +2

Query  26   RMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATD  205
             MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++IY++   L++ L GLATD
Sbjct  13   NMSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTIMCDFQKIYEMGPHLYVSLPGLATD  72

Query  206  VQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KP  382
             QT+ +RL FR  LY+L+E R + P+TF +++S +LYEKRFGPYF +P++AGL     +P
Sbjct  73   TQTVMERLRFRLNLYELKENRKIHPKTFTAMISNLLYEKRFGPYFVEPIVAGLDPVTFEP  132

Query  383  FICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDC  562
            FIC MD IG++ +A+DFVV GT +E LYG CE++++P++EP ELFET+SQALV + DRD 
Sbjct  133  FICNMDLIGSRNMAEDFVVGGTCTEQLYGMCESLYEPNLEPTELFETVSQALVNAFDRDA  192

Query  563  LSGWGGHVYVVTPTEVTERILKGR  634
            +SGWG  VY++   +VT+R +K R
Sbjct  193  ISGWGAVVYIIEKDKVTKRTIKTR  216



>ref|NP_001040460.1| proteasome beta 3 subunit [Bombyx mori]
 gb|ABF51431.1| proteasome beta 3 subunit [Bombyx mori]
Length=205

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A+VAM G++C AIA+D+R G+Q QTV+T+F +++++   L++GL GLATD 
Sbjct  1    MSILAYNGGAVVAMKGQDCVAIATDKRFGIQAQTVSTNFPKVFQMGPTLYVGLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT++QRL FR  LY+L+E R M+P+TF++++S +LYE+RFGPYF +PVIAGL   D +P+
Sbjct  61   QTVFQRLKFRMNLYELKENRMMRPKTFSAMLSNLLYERRFGPYFIEPVIAGLDPYDNQPY  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            +C MD IG     +DFVV+GT SE LYG CEA+++P+++P+ELFETISQALV + DRD +
Sbjct  121  VCNMDLIGCPNEPEDFVVSGTCSEQLYGMCEALWEPNLKPDELFETISQALVNAADRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   ++TE+ +K R
Sbjct  181  SGWGAVVYIIEKDKITEKHVKTR  203



>ref|XP_004538793.1| PREDICTED: proteasome subunit beta type-3-like [Maylandia zebra]
 ref|XP_005746092.1| PREDICTED: proteasome subunit beta type-3-like [Pundamilia nyererei]
 ref|XP_005919306.1| PREDICTED: proteasome subunit beta type-3-like [Haplochromis 
burtoni]
Length=205

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEP++LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPDDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>ref|XP_003448021.2| PREDICTED: proteasome subunit beta type-3-like [Oreochromis niloticus]
Length=205

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   +  DFVV+GT SE +YG CE++++PDMEP++LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPDMEPDDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+VV   ++T R LK R
Sbjct  181  SGMGVVVHVVEKDKITTRTLKAR  203



>ref|XP_004085833.1| PREDICTED: proteasome subunit beta type-3 [Oryzias latipes]
Length=205

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKSFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PD+EPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDLEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>ref|XP_003695002.1| PREDICTED: proteasome subunit beta type-3-like [Apis florea]
Length=205

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++   L+L L GLATD 
Sbjct  1    MSILAYNGGAIIAMKGKNCVAIAADRRFGIQAQTITCDFQKIFEMGSHLYLSLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ ++L FR  LY+L+E R + P+ FAS+VS +LYE+RFGPYF +P+IAGL     +PF
Sbjct  61   QTVMEKLRFRLNLYELKENRKIHPKAFASMVSNLLYERRFGPYFVEPIIAGLNPNTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG    + DFVV GT SE LYG CE++++PDMEP++LFETISQALV + DRD +
Sbjct  121  ICNMDLIGCISPSNDFVVGGTCSEQLYGMCESLYEPDMEPDDLFETISQALVNACDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   ++T + LK R
Sbjct  181  SGWGAIVYIIEKDKITVKTLKTR  203



