BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028M03

Length=361
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...    137   5e-36   Sesamum indicum [beniseed]
gb|AEO13833.1|  thiazole biosynthetic protein                           127   2e-34   Camellia sinensis [black tea]
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg                132   3e-34   Erythranthe guttata [common monkey flower]
gb|ABI84250.1|  thiamine biosynthetic enzyme                            128   5e-34   Arachis hypogaea [goober]
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g             129   2e-33   Phaseolus vulgaris [French bean]
ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...    129   3e-33   Sesamum indicum [beniseed]
emb|CDO99712.1|  unnamed protein product                                129   3e-33   Coffea canephora [robusta coffee]
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                   128   4e-33   Citrus sinensis [apfelsine]
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic          128   6e-33   Citrus sinensis [apfelsine]
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                   128   6e-33   Citrus sinensis [apfelsine]
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg             128   6e-33   Citrus clementina [clementine]
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic             128   8e-33   Gossypium arboreum [tree cotton]
gb|ACV52582.1|  thiazole biosynthetic enzyme                            123   1e-32   Nicotiana benthamiana
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...    127   3e-32   Vitis vinifera
gb|KJB67127.1|  hypothetical protein B456_010G176000                    125   1e-31   Gossypium raimondii
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...    125   1e-31   Solanum lycopersicum
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein      124   3e-31   Nicotiana tabacum [American tobacco]
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...    124   3e-31   Nicotiana sylvestris
gb|KJB57702.1|  hypothetical protein B456_009G176400                    123   3e-31   Gossypium raimondii
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...    124   4e-31   Fragaria vesca subsp. vesca
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...    123   5e-31   Nicotiana tomentosiformis
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...    123   5e-31   Prunus mume [ume]
gb|KJB57700.1|  hypothetical protein B456_009G176400                    123   6e-31   Gossypium raimondii
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...    123   7e-31   Cucumis sativus [cucumbers]
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...    123   7e-31   Cucumis melo [Oriental melon]
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...    121   3e-30   Fragaria vesca subsp. vesca
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg             121   3e-30   Citrus clementina [clementine]
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...    121   3e-30   Citrus sinensis [apfelsine]
gb|AFM35683.1|  thiamin biosynthetic protein                            120   5e-30   Vitis pseudoreticulata
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic             120   7e-30   Gossypium arboreum [tree cotton]
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...    120   8e-30   Vitis vinifera
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg             119   1e-29   Prunus persica
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                       119   3e-29   
gb|EPS63253.1|  hypothetical protein M569_11533                         118   3e-29   Genlisea aurea
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g             118   4e-29   Populus trichocarpa [western balsam poplar]
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...    118   4e-29   Glycine max [soybeans]
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...    118   4e-29   Cicer arietinum [garbanzo]
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...    118   4e-29   Populus euphratica
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...    117   8e-29   Solanum tuberosum [potatoes]
gb|KEH43920.1|  thiazole biosynthetic enzyme                            117   8e-29   Medicago truncatula
gb|AFK44470.1|  unknown                                                 117   9e-29   Medicago truncatula
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...    117   9e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...    117   1e-28   
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    117   1e-28   
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...    116   1e-28   Glycine max [soybeans]
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...    115   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...    115   5e-28   
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg                114   9e-28   Erythranthe guttata [common monkey flower]
gb|AAW66657.1|  thiamine biosynthetic enzyme                            114   9e-28   Picrorhiza kurrooa
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g             113   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    113   2e-27   Populus euphratica
ref|XP_010105570.1|  Thiamine thiazole synthase 2                       113   3e-27   
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...    113   4e-27   Tarenaya hassleriana [spider flower]
emb|CDY42479.1|  BnaA10g08550D                                          111   4e-27   Brassica napus [oilseed rape]
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g             112   6e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...    112   7e-27   Brassica rapa
gb|AFK49632.1|  unknown                                                 111   1e-26   Lotus japonicus
emb|CDY52570.1|  BnaC03g71780D                                          111   1e-26   Brassica napus [oilseed rape]
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...    111   2e-26   Ricinus communis
gb|ADG27845.1|  thiazole biosynthetic enzyme                            110   2e-26   Gossypium hirsutum [American cotton]
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...    110   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB13600.1|  hypothetical protein B456_002G083700                    110   4e-26   Gossypium raimondii
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614             109   5e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...    109   6e-26   Brachypodium distachyon [annual false brome]
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...    109   7e-26   Camelina sativa [gold-of-pleasure]
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...    109   8e-26   Alnus glutinosa
gb|KDP39066.1|  hypothetical protein JCGZ_00823                         108   1e-25   Jatropha curcas
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         108   1e-25   Triticum urartu
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         108   1e-25   
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...    108   1e-25   Camelina sativa [gold-of-pleasure]
emb|CDY47441.1|  BnaC09g31160D                                          108   1e-25   Brassica napus [oilseed rape]
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...    108   1e-25   
gb|ACF85034.1|  unknown                                                 107   2e-25   Zea mays [maize]
emb|CDY43024.1|  BnaA03g11710D                                          107   2e-25   Brassica napus [oilseed rape]
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...    107   3e-25   Brassica rapa
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic             107   3e-25   Gossypium arboreum [tree cotton]
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...    107   3e-25   Populus euphratica
gb|AFG52195.1|  hypothetical protein UMN_CL97Contig1_06                 101   4e-25   Pinus taeda
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...    108   5e-25   
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic             106   5e-25   Genlisea aurea
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                     108   5e-25   Eucalyptus grandis [rose gum]
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg             106   6e-25   Eutrema salsugineum [saltwater cress]
gb|AEW09378.1|  hypothetical protein UMN_CL97Contig1_06                 100   9e-25   Pinus radiata
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...    106   1e-24   Cicer arietinum [garbanzo]
gb|AFK49080.1|  unknown                                                 103   1e-24   Medicago truncatula
gb|AGT17015.1|  thiazole biosynthetic enzyme                            105   2e-24   Saccharum hybrid cultivar R570
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family                105   2e-24   Saccharum hybrid cultivar R570
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family                105   2e-24   Saccharum hybrid cultivar R570
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family                105   2e-24   Saccharum hybrid cultivar R570
ref|NP_200288.1|  thiazole biosynthetic enzyme                          105   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767548.1|  predicted protein                                  105   2e-24   
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...    105   2e-24   Setaria italica
ref|XP_001755171.1|  predicted protein                                  105   3e-24   
gb|ACN36998.1|  unknown                                                 103   3e-24   Zea mays [maize]
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family                104   3e-24   Saccharum hybrid cultivar R570