>ref|XP_010583832.1| PREDICTED: proteasome subunit beta type-3 [Haliaeetus leucocephalus]
Length=205

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   +  DFVV+GT SE +YG CE++++PDMEP+ LFETISQA++ +VDRD L
Sbjct  121  ICSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPDMEPDHLFETISQAMLNAVDRDAL  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+++   ++T R LK R
Sbjct  181  SGMGVVVHIIEKDKITTRTLKAR  203



>gb|KIW26277.1| proteasome subunit beta type-3 [Cladophialophora immunda]
Length=206

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F+ NG A VAMVGK+C AIA D RLG+Q  TV+ +F +I+     +FLGL GLATDVQ
Sbjct  3    SPFDINGGACVAMVGKDCVAIACDLRLGMQALTVSNNFPKIFNYAPSVFLGLTGLATDVQ  62

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  388
            T+     ++  +Y+LREER++ P+T A+LVS+ LYEKRFGP+F  PV+AG+     KPFI
Sbjct  63   TVSDTFRYKVNMYRLREERNISPQTLANLVSSSLYEKRFGPWFVSPVLAGINHTTGKPFI  122

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+V+GTAS+ L+G CE +++PD+EPE+LFETISQAL+ +VDRD LS
Sbjct  123  CGFDSIGCIDFAKDFIVSGTASDQLFGTCEGLWEPDLEPEDLFETISQALLNAVDRDALS  182

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  183  GWGAHVYIIEKDKVTKRLLKGR  204



>gb|KIW72067.1| proteasome subunit beta type-3 [Capronia semiimmersa]
Length=206

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F+ NG A VAMVGK+C AIA D RLG+Q  TV+ +F +I+     +FLGL GLATDVQ
Sbjct  3    SPFDINGGACVAMVGKDCVAIACDLRLGLQALTVSNNFPKIFNYAPSVFLGLTGLATDVQ  62

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  388
            T+     ++  +Y+LREER++ P+T A+LVS+ LYE+RFGP+F  PV+AG+     KPFI
Sbjct  63   TVSDTFRYKVNMYRLREERNISPQTLANLVSSSLYERRFGPWFVSPVLAGINHTTGKPFI  122

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+VAGTAS+ L+G CE +++PD+EPE+LFETISQAL+ +VDRD LS
Sbjct  123  CGFDSIGCIDFAKDFIVAGTASDQLFGTCEGLWEPDLEPEDLFETISQALLNAVDRDALS  182

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  183  GWGAHVYIIEKDKVTKRLLKGR  204



>gb|KIV94470.1| proteasome subunit beta type-3 [Exophiala mesophila]
Length=206

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F+ NG A VAMVGK+C AIA D RLG+Q  TV+ +F +I+     +FLGL GLATDVQ
Sbjct  3    SPFDINGGACVAMVGKDCVAIACDLRLGLQALTVSNNFPKIFNYAPSVFLGLTGLATDVQ  62

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  388
            T+     ++  +Y+LREER++ P+T A+LVS+ LYE+RFGP+F  PV+AG+     KPFI
Sbjct  63   TVSDTFRYKVNMYRLREERNISPQTLANLVSSSLYERRFGPWFVSPVLAGINHTTGKPFI  122

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+VAGTAS+ L+G CE +++PD+EP+ELFETISQAL+ +VDRD LS
Sbjct  123  CGFDSIGCIDFAKDFIVAGTASDQLFGTCEGLWEPDLEPDELFETISQALLNAVDRDALS  182

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  183  GWGAHVYIIEKDKVTKRLLKGR  204



>gb|KFO73083.1| Proteasome subunit beta type-3, partial [Cuculus canorus]
Length=205

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 156/202 (77%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            SI  YNG A++AM GKNC AIA+DRR G+Q QTV TDF++I+ +  +L++GLAGLATDVQ
Sbjct  2    SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQTVTTDFQKIFPMGERLYIGLAGLATDVQ  61

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPFI  388
            T+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PFI
Sbjct  62   TVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPFI  121

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C++D IG   +  DFVV+GT SE +YG CE++++PDMEP+ LFETISQA++ +VDRD +S
Sbjct  122  CSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPDMEPDHLFETISQAMLNAVDRDAIS  181

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            G G  V+V+   ++T R LK R
Sbjct  182  GMGVVVHVIEKDKITTRTLKAR  203



>ref|XP_007870227.1| 20S proteasome subunit beta 3 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ51224.1| 20S proteasome subunit beta 3 [Gloeophyllum trabeum ATCC 11539]
Length=208

 Score =   250 bits (638),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 153/206 (74%), Gaps = 4/206 (2%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG +++AMVGK C AI SD RLG Q  TVAT+FE+++ +  +++LG++GLATDV
Sbjct  1    MSIMEYNGGSVIAMVGKGCVAIGSDLRLGNQALTVATNFEKVFPVTDRIYLGMSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD----ED  376
             TL ++  FR  +Y ++EERD++PE FA LVS+ LYE+RFGPYF +PV+AGL      E 
Sbjct  61   VTLREQFRFRVNMYTIKEERDIEPEAFAHLVSSTLYERRFGPYFIEPVMAGLWKTQKGEH  120

Query  377  KPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDR  556
            KP+I   D IG    AKDFVVAGTASE L+G  E +++PD+EPE+LFETISQ L+  VDR
Sbjct  121  KPYIAAADLIGCLNFAKDFVVAGTASEKLFGVAEGLWEPDLEPEDLFETISQTLLNGVDR  180

Query  557  DCLSGWGGHVYVVTPTEVTERILKGR  634
            D  SGWG  ++V+TP +V  R LKGR
Sbjct  181  DAFSGWGAIIHVITPDKVITRTLKGR  206



>ref|XP_011065729.1| PREDICTED: proteasome subunit beta type-3 [Acromyrmex echinatior]
Length=205

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++IY++   L++ L GLATD 
Sbjct  1    MSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTITCDFQKIYEMGPHLYVSLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ +RL FR  LY+L+E R + P+TF +++S +LYE+RFGPYF +P++AGL     +PF
Sbjct  61   QTVMERLRFRLNLYELKENRKIHPKTFTAMISNLLYERRFGPYFVEPIVAGLDPVTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG++ +A+DFVV GT +E LYG CE++++P++ PEELFET+SQALV + DRD +
Sbjct  121  ICNMDLIGSRNIAEDFVVGGTCTEQLYGMCESLYEPNLGPEELFETVSQALVNAFDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT+R +K R
Sbjct  181  SGWGAVVYIIEKDKVTKRTVKTR  203



>gb|KDO80557.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=167

 Score =   248 bits (634),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  388
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  389  CTMDSIGAK  415
            CTMDSIGAK
Sbjct  121  CTMDSIGAK  129



>ref|NP_001016503.1| proteasome subunit beta type-3 [Xenopus (Silurana) tropicalis]
 gb|AAI57195.1| proteasome (prosome, macropain) subunit, beta type 3 [Xenopus 
(Silurana) tropicalis]
Length=205

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GK+C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAIMAMRGKDCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+V+ +LYE+RFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVANLLYERRFGPYYIEPVIAGLDPKTFKPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG     +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>ref|XP_009225804.1| proteasome component PUP3 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT72830.1| proteasome component PUP3 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=205

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 158/202 (78%), Gaps = 2/202 (1%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F  NG A VAMVGK+C AIA D RLG+Q  TV+ +F +I++ +G +FLGL GLATDV 
Sbjct  3    SPFSINGGAAVAMVGKDCVAIACDLRLGMQALTVSNNFPKIFQ-YGDVFLGLTGLATDVS  61