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290          104   3e-24   Amborella trichopoda
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...    104   3e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...    104   3e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...    104   4e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...    104   5e-24   Setaria italica
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...    103   6e-24   Cicer arietinum [garbanzo]
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg             103   6e-24   Capsella rubella
gb|AHA84206.1|  thiamin biosynthetic enzyme                             103   6e-24   Phaseolus vulgaris [French bean]
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g             103   6e-24   Phaseolus vulgaris [French bean]
ref|XP_001767495.1|  predicted protein                                  103   6e-24   
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...    103   7e-24   
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...    103   8e-24   Theobroma cacao [chocolate]
dbj|BAA88225.1|  thiamin biosynthetic enzyme                            103   8e-24   Glycine max [soybeans]
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                       103   8e-24   Medicago truncatula
ref|NP_001236812.1|  thiamin biosynthetic enzyme                        103   9e-24   Glycine max [soybeans]
ref|XP_001753819.1|  predicted protein                                  103   9e-24   
ref|XP_001753698.1|  predicted protein                                  103   1e-23   
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002             103   1e-23   Selaginella moellendorffii
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429             103   1e-23   
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...    102   1e-23   Brassica rapa
emb|CDY28754.1|  BnaA02g09460D                                          102   1e-23   Brassica napus [oilseed rape]
gb|AFO59577.1|  thiamine biosynthetic enzyme                            102   1e-23   Saccharum hybrid cultivar GT28
gb|ABK22862.1|  unknown                                                 102   2e-23   Picea sitchensis
gb|ABK23376.1|  unknown                                                 102   2e-23   Picea sitchensis
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                    102   2e-23   
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...    102   2e-23   Zea mays [maize]
gb|ACF87708.1|  unknown                                                 102   3e-23   Zea mays [maize]
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...    102   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                    102   3e-23   Arabis alpina [alpine rockcress]
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060          102   3e-23   Sorghum bicolor [broomcorn]
gb|AFK46185.1|  unknown                                                 102   3e-23   Medicago truncatula
dbj|BAA88226.1|  thiamin biosynthetic enzyme                            101   4e-23   Glycine max [soybeans]
ref|NP_001236824.1|  thiamin biosynthetic enzyme                        101   4e-23   
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520          101   5e-23   Sorghum bicolor [broomcorn]
dbj|BAC79982.1|  putative thiamine biosynthesis protein                 100   7e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...    100   7e-23   Oryza brachyantha
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...    100   9e-23   Phoenix dactylifera
ref|NP_001059841.1|  Os07g0529600                                       100   9e-23   
gb|EAZ04139.1|  hypothetical protein OsI_26282                          100   1e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAC45141.1|  putative thiamine biosynthesis protein                 100   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008336996.1|  PREDICTED: thiamine thiazole synthase, chlor...  97.4    1e-22   
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8           100   1e-22   Oryza sativa Indica Group [Indian rice]
gb|AFK48432.1|  unknown                                                 100   2e-22   Lotus japonicus
gb|AAV92535.1|  thiazole biosynthetic enzyme                          99.8    2e-22   Pseudotsuga menziesii var. menziesii
gb|AAV92538.1|  thiazole biosynthetic enzyme                          99.8    2e-22   Pseudotsuga menziesii var. menziesii
gb|AAV92529.1|  thiazole biosynthetic enzyme                          99.8    2e-22   Pseudotsuga menziesii var. menziesii
gb|AAV92531.1|  thiazole biosynthetic enzyme                          99.8    2e-22   Pseudotsuga menziesii var. menziesii
gb|AAV92539.1|  thiazole biosynthetic enzyme                          99.8    2e-22   Pseudotsuga menziesii var. menziesii
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...  99.8    2e-22   Phoenix dactylifera
gb|AAV92537.1|  thiazole biosynthetic enzyme                          99.8    2e-22   Pseudotsuga menziesii var. menziesii
gb|AAV92554.1|  thiazole biosynthetic enzyme                          99.8    2e-22   Pseudotsuga menziesii var. menziesii
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...  99.4    3e-22   
gb|AAV92552.1|  thiazole biosynthetic enzyme                          99.4    3e-22   Pseudotsuga menziesii var. menziesii
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...  98.2    5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...  98.2    7e-22   Elaeis guineensis
emb|CBI23176.3|  unnamed protein product                              97.8    9e-22   Vitis vinifera
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg           97.1    2e-21   
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                 97.1    2e-21   Citrus sinensis [apfelsine]
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic           91.3    1e-19   Mortierella verticillata NRRL 6337
ref|XP_001754158.1|  predicted protein                                88.6    8e-19   
emb|CDM85402.1|  unnamed protein product                              89.0    1e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004496859.1|  PREDICTED: thiamine thiazole synthase, chlor...  87.0    7e-18   Cicer arietinum [garbanzo]
ref|XP_005648929.1|  thiazole biosynthetic enzyme                     82.4    2e-16   Coccomyxa subellipsoidea C-169
gb|EPB86412.1|  thiazole biosynthetic enzyme, chloroplastic           79.3    3e-15   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN03507.1|  thiamin biosynthetic enzyme                          78.6    6e-15   Mucor ambiguus
emb|CEI86767.1|  Putative Thiamine thiazole synthase                  76.6    1e-14   Rhizopus microsporus
emb|CEG62855.1|  Putative Thiamine thiazole synthase                  76.6    2e-14   Rhizopus microsporus
emb|CEG76808.1|  Putative Thiamine thiazole synthase                  76.3    2e-14   Rhizopus microsporus
emb|CEI86769.1|  Putative Thiamine thiazole synthase                  76.6    2e-14   Rhizopus microsporus
gb|EIE83081.1|  thiazole biosynthetic enzyme, chloroplastic           76.6    3e-14   Rhizopus delemar RA 99-880
gb|EYU27823.1|  hypothetical protein MIMGU_mgv1a009995mg              75.5    8e-14   Erythranthe guttata [common monkey flower]
ref|XP_007794010.1|  putative thiazole biosynthetic enzyme protein    75.5    9e-14   
gb|KCW75370.1|  hypothetical protein EUGRSUZ_E04118                   74.7    9e-14   Eucalyptus grandis [rose gum]
emb|CDY41008.1|  BnaA02g27980D                                        74.7    1e-13   Brassica napus [oilseed rape]
ref|XP_002784437.1|  conserved hypothetical protein                   75.1    1e-13   Perkinsus marinus ATCC 50983
emb|CEP18429.1|  hypothetical protein                                 73.9    3e-13   Parasitella parasitica
gb|KDO30626.1|  hypothetical protein SPRG_04526                       73.6    5e-13   Saprolegnia parasitica CBS 223.65
ref|XP_002172093.1|  thiazole biosynthetic enzyme                     72.8    8e-13   Schizosaccharomyces japonicus yFS275
gb|ABK95834.1|  unknown                                               72.0    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009844132.1|  thiazole biosynthesis enzyme                     72.4    1e-12   Aphanomyces astaci
emb|CBI23938.3|  unnamed protein product                              70.9    2e-12   Vitis vinifera
ref|XP_008616182.1|  thiamine biosynthetic enzyme                     72.0    2e-12   Saprolegnia diclina VS20
gb|KID99833.1|  thiazole biosynthetic enzyme variant 1                71.6    2e-12   Metarhizium majus ARSEF 297
ref|XP_007821738.1|  thiazole biosynthetic enzyme variant 1           71.6    2e-12   Metarhizium robertsii ARSEF 23
emb|CDP05793.1|  unnamed protein product                              70.9    3e-12   Coffea canephora [robusta coffee]
ref|XP_008877253.1|  thiazole biosynthetic enzyme, chloroplastic,...  71.2    3e-12   Aphanomyces invadans
emb|CAA57779.1|  nmt2                                                 70.9    3e-12   Schizosaccharomyces pombe
ref|NP_596642.1|  thiazole biosynthetic enzyme                        70.9    4e-12   Schizosaccharomyces pombe
ref|XP_001904665.1|  hypothetical protein                             70.1    4e-12   Podospora anserina S mat+
gb|ESW99744.1|  Thiamine thiazole synthase                            70.1    6e-12   Ogataea parapolymorpha DL-1
gb|KID90425.1|  thiazole biosynthetic enzyme variant 1                70.1    7e-12   Metarhizium guizhouense ARSEF 977
ref|XP_005834399.1|  putative THI4, thiamine                          70.1    9e-12   Guillardia theta CCMP2712
emb|CAH25337.1|  thiazole biosynthetic enzyme                         70.1    9e-12   Guillardia theta
ref|XP_007807526.1|  thiazole biosynthetic enzyme variant 1           70.1    1e-11   Metarhizium acridum CQMa 102
gb|EPB91714.1|  thiazole biosynthetic enzyme, chloroplastic           69.7    1e-11   Mucor circinelloides f. circinelloides 1006PhL
gb|KIW79545.1|  thiamine thiazole synthase                            69.7    1e-11   Fonsecaea pedrosoi CBS 271.37
ref|XP_005847930.1|  hypothetical protein CHLNCDRAFT_22703            68.9    1e-11   Chlorella variabilis
emb|CDP29968.1|  Putative mitochondrial thiazole biosynthetic enz...  69.7    1e-11   Podospora anserina S mat+
ref|XP_007591792.1|  thiazole biosynthetic enzyme                     69.3    1e-11   
ref|XP_001698672.1|  full-length thiazole biosynthetic enzyme         69.7    2e-11   Chlamydomonas reinhardtii
ref|XP_002541542.1|  thiazole biosynthesis enzyme                     69.3    2e-11   Uncinocarpus reesii 1704
gb|EIF46156.1|  thiazole biosynthetic enzyme                          68.9    2e-11   Brettanomyces bruxellensis AWRI1499
ref|XP_004198891.1|  Piso0_002284                                     68.9    2e-11   
ref|XP_006666857.1|  thiazole biosynthetic enzyme                     68.9    2e-11   Cordyceps militaris CM01
ref|XP_008026201.1|  hypothetical protein SETTUDRAFT_177413           68.9    3e-11   Exserohilum turcica Et28A
gb|AAF25444.1|AF217503_1  putative thiazole synthase                  68.6    3e-11   Aspergillus oryzae
ref|XP_001267966.1|  thiazole biosynthesis enzyme                     68.6    3e-11   Aspergillus clavatus NRRL 1
gb|ABR01228.1|  thiazole biosynthetic enzyme                          68.6    3e-11   Chlorella vulgaris
ref|XP_004199741.1|  Piso0_002284                                     68.2    4e-11   
ref|XP_001247344.1|  thiazole biosynthetic enzyme, mitochondrial ...  68.2    4e-11   
ref|XP_009853231.1|  hypothetical protein NEUTE1DRAFT_95662           68.6    4e-11   Neurospora tetrasperma FGSC 2508
gb|EFW21941.1|  thiazole biosynthetic enzyme                          68.2    4e-11   Coccidioides posadasii str. Silveira
gb|KDB14289.1|  thiazole biosynthetic enzyme variant 1                68.2    4e-11   Ustilaginoidea virens
ref|XP_003066032.1|  thiazole biosynthetic enzyme, mitochondrial ...  68.2    4e-11   Coccidioides posadasii C735 delta SOWgp
ref|XP_007586590.1|  putative thiazole biosynthetic enzyme protein    68.2    4e-11   
gb|ABN45968.1|  thiazole biosynthetic enzyme variant 1                68.2    4e-11   Epichloe typhina
ref|XP_003005955.1|  STI35 protein                                    67.4    5e-11   Verticillium alfalfae VaMs.102
gb|KHN95056.1|  thiazole biosynthetic enzyme variant 1                67.8    6e-11   Metarhizium album ARSEF 1941
ref|XP_002419419.1|  thiamine biosynthesis enzyme, putative; thia...  68.2    6e-11   Candida dubliniensis CD36
ref|XP_009648318.1|  STI35 protein                                    67.8    6e-11   Verticillium dahliae VdLs.17
ref|XP_007376158.1|  hypothetical protein SPAPADRAFT_51398            68.2    6e-11   Spathaspora passalidarum NRRL Y-27907
ref|XP_499918.1|  YALI0A09768p                                        67.4    6e-11   Yarrowia lipolytica CLIB122
gb|KHC63824.1|  thiazole biosynthesis enzyme                          67.8    7e-11   Candida albicans P75010
gb|EMG50374.1|  hypothetical protein G210_4595                        67.4    7e-11   Candida maltosa Xu316
emb|CDG58548.1|  Thi4-1 protein                                       67.4    8e-11   Verticillium longisporum
emb|CDG58546.1|  Thi4 protein                                         67.4    9e-11   Verticillium dahliae JR2
gb|KIV92747.1|  thiamine thiazole synthase                            67.4    9e-11   Exophiala mesophila
emb|CDG58547.1|  Thi4 protein                                         67.4    9e-11   Verticillium albo-atrum
gb|EPX71211.1|  thiazole biosynthetic enzyme                          67.4    9e-11   Schizosaccharomyces octosporus yFS286
ref|XP_003344754.1|  hypothetical protein SMAC_06409                  67.0    1e-10   Sordaria macrospora k-hell
emb|CDG58549.1|  Thi4-2 protein                                       67.0    1e-10   Verticillium longisporum
ref|XP_002797266.1|  thiazole biosynthesis enzyme                     67.0    1e-10   
ref|XP_001819323.1|  thiazole biosynthetic enzyme                     67.0    1e-10   Aspergillus oryzae RIB40
gb|EEH19379.2|  thiazole biosynthetic enzyme, mitochondrial           67.0    1e-10   Paracoccidioides brasiliensis Pb03
gb|KIX08964.1|  thiamine thiazole synthase                            67.0    1e-10   Rhinocladiella mackenziei CBS 650.93
ref|XP_010759569.1|  thiazole biosynthetic enzyme, mitochondrial      67.0    1e-10   Paracoccidioides brasiliensis Pb18
ref|XP_003851349.1|  hypothetical protein MYCGRDRAFT_44262            66.6    1e-10   Zymoseptoria tritici IPO323
dbj|GAM35876.1|  thiazole biosynthetic enzyme                         66.6    2e-10   Talaromyces cellulolyticus
ref|XP_009154920.1|  thiazole biosynthetic enzyme, mitochondrial      66.6    2e-10   Exophiala dermatitidis NIH/UT8656
ref|XP_002479053.1|  thiazole biosynthesis enzyme                     66.6    2e-10   Talaromyces stipitatus ATCC 10500
gb|ACN39013.1|  thiazole synthase                                     66.2    2e-10   Epichloe festucae
gb|EPY53594.1|  thiazole biosynthetic enzyme                          66.6    2e-10   Schizosaccharomyces cryophilus OY26
ref|XP_001227644.1|  thiazole biosynthetic enzyme, mitochondrial ...  66.6    2e-10   Chaetomium globosum CBS 148.51
ref|XP_007835960.1|  Thiamine thiazole synthase                       66.2    2e-10   Pestalotiopsis fici W106-1
gb|KIL95952.1|  hypothetical protein FAVG1_00690                      66.2    2e-10   Fusarium avenaceum
gb|ABN45974.1|  thiazole biosynthetic enzyme variant 1                66.2    2e-10   Epichloe festucae var. lolii
gb|EYE95075.1|  Thi4 family thiamine biosynthetic enzyme              66.2    2e-10   Aspergillus ruber CBS 135680
gb|KIY92671.1|  thiamine biosynthetic enzyme                          66.6    2e-10   Monoraphidium neglectum
ref|XP_007745751.1|  thiazole biosynthetic enzyme, mitochondrial      66.2    2e-10   Cladophialophora psammophila CBS 110553
gb|KIW92677.1|  thiamine thiazole synthase                            66.2    2e-10   Cladophialophora bantiana CBS 173.52
ref|XP_002375225.1|  thiazole biosynthesis enzyme Sti35               65.9    3e-10   Aspergillus flavus NRRL3357
gb|KIY99977.1|  thiamine biosynthetic enzyme                          66.2    3e-10   Monoraphidium neglectum
ref|XP_007913237.1|  putative thiazole biosynthetic enzyme protein    65.9    3e-10   Phaeoacremonium minimum UCRPA7
ref|XP_461084.2|  DEHA2F16654p                                        65.9    3e-10   Debaryomyces hansenii CBS767
ref|XP_002951140.1|  hypothetical protein VOLCADRAFT_74900            66.2    3e-10   Volvox carteri f. nagariensis
ref|XP_011397717.1|  Thiamine thiazole synthase, chloroplastic        66.6    3e-10   Auxenochlorella protothecoides
gb|EUC66166.1|  thiamine thiazole synthase                            65.9    3e-10   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_723197.1|  likely thiamine biosynthesis enzyme                 66.2    3e-10   Candida albicans SC5314
sp|C4YNP4.1|THI4_CANAW  RecName: Full=Thiamine thiazole synthase;...  66.2    3e-10   Candida albicans WO-1
ref|XP_002951138.1|  hypothetical protein VOLCADRAFT_74899            66.2    3e-10   Volvox carteri f. nagariensis
gb|AAL86771.2|  THI4 enzyme                                           66.2    3e-10   Candida albicans
ref|XP_003297921.1|  hypothetical protein PTT_08482                   65.9    3e-10   
ref|XP_003044703.1|  predicted protein                                65.9    3e-10   [Nectria] haematococca mpVI 77-13-4
ref|XP_007701574.1|  hypothetical protein COCSADRAFT_38262            65.9    3e-10   Bipolaris sorokiniana ND90Pr
gb|KGO71577.1|  Thiazole biosynthetic enzyme Thi4 family              65.9    3e-10   Penicillium italicum
ref|XP_001386426.1|  hypothetical protein PICST_50942                 65.9    3e-10   Scheffersomyces stipitis CBS 6054
gb|KIX99472.1|  thiamine thiazole synthase                            65.9    3e-10   Fonsecaea multimorphosa CBS 102226
ref|XP_002564812.1|  Pc22g07960                                       65.9    3e-10   Penicillium rubens Wisconsin 54-1255
dbj|GAA84055.1|  thiazole biosynthesis enzyme                         65.9    3e-10   Aspergillus kawachii IFO 4308
gb|EDK40113.2|  conserved hypothetical protein                        65.9    3e-10   Meyerozyma guilliermondii ATCC 6260
ref|XP_001394167.1|  thiazole biosynthetic enzyme                     65.9    3e-10   Aspergillus niger CBS 513.88
ref|XP_007728533.1|  thiazole biosynthetic enzyme, mitochondrial      65.9    3e-10   Capronia epimyces CBS 606.96
ref|XP_007692325.1|  hypothetical protein COCMIDRAFT_30031            65.9    3e-10   Bipolaris oryzae ATCC 44560
gb|KGO43516.1|  Thiazole biosynthetic enzyme Thi4 family              65.9    3e-10   Penicillium expansum
gb|KEF63437.1|  thiazole biosynthetic enzyme, mitochondrial           65.9    3e-10   Exophiala aquamarina CBS 119918
gb|KDN34978.1|  hypothetical protein RSAG8_11984                      65.5    3e-10   Rhizoctonia solani AG-8 WAC10335
ref|XP_750725.1|  thiazole biosynthesis enzyme                        65.9    3e-10   Aspergillus fumigatus Af293
ref|XP_001483482.1|  conserved hypothetical protein                   65.9    3e-10   Meyerozyma guilliermondii ATCC 6260