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPFI  388
            T+     ++  +Y+LREER++ P TFA+LVS+ LYE+RFGPYF  PV+AGL  +  +PFI
Sbjct  62   TVSDLFRYKVNMYRLREERNIAPRTFANLVSSSLYERRFGPYFVSPVVAGLDPKTSQPFI  121

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+V+GTASE L+G CE++++P++EPE+LFETISQAL+++VDRD LS
Sbjct  122  CGFDSIGCIDFAKDFIVSGTASEQLFGMCESLWEPNLEPEDLFETISQALLSAVDRDALS  181

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  182  GWGAHVYIIEKDKVTKRLLKGR  203



>ref|XP_003972178.1| PREDICTED: proteasome subunit beta type-3-like [Takifugu rubripes]
Length=205

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG     +DFVV+GT SE +YG CE+++ PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWGPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>ref|XP_624958.3| PREDICTED: proteasome subunit beta type-3-like [Apis mellifera]
 ref|XP_006611102.1| PREDICTED: proteasome subunit beta type-3-like isoform X2 [Apis 
dorsata]
Length=205

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++   L+L L GLATD 
Sbjct  1    MSILAYNGGAIIAMKGKNCVAIAADRRFGIQAQTITCDFQKIFEMGSHLYLSLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ ++L FR  LY+L+E R + P+ FAS+VS +LYE+RFGPYF +P+IAGL     +PF
Sbjct  61   QTVMEKLRFRLNLYELKENRKIHPKAFASMVSNLLYERRFGPYFVEPIIAGLNPNTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG    + DFVV GT +E LYG CE++++PDMEP++LFETISQALV + DRD +
Sbjct  121  ICNMDLIGCISPSNDFVVGGTCTEQLYGMCESLYEPDMEPDDLFETISQALVNACDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   ++T + LK R
Sbjct  181  SGWGAIVYIIEKDKITVKTLKTR  203



>ref|XP_003484954.1| PREDICTED: proteasome subunit beta type-3-like [Bombus impatiens]
Length=205

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 152/203 (75%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++   L+L L GLATD 
Sbjct  1    MSILAYNGGAIIAMKGKNCVAIAADRRFGIQAQTITCDFQKIFEMGSHLYLSLPGLATDT  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ ++L FR  LY+L+E R + P+TFAS+VS +LYE+RFGPYF +PVIAGL     +PF
Sbjct  61   QTVMEKLRFRLNLYELKENRKIHPKTFASMVSNLLYERRFGPYFVEPVIAGLSPVTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            +C +D IG    + DFVV GT SE LYG CE++++PDMEP++LFETISQALV + DRD +
Sbjct  121  VCNVDLIGCISPSDDFVVGGTCSEQLYGMCESLYEPDMEPDDLFETISQALVNACDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  VY++   +VT R +K R
Sbjct  181  SGWGAIVYIIEKDKVTTRTIKTR  203



>gb|KDQ53836.1| hypothetical protein JAAARDRAFT_182602 [Jaapia argillacea MUCL 
33604]
Length=208

 Score =   249 bits (637),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 153/206 (74%), Gaps = 4/206 (2%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI EYNG +++AMVGKNC A+ASD RLG Q  TVAT+FE+++ I  +++LG++GLATDV
Sbjct  1    MSIMEYNGGSVIAMVGKNCVAVASDLRLGNQALTVATNFEKVFPITDRIYLGMSGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED----  376
             TL +   +R  +Y ++EERD++PE FA LVS+ LYE+RFGP+F +PVIAGL        
Sbjct  61   TTLRETFRYRVNMYTIKEERDIEPEAFAHLVSSTLYERRFGPFFIEPVIAGLSKTSSGAF  120

Query  377  KPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDR  556
            +P+I   D IG    AKDFVVAGTASE ++G  E +++PD+EPE+LFETISQ L+ SVDR
Sbjct  121  RPYIAGADLIGCLNFAKDFVVAGTASEKMFGVAEGLWEPDLEPEDLFETISQTLLNSVDR  180