gb|KEY78369.1|  thiazole biosynthesis enzyme                          65.9    3e-10   Aspergillus fumigatus var. RP-2014
ref|XP_001214996.1|  hypothetical protein ATEG_05818                  65.9    4e-10   Aspergillus terreus NIH2624
ref|XP_007277744.1|  thiazole biosynthetic enzyme                     64.7    4e-10   
gb|KGR10168.1|  thiazole biosynthesis enzyme                          65.9    4e-10   Candida albicans P57072
gb|KGQ88127.1|  thiazole biosynthesis enzyme                          65.9    4e-10   Candida albicans P94015
ref|XP_002146762.1|  thiazole biosynthesis enzyme                     65.5    4e-10   Talaromyces marneffei ATCC 18224
gb|KHC37210.1|  thiazole biosynthesis enzyme                          65.9    4e-10   
gb|EKV04849.1|  Thiazole biosynthesis enzyme                          65.5    4e-10   
gb|KFX46359.1|  Thiamine thiazole synthase                            65.5    4e-10   
ref|XP_661532.1|  THI4_ASPOR Thiazole biosynthetic enzyme, mitoch...  65.5    4e-10   
ref|XP_007721137.1|  thiazole biosynthetic enzyme, mitochondrial      65.5    4e-10   
gb|ABG46357.1|  mitochondrial thiazole biosynthetic enzyme            65.5    4e-10   
gb|KIW39396.1|  thiamine thiazole synthase, variant 1                 65.5    4e-10   
gb|KIV86535.1|  thiamine thiazole synthase, variant 2                 65.5    4e-10   
ref|XP_006692218.1|  hypothetical protein CTHT_0017160                65.5    4e-10   
gb|KGK37032.1|  hypothetical protein JL09_g3847                       65.5    4e-10   
ref|XP_001796354.1|  hypothetical protein SNOG_05965                  65.5    4e-10   
ref|XP_002548228.1|  hypothetical protein CTRG_02525                  65.5    5e-10   
gb|KIV86533.1|  thiamine thiazole synthase                            65.5    5e-10   
gb|KIW29175.1|  thiamine thiazole synthase                            65.5    5e-10   
gb|KIW39395.1|  thiamine thiazole synthase                            65.5    5e-10   
gb|EHK27008.1|  hypothetical protein TRIVIDRAFT_215037                65.1    5e-10   
gb|KGQ06713.1|  Thiamine thiazole synthase                            65.1    5e-10   
ref|XP_001257952.1|  thiazole biosynthesis enzyme                     65.1    6e-10   
ref|XP_002492875.1|  Thiazole synthase, catalyzes formation of th...  65.1    6e-10   
ref|XP_008598283.1|  mitochondrial thiazole biosynthetic enzyme       65.1    6e-10   
gb|EEH38204.2|  thiazole biosynthesis enzyme                          65.5    6e-10   
gb|KDN61355.1|  putative Thi4 family protein                          65.1    7e-10   
gb|EQB43457.1|  hypothetical protein CGLO_17887                       64.7    7e-10   
emb|CCO32846.1|  Thiamine thiazole synthase AltName: Full=Stress-...  64.7    7e-10   
ref|XP_007289177.1|  thiazole biosynthetic enzyme                     64.7    7e-10   
gb|KIN04678.1|  hypothetical protein OIDMADRAFT_17638                 64.7    7e-10   
ref|XP_009253330.1|  hypothetical protein FPSE_01936                  64.7    8e-10   
gb|ABQ23424.1|  thiazole biosynthetic enzyme                          64.7    8e-10   
ref|XP_011318395.1|  hypothetical protein FGSG_02469                  64.7    8e-10   
ref|XP_003868755.1|  Thi4 thiamine biosynthetic enzyme precursor      64.7    8e-10   
sp|P23618.2|THI4_FUSOX  RecName: Full=Thiamine thiazole synthase;...  64.7    8e-10   
gb|ABL63512.1|  mitochondrial thiazole biosynthetic enzyme            64.7    8e-10   
gb|EWG49587.1|  thiamine biosynthetic enzyme                          64.7    8e-10   
emb|CCE33143.1|  probable CyPBP37 protein (protein binding to CyP41)  64.7    9e-10   
gb|EMT70803.1|  Thiazole biosynthetic enzyme, mitochondrial           64.7    9e-10   
ref|XP_002842761.1|  thiazole biosynthetic enzyme                     64.3    1e-09   
pdb|3JSK|A  Chain A, Thiazole Synthase From Neurospora Crassa         64.3    1e-09   
gb|KEQ59396.1|  Thi4-domain-containing protein                        64.3    1e-09   
gb|KIW21130.1|  thiamine thiazole synthase                            64.3    1e-09   
ref|XP_011395239.1|  thiazole biosynthetic enzyme, variant 2          64.3    1e-09   
gb|KHE80990.1|  hypothetical protein GE21DRAFT_10110                  64.3    1e-09   
gb|KEZ45124.1|  Thiamine thiazole synthase                            64.3    1e-09   
ref|XP_006968797.1|  thiazole biosynthetic enzyme                     63.9    1e-09   
gb|ENH83973.1|  thiazole biosynthetic enzyme                          64.3    1e-09   
gb|KDB24510.1|  thiazole biosynthetic enzyme, mitochondrial           64.3    1e-09   
ref|XP_003169195.1|  thiazole biosynthesis enzyme                     64.3    1e-09   
gb|EGD98433.1|  Thi4 family protein                                   64.3    1e-09   
emb|CDM36407.1|  Thiazole biosynthetic enzyme, mitochondrial          64.7    1e-09   
ref|XP_001526313.1|  hypothetical protein LELG_02871                  64.3    1e-09   
ref|XP_003013828.1|  hypothetical protein ARB_07940                   63.9    1e-09   
ref|XP_007713209.1|  hypothetical protein COCCADRAFT_27023            63.9    1e-09   
gb|EUN24789.1|  hypothetical protein COCVIDRAFT_17857                 63.9    1e-09   
dbj|GAM85562.1|  hypothetical protein ANO11243_035690                 63.9    1e-09   
gb|EZF72777.1|  thiazole biosynthetic enzyme, mitochondrial           63.9    1e-09   
gb|EMD85953.1|  hypothetical protein COCHEDRAFT_1160889               63.9    1e-09   
ref|XP_003235740.1|  Thi4 family protein                              63.9    1e-09   
gb|EWG49586.1|  thiamine biosynthetic enzyme                          64.3    2e-09   
gb|EPS32049.1|  hypothetical protein PDE_07008                        63.5    2e-09   
dbj|GAD93648.1|  thiazole biosynthetic enzyme                         63.9    2e-09   
emb|CCF45087.1|  thiazole biosynthetic enzyme                         63.5    2e-09   
gb|EXK40264.1|  thiamine biosynthetic enzyme                          63.9    2e-09   
gb|KIW54196.1|  thiamine thiazole synthase                            63.5    2e-09   
gb|KEQ99790.1|  hypothetical protein AUEXF2481DRAFT_35726             63.5    2e-09   
ref|XP_001589094.1|  thiazole biosynthetic enzyme                     63.5    2e-09   
gb|KEQ82031.1|  Thi4-domain-containing protein                        63.5    2e-09   
gb|AGT99181.1|  thiazole biosynthetic enzyme                          63.5    2e-09   
emb|CCE44732.1|  hypothetical protein CPAR2_405360                    63.5    2e-09   
ref|XP_008726400.1|  thiazole biosynthetic enzyme, mitochondrial      63.2    3e-09   
ref|XP_007757037.1|  thiazole biosynthetic enzyme, mitochondrial      63.2    3e-09   
ref|XP_001935439.1|  thiazole biosynthesis enzyme                     63.2    3e-09   
sp|P23617.1|THI4_FUSSH  RecName: Full=Thiamine thiazole synthase;...  63.2    3e-09   
ref|XP_003665159.1|  hypothetical protein MYCTH_2315910               62.8    4e-09   
gb|ERT00649.1|  thiazole biosynthetic enzyme, mitochondrial           62.8    4e-09   
ref|XP_007928692.1|  hypothetical protein MYCFIDRAFT_211863           62.8    4e-09   
gb|KIH92073.1|  thiamine biosynthetic enzyme                          62.8    4e-09   
gb|EFW98890.1|  thiazole biosynthetic enzyme                          62.8    5e-09   
ref|XP_003320392.1|  thiazole biosynthetic enzyme, mitochondrial      62.4    5e-09   
gb|ELR08851.1|  thiazole biosynthetic enzyme, mitochondrial           62.4    5e-09   
gb|KFY24905.1|  hypothetical protein V493_04960                       62.4    5e-09   
gb|KFY84898.1|  hypothetical protein V500_08902                       62.4    5e-09   
gb|KFY94986.1|  hypothetical protein V498_03597                       62.4    5e-09   
gb|KFZ09843.1|  hypothetical protein V501_05470                       62.4    5e-09   
gb|EFQ30532.1|  Thi4 family protein                                   62.4    6e-09   
gb|KFY70117.1|  hypothetical protein V499_09439                       62.4    6e-09   
ref|XP_001549602.1|  thiazole biosynthetic enzyme                     62.4    6e-09   
gb|KFY43107.1|  hypothetical protein V494_02101                       62.4    6e-09   
gb|KFY08103.1|  hypothetical protein V492_06538                       62.4    6e-09   
emb|CCK70574.1|  hypothetical protein KNAG_0E03150                    62.0    6e-09   
sp|Q9UVF8.1|THI4_UROFA  RecName: Full=Thiamine thiazole synthase;...  62.4    6e-09   
gb|EPE04284.1|  thiazole biosynthetic enzyme                          62.4    6e-09   
gb|KFY20175.1|  hypothetical protein V491_03934                       62.0    6e-09   
gb|KFX98431.1|  hypothetical protein O988_04337                       62.0    7e-09   
gb|KFZ11494.1|  hypothetical protein V502_07520                       62.0    7e-09   
ref|XP_007416429.1|  hypothetical protein MELLADRAFT_53832            62.0    7e-09   
gb|ACB70465.1|  thiazole biosynthetic enzyme                          62.0    8e-09   
ref|XP_008714161.1|  thiazole biosynthetic enzyme, mitochondrial      62.0    8e-09   
ref|XP_001647032.1|  hypothetical protein Kpol_1050p31                61.6    8e-09   
emb|CCF51739.1|  probable Thiamin biosynthetic enzyme                 62.0    8e-09   
ref|XP_003842741.1|  similar to thiazole biosynthetic enzyme          62.0    8e-09   
gb|EHK44880.1|  hypothetical protein TRIATDRAFT_299703                61.6    1e-08   
emb|CDF87469.1|  BN860_07074g1_1                                      61.6    1e-08   
emb|CDH15474.1|  probable Thiamine thiazole synthase                  61.6    1e-08   
gb|KEQ70131.1|  putative thiazole synthase THI4_ASPOR thiazole bi...  61.6    1e-08   
emb|CEP62770.1|  LALA0S06e03400g1_1                                   61.2    1e-08   