Query  557  DCLSGWGGHVYVVTPTEVTERILKGR  634
            D  SGWG  V+V+TP +V  R LK R
Sbjct  181  DAYSGWGAIVHVITPEQVITRTLKAR  206



>gb|ACO09022.1| Proteasome subunit beta type 3 [Osmerus mordax]
Length=205

 Score =   249 bits (637),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GK C A+A+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKQCVAVAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYEKRFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYEKRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEP++LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPDDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVVVHVIEKDKITTRTLKAR  203



>emb|CEJ81669.1| Putative Proteasome subunit beta type [Torrubiella hemipterigena]
Length=205

 Score =   249 bits (636),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 155/202 (77%), Gaps = 2/202 (1%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F  NG A VAMVGK+C AIA D RLG+Q  TV+ +F +I++ +G +FLGL GLATDV 
Sbjct  3    SPFSINGGACVAMVGKDCVAIACDLRLGMQALTVSNNFPKIFQ-YGDVFLGLTGLATDVN  61

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPFI  388
            T+     ++  +Y+LREER + P+TFA+LVS+ LYE+RFGPYF  PV+AGL  +  KPFI
Sbjct  62   TVSDLFRYKVNMYRLREERQIAPKTFANLVSSSLYERRFGPYFVSPVVAGLDPKTSKPFI  121

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+V+GTASE L+G CE +++PDMEP+ LFETISQAL+ +VDRD LS
Sbjct  122  CGFDSIGCIDFAKDFIVSGTASEQLFGMCEGLWEPDMEPDALFETISQALLNAVDRDALS  181

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   ++T+R+LKGR
Sbjct  182  GWGAHVYIIEKDKITKRLLKGR  203



>gb|ACI67569.1| Proteasome subunit beta type-3 [Salmo salar]
Length=205

 Score =   249 bits (636),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + KDFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTKDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V  +   ++T R LK R
Sbjct  181  SGMGVVVQAIEKDKITTRTLKAR  203



>ref|NP_001117722.1| proteasome subunit beta type-3 [Oncorhynchus mykiss]
 ref|XP_010887454.1| PREDICTED: proteasome subunit beta type-3 [Esox lucius]
 sp|O73817.1|PSB3_ONCMY RecName: Full=Proteasome subunit beta type-3; AltName: Full=Proteasome 
chain 13; AltName: Full=Proteasome component C10-II; 
AltName: Full=Proteasome theta chain [Oncorhynchus mykiss]
 gb|AAC14141.1| proteasome subunit C10-11 [Oncorhynchus mykiss]
 gb|ACO08798.1| Proteasome subunit beta type 3 [Oncorhynchus mykiss]
Length=205

 Score =   249 bits (636),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V V+   ++T R LK R
Sbjct  181  SGMGVVVQVIEKDKITTRTLKAR  203



>gb|ACH70865.1| proteasome (prosome, macropain) subunit, beta type 3 [Salmo salar]
 gb|ACI68800.1| Proteasome subunit beta type-3 [Salmo salar]
Length=205

 Score =   249 bits (636),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V V+   ++T R LK R
Sbjct  181  SGMGVIVQVIEKDKITTRTLKAR  203



>gb|AAH87457.1| Unknown (protein for MGC:99279) [Xenopus laevis]
Length=205

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GK+C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAIMAMKGKDCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+V+ +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVANLLYERRFGPYYIEPVIAGLDPKTFQPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG     +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   +VT R LK R
Sbjct  181  SGMGVVVHVIEKDKVTTRTLKAR  203



>gb|EDK40915.2| hypothetical protein PGUG_05013 [Meyerozyma guilliermondii ATCC 
6260]
Length=205

 Score =   249 bits (635),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = +2

Query  38   FEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTL  217
            F  NG A VAMVGK+C AIA D RLG Q   +A +FE+++++    FLGL GLATDV TL
Sbjct  5    FSINGGAAVAMVGKDCIAIACDTRLGSQSLGLANNFEKVFQMGKTTFLGLTGLATDVITL  64