gb|EHN02289.1|  Thi4p                                                 61.2    1e-08   
ref|XP_008087498.1|  FAD/NAD(P)-binding protein                       61.2    1e-08   
gb|KFY50717.1|  hypothetical protein V496_09214                       62.4    1e-08   
gb|KFX95262.1|  hypothetical protein V490_03958                       62.4    1e-08   
gb|EHL02685.1|  putative Thiazole biosynthetic enzyme, mitochondrial  61.2    1e-08   
emb|CCX30406.1|  Similar to Thiamine thiazole synthase; acc. no. ...  61.2    1e-08   
gb|EJT96874.1|  thiazole biosynthetic enzyme                          61.2    1e-08   
gb|KFY37341.1|  hypothetical protein V495_07232                       62.4    1e-08   
ref|XP_009228164.1|  thiazole biosynthetic enzyme                     60.8    2e-08   
emb|CEJ80029.1|  Putative Thiamine thiazole synthase                  60.8    2e-08   
gb|EME42084.1|  hypothetical protein DOTSEDRAFT_73000                 60.8    2e-08   
ref|XP_002551959.1|  KLTH0B03916p                                     60.8    2e-08   
emb|CEJ80028.1|  Putative Thiamine thiazole synthase                  60.8    2e-08   
gb|KIW68442.1|  thiamine thiazole synthase                            60.5    2e-08   
gb|ESZ95478.1|  thiazole biosynthetic enzyme                          60.5    3e-08   
ref|XP_006462581.1|  hypothetical protein AGABI2DRAFT_72787           60.1    3e-08   
ref|XP_003683090.1|  hypothetical protein TDEL_0H00200                60.1    3e-08   
ref|XP_001538310.1|  hypothetical protein HCAG_05915                  60.1    3e-08   
sp|C0NSF3.2|THI4_AJECG  RecName: Full=Thiamine thiazole synthase;...  60.1    3e-08   
gb|AGO09853.1|  AaceriAAL137Wp                                        60.1    3e-08   
ref|XP_003669189.1|  hypothetical protein NDAI_0C02860                60.1    3e-08   
ref|XP_002498498.1|  ZYRO0G11726p                                     60.1    3e-08   
gb|EER41684.1|  thiazole biosynthetic enzyme                          60.1    3e-08   
gb|EEH05819.1|  thiazole biosynthetic enzyme                          60.1    4e-08   
ref|NP_982405.1|  AAL137Wp                                            60.1    4e-08   
gb|EGA62236.1|  Thi4p                                                 59.3    4e-08   
gb|KII90613.1|  hypothetical protein PLICRDRAFT_538929                59.7    4e-08   
ref|XP_002626178.1|  thiazole biosynthesis enzyme                     60.1    4e-08   
gb|EEQ92538.1|  thiazole biosynthesis enzyme                          60.1    4e-08   
pdb|3FPZ|A  Chain A, Saccharomyces Cerevisiae Thi4p Is A Suicide ...  59.7    4e-08   
gb|AJR77233.1|  Thi4p                                                 59.7    4e-08   
gb|EDN61733.1|  thiamine metabolism-related protein                   59.7    4e-08   
ref|XP_003683988.1|  hypothetical protein TPHA_0A04790                59.7    4e-08   
ref|NP_011660.1|  thiamine thiazole synthase                          59.7    4e-08   
gb|EWH18379.1|  Thi4p                                                 59.7    4e-08   
gb|EST05805.1|  flavin-binding monooxygenase-like                     59.7    4e-08   
gb|KJA21255.1|  hypothetical protein HYPSUDRAFT_42403                 59.7    4e-08   
ref|XP_003654402.1|  hypothetical protein THITE_2117402               59.7    5e-08   
gb|EMF12655.1|  thiazole biosynthetic enzyme, mitochondrial           59.7    5e-08   
gb|KIM43217.1|  hypothetical protein M413DRAFT_444027                 59.3    6e-08   
ref|XP_007672530.1|  hypothetical protein BAUCODRAFT_62660            59.3    6e-08   
ref|XP_003034505.1|  hypothetical protein SCHCODRAFT_84820            59.3    6e-08   
dbj|GAK64104.1|  thi4-domain-containing protein                       59.3    7e-08   
gb|EGA78748.1|  Thi4p                                                 59.3    7e-08   
ref|XP_006957782.1|  Thi4-domain-containing protein                   59.3    7e-08   
ref|XP_003720575.1|  thiazole biosynthetic enzyme                     59.3    7e-08   
dbj|GAC72397.1|  hypothetical protein PANT_7d00078                    59.3    7e-08   
gb|ELQ36693.1|  hypothetical protein OOU_Y34scaffold00646g4           58.9    7e-08   
gb|ETS60793.1|  hypothetical protein PaG_04705                        59.3    7e-08   
ref|XP_003647237.1|  hypothetical protein Ecym_6012                   58.9    7e-08   
emb|CAY79903.1|  Thi4p                                                58.9    7e-08   
gb|EQL00755.1|  thiazole biosynthetic enzyme variant 1                58.9    8e-08   
gb|KIJ50951.1|  hypothetical protein M422DRAFT_101777                 57.0    8e-08   
dbj|GAC98786.1|  flavin-binding monooxygenase-like                    58.9    8e-08   
ref|XP_001835983.2|  thiazole biosynthetic enzyme                     58.9    9e-08   
ref|XP_011273842.1|  Thiazole biosynthetic enzyme                     58.9    9e-08   
ref|XP_007351669.1|  thiazole biosynthetic enzyme                     58.2    1e-07   
emb|CDI56388.1|  probable Thiamin biosynthetic enzyme                 58.2    1e-07   
dbj|BAO40649.1|  thiazole biosynthetic enzyme                         58.2    1e-07   
ref|XP_003676118.1|  hypothetical protein NCAS_0D01750                58.2    2e-07   
gb|ELQ63963.1|  hypothetical protein OOW_P131scaffold00904g6          58.9    2e-07   
emb|CDO93401.1|  unnamed protein product                              57.8    2e-07   
emb|CBQ71006.1|  probable Thiamin biosynthetic enzyme                 57.8    2e-07   
ref|XP_007380545.1|  thiazole biosynthetic enzyme                     57.8    2e-07   
gb|EGA86663.1|  Thi4p                                                 57.8    2e-07   
gb|EMS18749.1|  thiamine biosynthetic enzyme                          57.8    3e-07   
gb|AJP38917.1|  Thi4p                                                 57.4    3e-07   
ref|XP_007271222.1|  thiazole biosynthetic enzyme                     57.4    3e-07   
gb|EGU11956.1|  Thiazole biosynthetic enzyme                          57.8    3e-07   
gb|KDN47179.1|  putative Thiamin biosynthetic enzyme                  57.4    3e-07   
gb|EPT05287.1|  hypothetical protein FOMPIDRAFT_1112158               57.4    3e-07   
gb|KIY62047.1|  thiazole biosynthetic enzyme                          57.4    3e-07   
ref|XP_449395.1|  hypothetical protein                                57.4    3e-07   
ref|XP_009269436.1|  Thiamine thiazole synthase                       57.0    3e-07   
gb|KIJ62636.1|  hypothetical protein HYDPIDRAFT_94083                 57.0    4e-07   
gb|KIP06210.1|  hypothetical protein PHLGIDRAFT_468135                57.0    4e-07   
gb|KIO02829.1|  hypothetical protein M404DRAFT_27718                  57.0    4e-07   
ref|XP_011388856.1|  putative Thiamin biosynthetic enzyme             57.0    4e-07   
sp|Q4PC85.1|THI4_USTMA  RecName: Full=Thiamine thiazole synthase;...  57.0    4e-07   
ref|XP_004181884.1|  hypothetical protein TBLA_0H00760                57.0    4e-07   
ref|XP_007768494.1|  Thi4-domain-containing protein                   57.0    5e-07   
gb|KIJ24322.1|  hypothetical protein M422DRAFT_274931                 56.6    5e-07   
ref|XP_007319542.1|  hypothetical protein SERLADRAFT_470126           56.6    5e-07   
ref|XP_007364009.1|  Thi4-domain-containing protein                   56.6    5e-07   
gb|KDQ62341.1|  hypothetical protein JAAARDRAFT_170661                56.6    5e-07   
gb|KIK52064.1|  hypothetical protein GYMLUDRAFT_50135                 56.6    5e-07   
ref|XP_007304939.1|  Thi4-domain-containing protein                   56.2    6e-07   
gb|KDQ25745.1|  hypothetical protein PLEOSDRAFT_1057999               56.2    7e-07   
gb|KIL63207.1|  hypothetical protein M378DRAFT_79929                  55.8    9e-07   
gb|KEY67925.1|  hypothetical protein S7711_02133                      55.8    9e-07   
gb|KFA66874.1|  hypothetical protein S40285_02303                     55.8    1e-06   
ref|XP_451008.1|  hypothetical protein                                55.8    1e-06   
ref|XP_007866883.1|  Thi4-domain-containing protein                   55.5    1e-06   
gb|ELU45290.1|  thiazole biosynthetic enzyme                          55.8    2e-06   
gb|KIM63333.1|  hypothetical protein SCLCIDRAFT_752494                54.7    2e-06   
gb|KIJ17836.1|  hypothetical protein PAXINDRAFT_9774                  54.3    3e-06   
ref|XP_007399642.1|  hypothetical protein PHACADRAFT_177254           54.7    3e-06   
gb|EMD39842.1|  hypothetical protein CERSUDRAFT_112109                54.3    3e-06   
gb|KIK99865.1|  hypothetical protein PAXRUDRAFT_822318                54.3    3e-06   
ref|XP_008037799.1|  Thi4-domain-containing protein                   54.3    3e-06   
ref|XP_004179275.1|  hypothetical protein TBLA_0B09390                54.3    3e-06   
emb|CCM00650.1|  predicted protein                                    53.9    4e-06   
gb|KIM86133.1|  hypothetical protein PILCRDRAFT_816673                53.5    6e-06   
ref|XP_007882083.1|  hypothetical protein PFL1_06351                  53.1    8e-06   
emb|CCV00434.1|  unnamed protein product                              53.1    9e-06   
ref|XP_009844134.1|  thiazole biosynthesis enzyme, variant 2          52.8    1e-05   
gb|ACZ34282.1|  thiazole synthase                                     52.8    1e-05   
ref|XP_009546328.1|  hypothetical protein HETIRDRAFT_440039           52.8    2e-05   
gb|KIY43384.1|  Thi4-domain-containing protein                        50.1    8e-05   
ref|XP_007853538.1|  thiazole biosynthetic enzyme                     49.7    1e-04   
ref|XP_001731131.1|  hypothetical protein MGL_1314                    49.3    2e-04   