Query  218  YQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTM  397
             +    ++ LY+LREER+M+P+T A+LVS  LYE+RFGPYF  P++AGLG   +PFIC  
Sbjct  65   REDFRLKNNLYKLREEREMEPKTLANLVSTSLYERRFGPYFVSPIVAGLGKGGQPFICGF  124

Query  398  DSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLSGWG  577
            DSIG  + AKDF+V+GTAS+ LYG CE++++P++EPE+LFETISQAL+ +VDRD LSGWG
Sbjct  125  DSIGCIDFAKDFIVSGTASDQLYGTCESLYEPNLEPEDLFETISQALLNAVDRDALSGWG  184

Query  578  GHVYVVTPTEVTERILKGR  634
              VYVVT  +V  R+L+ R
Sbjct  185  AVVYVVTKEKVVRRVLRTR  203



>ref|XP_007177581.1| PREDICTED: proteasome subunit beta type-3 [Balaenoptera acutorostrata 
scammoni]
Length=205

 Score =   249 bits (635),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   +  DFVV+GT +E +YG CE++++PDM+PE LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPDMDPEHLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  VY+V   ++T R LK R
Sbjct  181  SGMGVIVYIVEKDKITTRTLKAR  203



>ref|XP_008559789.1| PREDICTED: proteasome subunit beta type-3 [Microplitis demolitor]
Length=205

 Score =   249 bits (635),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DFE+I+++   LF+G+ GLATDV
Sbjct  1    MSILAYNGGAIIAMKGKNCVAIAADRRFGIQAQTITCDFEKIFEMGPHLFVGIPGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ +RL FR  LY+L+E R M P+TFAS+VS +LYEKRFG YF +P+I GL  E  +P+
Sbjct  61   QTVKERLRFRLNLYELKENRRMHPKTFASVVSNLLYEKRFGSYFVEPIIVGLDPETFEPY  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC MD IG     +DFVV GT  E LYG CE +++PD+EPE+LFETISQALV + DRD +
Sbjct  121  ICNMDLIGCLNEPEDFVVGGTCEEQLYGMCETVYEPDLEPEDLFETISQALVNACDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SGWG  V+++   +VT R +K R
Sbjct  181  SGWGAIVHIIEKDKVTTRTIKTR  203



>gb|KIV78159.1| proteasome subunit beta type-3 [Exophiala sideris]
Length=206

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F+ NG A VAMVGK+C AIA D RLG+Q  TV+ +F +I+     ++LGL GLATDVQ
Sbjct  3    SPFDINGGACVAMVGKDCVAIACDLRLGLQSLTVSNNFPKIFPFGPSVYLGLTGLATDVQ  62

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  388
            T+     ++  +Y+LREER++ P+T A+LVS+ LYE+RFGP+F  PV+AGL     KPFI
Sbjct  63   TVSDTFRYKVNMYRLREERNISPQTLANLVSSSLYERRFGPWFVSPVLAGLNHTTGKPFI  122

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+VAGTAS+ L+G CE +++PD+EPE+LFETISQAL+ +VDRD LS
Sbjct  123  CGFDSIGCIDFAKDFIVAGTASDQLFGTCEGLWEPDLEPEDLFETISQALLNAVDRDALS  182

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  183  GWGAHVYIIEKDKVTKRLLKGR  204



>gb|KFH45773.1| Proteasome subunit beta type-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=205

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 154/202 (76%), Gaps = 2/202 (1%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F  NG A VAMVGK+C AIA D RLG+Q  TV+ +F ++++ +G +FLGL GLATDV 
Sbjct  3    SPFSINGGACVAMVGKDCVAIACDLRLGMQALTVSNNFPKVFR-YGDVFLGLTGLATDVN  61

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLG-DEDKPFI  388
            T+     ++  +Y+LREER + P TFA+LVS+ LYE+RFGPYF  PV+AGL     +PFI
Sbjct  62   TVSDLFRYKTNMYRLREERAIAPRTFANLVSSSLYERRFGPYFVSPVVAGLDPTTSEPFI  121