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 2/95 (2%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            FFD  KSSF+G+P+ +   Q ++A+  HNLSV+ S  PY+LD+FKF PIK+SIV+REMTR
Sbjct  17   FFDN-KSSFHGSPIPTRAAQPIRATP-HNLSVTMSSAPYNLDNFKFHPIKESIVSREMTR  74

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  75   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  109



>gb|AEO13833.1| thiazole biosynthetic protein [Camellia sinensis]
Length=132

 Score =   127 bits (318),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 4/98 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS-RVQAVKASSFHNLSVS--ASHTPYSLDSFKFQPIKQSIVARE  247
            F D  +SSF+G P+ S  R+Q +K S+ HNLS+S  AS  PY L SF F+PIK+SIV+RE
Sbjct  20   FLDTHQSSFHGVPLSSPIRLQPIK-STPHNLSISMSASSPPYDLRSFTFEPIKESIVSRE  78

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYM DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  79   MTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPS  116



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            FFD  KS+F+G  VV +R      S+  NL+V+ + TPY+LD FKFQPIK+SIVAREMTR
Sbjct  17   FFDN-KSTFHGAAVVPTRAAQPIKSTPKNLAVAMASTPYNLDDFKFQPIKESIVAREMTR  75

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  76   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  110



>gb|ABI84250.1| thiamine biosynthetic enzyme [Arachis hypogaea]
Length=201

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHNLSVSASHT--PYSLDSFKFQPIKQSIVAREMTRRYMT  268
            S+F+GTPV +SRV  +K+    + ++S S    PY L SFKFQPIK+SIVAREMTRRYMT
Sbjct  18   SAFHGTPVATSRVTPIKSQQQQSQTISMSMATPPYDLQSFKFQPIKESIVAREMTRRYMT  77

Query  269  DMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            DMITYADTDVIVVGAGSAGLSCA++++ NP+
Sbjct  78   DMITYADTDVIVVGAGSAGLSCAYELSKNPS  108



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFH-NLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
            FFD   +SF+G PV  SR+   K+SS    +S+S +  PY L SFKFQPIK+SIV+REMT
Sbjct  17   FFDHKPTSFHGKPVSQSRLTPTKSSSKQPTISMSLTPPPYDLQSFKFQPIKESIVSREMT  76

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            RRYMTDMITYADTDV+VVGAGSAGLSCA++++ NP
Sbjct  77   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNP  111



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 82/96 (85%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHT-PYSLDSFKFQPIKQSIVAREMT  253
            FFD  KSSF+G+P+ +  VQ +K S+  +L+++ S   PY+LD+FKFQPIK+SIV+REMT
Sbjct  17   FFDN-KSSFHGSPLSTRAVQPIK-SAPQSLAITMSAAAPYNLDNFKFQPIKESIVSREMT  74

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  75   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  110



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 4/96 (4%)
 Frame = +2

Query  80   FDAAKSSFNGTPVVSSRVQAVKASSFHNLSV--SASHTPYSLDSFKFQPIKQSIVAREMT  253
            F   KSSF+G+P++S RVQ VK SS  N SV  SAS   Y+ D+FKFQPI++SIV+REMT
Sbjct  16   FLETKSSFHGSPILS-RVQPVK-SSPQNFSVTMSASTPQYNFDAFKFQPIQESIVSREMT  73

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYADTDV+VVGAGSAGLSCA++I+ NPN
Sbjct  74   RRYMTDMITYADTDVVVVGAGSAGLSCAYEISKNPN  109



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 6/98 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS--RVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVARE  247
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIK+SIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  114



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 6/98 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS--RVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVARE  247
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIK+SIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  114



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 6/98 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS--RVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVARE  247
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIK+SIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  114



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 6/98 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS--RVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVARE  247
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIK+SIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  114



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 78/96 (81%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMT  253
            F D  KSSF+GTP+  SR   +K+SS HN ++S S TP Y L SFKFQPIK+S V+REMT
Sbjct  19   FLDHNKSSFSGTPI-PSRFTPIKSSS-HNSAISMSLTPPYDLQSFKFQPIKESYVSREMT  76

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM D+ITYADTDVI+VGAGSAGLSCA++I+ NPN
Sbjct  77   RRYMMDIITYADTDVIIVGAGSAGLSCAYEISKNPN  112



>gb|ACV52582.1| thiazole biosynthetic enzyme [Nicotiana benthamiana]
Length=160

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVS-SRVQAVKASSFHNLSVS----ASHTPYSLDSFKFQPIKQSIVA  241
            F D  KSSF+G P+ S +RV+ VK +   N+++S    +S  PY L++F F PIK+SIV+
Sbjct  13   FLDTHKSSFSGVPLFSQARVKPVKYAQ-QNMTISMSADSSPPPYDLNAFSFNPIKESIVS  71

Query  242  REMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            REMTRRYMTDMITYADTDV++VGAGSAGLSCA++I+ NPN
Sbjct  72   REMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPN  111



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 79/95 (83%), Gaps = 2/95 (2%)
 Frame = +2

Query  80   FDAAKSSFNGTPVVS-SRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            FD  KSSF+G P+ + +R+  VK++   NL+V+A+  PY L SFKF+PIK+SIV+REMTR
Sbjct  17   FDPHKSSFHGVPIATQARLSPVKSTPV-NLAVTAAAMPYDLRSFKFEPIKESIVSREMTR  75

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYM DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  76   RYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPS  110



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 77/96 (80%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMT  253
            F D  KSSF+GT +  SR   +K+SS HN ++S S TP Y L SF+FQPIK+S V+REMT
Sbjct  19   FLDHNKSSFSGTQI-PSRFTPIKSSS-HNSAISMSLTPPYDLQSFEFQPIKESYVSREMT  76

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM DMITYADTDVI+VGAGSAGLSCA++I+ NPN
Sbjct  77   RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPN  112



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 77/99 (78%), Gaps = 5/99 (5%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVS-SRVQAVKASSFHNLSVSAS---HTPYSLDSFKFQPIKQSIVAR  244
            F D  KSSF G P+ S +R++ VK S+  N+SVS S     PY L SF F PIK+SIVAR
Sbjct  15   FIDTHKSSFYGVPISSQTRLKIVK-STPQNMSVSMSADASPPYDLGSFSFNPIKESIVAR  73

Query  245  EMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            EMTRRYMTDMITYADTDV++VGAGSAGLSCA++++ NPN
Sbjct  74   EMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPN  112



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 80/100 (80%), Gaps = 6/100 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVS-SRVQAVKASSFHNLSVS----ASHTPYSLDSFKFQPIKQSIVA  241
            F D  KSSF+G P+ S +R++ VK S+  N+++S    +S  PY L++F F PIK+SIV+
Sbjct  18   FLDTHKSSFSGVPLFSQARLKPVK-SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVS  76

Query  242  REMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            REMTRRYMTDMITYADTDV++VGAGSAGLSCA++I+ NPN
Sbjct  77   REMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPN  116



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 80/100 (80%), Gaps = 6/100 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVS-SRVQAVKASSFHNLSVS----ASHTPYSLDSFKFQPIKQSIVA  241
            F D  KSSF+G P+ S +R++ VK S+  N+++S    +S  PY L++F F PIK+SIV+
Sbjct  18   FLDTHKSSFSGVPLFSQARLKPVK-SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVS  76

Query  242  REMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            REMTRRYMTDMITYADTDV++VGAGSAGLSCA++I+ NPN
Sbjct  77   REMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPN  116



>gb|KJB57702.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=304

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYMT  268
            KSSF+GTP+ +SR   +K+SS    ++S S TP Y L SFKFQPIK+S VAREMTRRYM 
Sbjct  23   KSSFHGTPL-ASRFTPIKSSS-QTATISMSLTPPYDLQSFKFQPIKESYVAREMTRRYMM  80

Query  269  DMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            DMITYADTDVI+VGAGSAGLSCA++I+ NPN
Sbjct  81   DMITYADTDVIIVGAGSAGLSCAYEISKNPN  111



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 8/96 (8%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKA--SSFHNLSVS----ASHTPYSLDSFKFQPIKQSIVAREMT  253
            +SSF+G PV  +RVQ +KA  S+ H LSVS     S + Y L +FKF+PIK+SIV+REMT
Sbjct  24   ESSFHGVPV--ARVQPLKAATSNGHGLSVSMSAGGSTSAYDLTNFKFEPIKESIVSREMT  81

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  82   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  117



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS-RVQAVKASSFHNLSVS----ASHTPYSLDSFKFQPIKQSIVA  241
            F D  KSSF+G P+ S  R++ VK S+  N+++S    +S  PY L++F F PIK+SIV+
Sbjct  19   FLDTHKSSFSGIPLFSQVRLKPVK-SAQQNMTISMSADSSPPPYDLNAFTFNPIKESIVS  77

Query  242  REMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            REMTRRYMTDMITYADTDV++VGAGSAGLSCA++I+ NPN
Sbjct  78   REMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPN  117



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 9/96 (9%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKA---SSFHNLSVSAS---HTP-YSLDSFKFQPIKQSIVAREMT  253
            SSF+GTPVV  R+Q  KA   S+ H LSVS S    TP Y L +FKF PIK+SIV+REMT
Sbjct  25   SSFHGTPVV--RLQPAKAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMT  82

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  83   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  118



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYMT  268
            KSSF+GTP+ +SR   +K+SS    ++S S TP Y L SFKFQPIK+S VAREMTRRYM 
Sbjct  23   KSSFHGTPL-ASRFTPIKSSS-QTATISMSLTPPYDLQSFKFQPIKESYVAREMTRRYMM  80

Query  269  DMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            DMITYADTDVI+VGAGSAGLSCA++I+ NPN
Sbjct  81   DMITYADTDVIIVGAGSAGLSCAYEISKNPN  111



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 4/92 (4%)
 Frame = +2

Query  95   SSFNGTPVVSS---RVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYM  265
            SSF+GTP+ S    R+++  A+S   +S SAS  PY L+ FKF PI++SIV+REMTRRYM
Sbjct  21   SSFHGTPLASPSSLRLKSTAATSL-TISASASQPPYDLNQFKFNPIRESIVSREMTRRYM  79

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDMITYADTDV++VGAGSAGLSCA++++ NPN
Sbjct  80   TDMITYADTDVVIVGAGSAGLSCAYELSKNPN  111



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 4/92 (4%)
 Frame = +2

Query  95   SSFNGTPVVSS---RVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYM  265
            SSF+GTP+ S    R+++  A+S   +S SAS  PY L+ FKF PI++SIV+REMTRRYM
Sbjct  21   SSFHGTPLASPPSLRLKSPAATSL-TISASASQPPYDLNQFKFNPIRESIVSREMTRRYM  79

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDMITYADTDVI+VGAGSAGLSCA++++ NPN
Sbjct  80   TDMITYADTDVIIVGAGSAGLSCAYELSKNPN  111



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASS---FHNLSVS--ASHTPYSLDSFKFQPIKQSIVAREMTRR  259
            SSF+G P+  +RVQ +KA+S    H LSVS  AS   Y L +FKF+PIK+SIV+REMTRR
Sbjct  27   SSFHGAPL--ARVQPLKAASSSNGHGLSVSMSASTNAYDLSNFKFEPIKESIVSREMTRR  84

Query  260  YMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            YMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  85   YMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  118



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 2/92 (2%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNL-SVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYM  265
            KSSF+G+P+++SRV  +++SS     ++S S TP Y  +SF F PIK+SIV+REMTRRYM
Sbjct  24   KSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYM  83

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDM+TYADTDVIVVGAGSAGLSCA++I+ NP+
Sbjct  84   TDMVTYADTDVIVVGAGSAGLSCAYEISKNPS  115



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 2/92 (2%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASS-FHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYM  265
            KSSF+G+P+++SRV  +++SS     ++S S TP Y  +SF F PIK+SIV+REMTRRYM
Sbjct  24   KSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYM  83

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDM+TYADTDVIVVGAGSAGLSCA++I+ NP+
Sbjct  84   TDMVTYADTDVIVVGAGSAGLSCAYEISKNPS  115



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            FFD  KSSF+G+P+ S RV  +K S        +S +PY L SFKF+PIK+SIVAREMTR
Sbjct  19   FFDN-KSSFHGSPI-SYRVLPIKVSHQSPTISMSSASPYDLQSFKFEPIKESIVAREMTR  76

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYM DMITYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  77   RYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPS  111



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASS-FHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
            F D  KSSF+GTP+ +SR   +K+SS    +S+S +  PY L SFKFQPI++S VAREMT
Sbjct  19   FLDH-KSSFHGTPL-ASRFTPIKSSSQISTISMSLT-PPYDLQSFKFQPIQESYVAREMT  75

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM DMITYADTDVI+VGAGSAGLSCA++I+ NPN
Sbjct  76   RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPN  111



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            FFD  KSSF+G+P+ S RV  +K S        +S +PY L SFKF+PIK+SIVAREMTR
Sbjct  19   FFDN-KSSFHGSPI-SYRVLPIKVSHQSPTISMSSVSPYDLQSFKFEPIKESIVAREMTR  76

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYM DMITYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  77   RYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPS  111



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKA---SSFHNLSVSAS---HTP-YSLDSFKFQPIKQSIVAREMT  253
            SSF+GT VV  R+Q  KA   S+ H LSVS S    TP Y L +FKF PIK+SIV+REMT
Sbjct  25   SSFHGTSVV--RLQPAKAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMT  82

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  83   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPN  118



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHN-LSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
            F D  KSSF+GTP+ +SR   +++SS  + +S+S +  PY L SF FQPIK+S VAREMT
Sbjct  50   FLDH-KSSFHGTPI-ASRFTPIRSSSQDSAISMSLNTPPYDLQSFNFQPIKESYVAREMT  107

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM DMITYADTDVI+VGAGSAGLSCA++I+ NP+
Sbjct  108  RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPS  143



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = +2

Query  86   AAKSSFNGTPVVSSRVQAVKASSFHNLSVS---ASHTPYSLDSFKFQPIKQSIVAREMTR  256
            A KSSF+G PV ++R      +S    SV+   A+  PY+LD+FKF PIK+SIV+REMTR
Sbjct  9    APKSSFHGLPV-NTRAAVHPVTSLPARSVTVAAAAALPYNLDAFKFNPIKESIVSREMTR  67

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  68   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  102



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 78/96 (81%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS-RVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
            F D  KSSF+GTP+ ++ R   +K++S   +++S +   Y L SFKFQPIK+SIV+REMT
Sbjct  17   FLDH-KSSFHGTPITTTGRFTPIKSTS-PAITMSLTQPSYDLQSFKFQPIKESIVSREMT  74

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDM+TYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  75   RRYMTDMVTYADTDVVVVGAGSAGLSCAYELSKNPS  110



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 4/90 (4%)
 Frame = +2

Query  101  FNGTPVV-SSRVQ---AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMT  268
            FNG PV  SSRV     + +S    +S+S +  PY L SFKFQPIK+SIV+REMTRRYMT
Sbjct  18   FNGKPVTYSSRVAPTTKLSSSKQGTISMSLTPPPYDLQSFKFQPIKESIVSREMTRRYMT  77

Query  269  DMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            DMITYADTDV++VGAGSAGLSCA++++ NP
Sbjct  78   DMITYADTDVVIVGAGSAGLSCAYELSKNP  107



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 75/93 (81%), Gaps = 3/93 (3%)
 Frame = +2

Query  92   KSSF-NGTPVVSSRVQAVKASS--FHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRY  262
            KSSF NG  + +     +K++S  + ++S+S +  PY L SFKFQPIK+SIV+REMTRRY
Sbjct  15   KSSFFNGRSIATRTSHLIKSTSHNYSSVSMSLNTPPYDLQSFKFQPIKESIVSREMTRRY  74

Query  263  MTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTDMITYADTDV++VGAGSAGLSCA++++ NPN
Sbjct  75   MTDMITYADTDVVIVGAGSAGLSCAYELSKNPN  107