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+V+GTASE L+G CE +++PD+EP+ LFETISQAL+ +VDRDCLS
Sbjct  122  CGFDSIGCIDFAKDFIVSGTASEQLFGMCEGLWEPDLEPDALFETISQALLNAVDRDCLS  181

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  182  GWGAHVYIIEKDKVTKRLLKGR  203



>gb|ADO27744.1| proteasome subunit beta type-3 [Ictalurus furcatus]
Length=205

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GK+C AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKDCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT +E +YG CE++++PDM PE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDQIGCPMITEDFVVSGTCAEQMYGMCESLWEPDMGPEDLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+V+   ++T R LK R
Sbjct  181  SGMGVIVHVIEKDKITTRTLKAR  203



>ref|XP_002796904.1| proteasome component PUP3 [Paracoccidioides sp. 'lutzii' Pb01]
Length=206

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S+F+ NG A VAM+GK+C AIA D RLG+Q  TV+ +F +I+      +LGL GLATDV 
Sbjct  3    SVFDINGGACVAMIGKDCVAIACDLRLGLQALTVSNNFPKIFNYAPSTYLGLTGLATDVS  62

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  388
            T+   L F+  +Y+LREER + P+T A+LVS+ LYEKRFGPYF  PV+AG+ +   +PFI
Sbjct  63   TVSDVLRFKVNMYRLREERQISPQTLANLVSSSLYEKRFGPYFVSPVLAGINNTTGEPFI  122

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+V+GTASE L+G CE +++PD+ PE+LFETISQAL+ +VDRD LS
Sbjct  123  CGFDSIGCIDFAKDFIVSGTASEQLFGTCEGLWEPDLGPEDLFETISQALLNAVDRDALS  182

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  183  GWGAHVYIIEKDKVTKRLLKGR  204



>ref|XP_780413.3| PREDICTED: proteasome subunit beta type-3-like [Strongylocentrotus 
purpuratus]
Length=205

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNGSA+VAM+GK+C  IASDRR GVQ QTV+ + ++I+ +  +L+LGL+GLATD+
Sbjct  1    MSIMSYNGSAVVAMIGKDCVGIASDRRFGVQAQTVSMNAQKIFTMGPRLYLGLSGLATDI  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
             T+  RL FR  LY LRE RD+KPETF S+VS +LYE+RFGPYF +PVIAGL  +  KPF
Sbjct  61   TTVSNRLKFRLNLYTLRENRDVKPETFMSMVSNLLYERRFGPYFIEPVIAGLDPKTYKPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC +D IG      DFVVAGT +E LYG CE+++ PD+ P++LFET+SQ L+ +VDRD L
Sbjct  121  ICNLDLIGCPMFTDDFVVAGTCTEQLYGMCESVWVPDLAPDDLFETLSQGLLNAVDRDAL  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            +GWG  V+++   +VT R +K R
Sbjct  181  AGWGVVVHIIEKDKVTTREVKAR  203



>gb|EMF10284.1| N-terminal nucleophile aminohydrolase [Sphaerulina musiva SO2202]
Length=206

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            S F  NG A VAMVGK+C AIA D RLG+Q  TV+ +F +I+      +LGL GLATDV 
Sbjct  3    SPFSINGGACVAMVGKDCVAIACDLRLGLQALTVSNNFPKIFPFGSSTYLGLTGLATDVS  62

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  388
            T+ +   ++  +Y+LREERD+ P TFA+LVS+ LYEKRFGP+F  PV+AGL  +  KPFI
Sbjct  63   TVSELFRYKVNMYRLREERDISPRTFANLVSSSLYEKRFGPWFISPVVAGLDSKTGKPFI  122

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C  DSIG  + AKDF+VAGTAS+ L+G CE +++PD+ PE+LFET+SQAL+++VDRD LS
Sbjct  123  CGFDSIGCIDFAKDFIVAGTASDQLFGTCEGLWEPDLGPEDLFETMSQALLSAVDRDALS  182

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            GWG HVY++   +VT+R+LKGR
Sbjct  183  GWGAHVYIIEKDKVTKRLLKGR  204



>gb|KFM04559.1| Proteasome subunit beta type-3, partial [Aptenodytes forsteri]
Length=205

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 155/202 (77%), Gaps = 1/202 (0%)
 Frame = +2

Query  32   SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  211
            SI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDVQ
Sbjct  2    SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQVVTTDFQKIFPMGERLYIGLAGLATDVQ  61

Query  212  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPFI  388
            T+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PFI
Sbjct  62   TVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPFI  121

Query  389  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCLS  568
            C++D IG   +  DFVV+GT SE +YG CE++++PDMEP+ LFETISQA++ +VDRD +S
Sbjct  122  CSLDLIGCPMITNDFVVSGTCSEQMYGMCESLWEPDMEPDHLFETISQAMLNAVDRDAIS  181

Query  569  GWGGHVYVVTPTEVTERILKGR  634
            G G  V+++   ++T R LK R
Sbjct  182  GMGVVVHIIEKDKITTRTLKAR  203



>gb|KJE95802.1| proteasome subunit beta type-3 [Capsaspora owczarzaki ATCC 30864]
Length=231

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 157/216 (73%), Gaps = 5/216 (2%)
 Frame = +2

Query  2    RFLSSACLR----MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHG  169
            R LS  C+     MSI  YNG++++AM GK C AIA+DRR G+Q QTV+TDF++ +K+  
Sbjct  14   RLLSRFCIEFSVAMSILAYNGASIIAMKGKGCVAIAADRRFGIQAQTVSTDFQKTFKMGD  73

Query  170  KLFLGLAGLATDVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQP  349
            +LF+GLAGLATDVQT+  +L FR  +Y LREER + PETF ++V+ +LYEKRFGP+F +P
Sbjct  74   RLFIGLAGLATDVQTVASKLQFRVNMYHLREERSVAPETFMNIVANVLYEKRFGPFFIEP  133

Query  350  VIAGLGD-EDKPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETI  526
            VIAGL     +PF+   D IG  ++A DF V GTASE LYG CE+M++P++EPE+LFE +
Sbjct  134  VIAGLDPVSGEPFVAATDLIGCPDVADDFAVVGTASEQLYGMCESMYEPNLEPEDLFEVV  193

Query  527  SQALVASVDRDCLSGWGGHVYVVTPTEVTERILKGR  634
            SQ L+   DRD +SGWG  V+++   +VT R LK R
Sbjct  194  SQCLMNGCDRDAISGWGAVVHIIEKDKVTTRTLKAR  229



>ref|XP_005301900.1| PREDICTED: proteasome subunit beta type-3 [Chrysemys picta bellii]
Length=205

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM GKNC AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+T  S+V+ +LYEKRFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTLMSMVANLLYEKRFGPYYTEPVIAGLDPVTYEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   +  DFVV+GT SE +YG CE++++PDMEP+ LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPDMEPDHLFETISQAMLNAVDRDAV  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V+++   ++T R LK R
Sbjct  181  SGMGVVVHIIEKDKITTRTLKAR  203



>gb|ACO08764.1| Proteasome subunit beta type 3 [Oncorhynchus mykiss]
Length=205

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  29   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  208
            MSI  YNG A++AM G+ C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGQQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  209  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  385
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  386  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPDMEPEELFETISQALVASVDRDCL  565
            IC++D IG   + +DFVV+GT SE +YG CE++++PDMEPE+LFETISQA++ +VDRD +
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAI  180

Query  566  SGWGGHVYVVTPTEVTERILKGR  634
            SG G  V V+   ++T R LK R
Sbjct  181  SGMGVVVQVIEKDKITARTLKAR  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125