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 78/96 (81%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS-RVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
            F D  KSSF+GTP+ ++ R   +K++S   +++S +   Y L SFKFQPIK+SIV+REMT
Sbjct  17   FLDH-KSSFHGTPITTTGRFTPIKSTS-SAITMSLAQPSYDLQSFKFQPIKESIVSREMT  74

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDM+TYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  75   RRYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPS  110



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 8/102 (8%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVS-SRVQAVKASSFHNLSVSAS------HTPYSLDSFKFQPIKQSI  235
            F D  KSSF G P+ S +R++ VK S+  N++VS S        PY L SF F PIK+SI
Sbjct  15   FIDTHKSSFYGVPISSQARLKIVK-STPQNMAVSMSADASPPPPPYDLGSFSFNPIKESI  73

Query  236  VAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            VAREMTRRYMTDMITYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  74   VAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPD  115



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +2

Query  92   KSSF-NGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMT  268
            KSSF NG P+ ++R   +  S+   +++S +  PY +++FKF PIK+SIV+REMTRRYMT
Sbjct  18   KSSFFNGRPI-ATRTSTIIKSTPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMT  76

Query  269  DMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            DMITYADTDV++VGAGSAGLSCA++++ NPN
Sbjct  77   DMITYADTDVVIVGAGSAGLSCAYELSKNPN  107



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +2

Query  92   KSSF-NGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMT  268
            KSSF NG P+ ++R   +  S+   +++S +  PY +++FKF PIK+SIV+REMTRRYMT
Sbjct  18   KSSFFNGRPI-ATRTSTIIKSTPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMT  76

Query  269  DMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            DMITYADTDV++VGAGSAGLSCA++++ NPN
Sbjct  77   DMITYADTDVVIVGAGSAGLSCAYELSKNPN  107



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 76/91 (84%), Gaps = 3/91 (3%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYMT  268
            +SS +G P+  +R+Q ++ SS  +LS+S S TP Y L SFKF+PI++SIV+REMTRRYM 
Sbjct  24   RSSIHGVPL-PTRLQPIR-SSPQSLSISMSSTPPYDLQSFKFEPIRESIVSREMTRRYMM  81

Query  269  DMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            DMITYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  82   DMITYADTDVVIVGAGSAGLSCAYELSKNPS  112



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHN--LSVSASH---TP-YSLDSFKFQPIKQSIVAREMTR  256
            SSF+G P+V  R+Q  KA+  +N  LSVS S    TP Y L +FKF PIK+SIV+REMTR
Sbjct  25   SSFHGAPMV--RLQPAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTR  82

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  117



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHN--LSVSASH---TP-YSLDSFKFQPIKQSIVAREMTR  256
            SSF+G P+V  R+Q  KA+  +N  LSVS S    TP Y L +FKF PIK+SIV+REMTR
Sbjct  25   SSFHGAPMV--RLQLAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTR  82

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  117



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 4/92 (4%)
 Frame = +2

Query  95   SSFNGTPVV-SSRVQAVK---ASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRY  262
            S F+G PV  SSRV       +S    +S+S +  PY L SFKFQPIK+SIV+REMTRRY
Sbjct  16   SFFHGKPVTYSSRVAPTTKLFSSKQGTISMSLTQPPYDLQSFKFQPIKESIVSREMTRRY  75

Query  263  MTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            MTDMITYADTDV++VGAGSAGLSCA++I+ NP
Sbjct  76   MTDMITYADTDVVIVGAGSAGLSCAYEISKNP  107



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHN--LSVSAS----HTPYSLDSFKFQPIKQSIVAREMTR  256
            SSF+G P+V  R+Q  KA+   N  LSVS S    +  Y L +FKF PIK+SIV+REMTR
Sbjct  25   SSFHGAPIV--RLQPAKAAPASNGGLSVSMSSNGLNPSYDLSAFKFDPIKESIVSREMTR  82

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  117



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 75/95 (79%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHN--LSVSAS----HTPYSLDSFKFQPIKQSIVAREMTR  256
            SSF+G P+V  R+Q  KA+   N  LSVS S    +  Y+L +FKF PIK+SIV+REMTR
Sbjct  25   SSFHGAPMV--RLQPAKAAPASNGGLSVSMSANGLNPSYNLSAFKFDPIKESIVSREMTR  82

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  117



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = +2

Query  77   FFDAAKSSFNGTPV---VSSRVQAVKASSFHNLSVSASHTP----YSLDSFKFQPIKQSI  235
            FFD  K+SFNG P+   V  R QA +++  +   +S S       Y L+ F+F PIK+SI
Sbjct  14   FFDTHKTSFNGQPISPAVRRRRQATRSAKPNGSPISMSSASSPPGYDLNQFRFAPIKESI  73

Query  236  VAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            V+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  74   VSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPS  115



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 7/99 (7%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSR--VQAVKASSFHNLSV--SASHTPYSLDSFKFQPIKQSIVAR  244
            F D  KSS  G+P+ SSR  +Q VK SS  NLSV  SA+   Y LD+  F PIK+SIV+R
Sbjct  17   FLDT-KSSIYGSPL-SSRATIQRVK-SSPQNLSVTMSAATPAYDLDNLTFAPIKESIVSR  73

Query  245  EMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            EMTRRYM DMITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  74   EMTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPN  112



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  80   FDAAKSSFNGTPVVSS--RVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
            FD + SSF+GTP+     R+Q  K+SS  N+S+S S  PY L++FKF+PIK+SIV+REMT
Sbjct  21   FDTS-SSFHGTPISKPTLRMQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMT  79

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM DMIT+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  80   RRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPS  115



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  80   FDAAKSSFNGTPVVSS--RVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
            FD + SSF+GTP+     R+Q  K+SS  N+S+S S  PY L++FKF+PIK+SIV+REMT
Sbjct  21   FDTS-SSFHGTPISKPTLRMQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMT  79

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM DMIT+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  80   RRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPS  115



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 7/93 (8%)
 Frame = +2

Query  95   SSFNGTPVVSS----RVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRY  262
            SSF+GTP+       R+Q  KA    ++S +A   PY L +F+F+PIK+SIV+REMTRRY
Sbjct  21   SSFHGTPLAPPPPCLRLQPAKAGFSVSMSAAA---PYDLKNFRFEPIKESIVSREMTRRY  77

Query  263  MTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            M DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  78   MMDMITYADTDVVVVGAGSAGLSCAYELSKNPD  110



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 10/102 (10%)
 Frame = +2

Query  77   FFDAAKSSFNGTPV------VSSRVQAVKASSFH-NLSVSASHTPYSLDSFKFQPIKQSI  235
             FD   SSF+G+ V      V  R +AV  + F    S  +S  PY L++F+F PIK+SI
Sbjct  18   LFD---SSFHGSAVAVPPVSVGLRSRAVAGNGFSVRASAESSSPPYDLNNFRFSPIKESI  74

Query  236  VAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            V+REMTRRYMTDMITYA+TDV++VGAGSAGLSCA++I+ NPN
Sbjct  75   VSREMTRRYMTDMITYAETDVVIVGAGSAGLSCAYEISKNPN  116



>emb|CDY42479.1| BnaA10g08550D [Brassica napus]
Length=258

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + ++ V   +K  S   +SV AS   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPVSVGLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMT  74

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  75   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  110



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            F D  KSSF+GTP+ ++       S+   +S+S +   Y L SFKFQPIK+SIV+REMTR
Sbjct  17   FLDN-KSSFHGTPITTTTRFTPIKSTSPAISMSLTQPSYDLQSFKFQPIKESIVSREMTR  75

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDM+TYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  76   RYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPS  110



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + ++ V   +K  S   +SV AS   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPVSVGLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMT  74

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  75   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  110



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 75/92 (82%), Gaps = 4/92 (4%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHN---LSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYM  265
            SSF+G P+ S+R  ++K+++  N   +S+S +   Y L++FKF P K+SIV+REMTRRYM
Sbjct  22   SSFHGKPI-STRTTSIKSTTQQNTTTISMSLNSPAYDLEAFKFAPTKESIVSREMTRRYM  80

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDMITYADTDV++VGAGSAGLSCA++++ +P+
Sbjct  81   TDMITYADTDVVIVGAGSAGLSCAYELSKDPS  112



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 5/96 (5%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + +S V   +K  SF  +SV A+   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSSISASPVSVGLKPRSFSTVSVRAT-AGYDLNAFTFAPIKESIVSREMT  73

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  74   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  109



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (84%), Gaps = 3/92 (3%)
 Frame = +2

Query  95   SSFNGTPVV--SSRVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYM  265
            S+F GTPV   S R+Q    ++  ++S+SAS TP Y+L+SFKF PIK+SIV+REMTRRYM
Sbjct  28   SAFYGTPVAAPSLRMQPTSKTNAVSVSMSASSTPSYNLNSFKFDPIKESIVSREMTRRYM  87

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDMI+YADTDV++VGAGSAGLSCA++++ NP+
Sbjct  88   TDMISYADTDVVIVGAGSAGLSCAYELSKNPD  119



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSVS---ASHTPYSLDSFKFQPIKQSIVAREMTRRY  262
            +SSF+G P+          SS  N S+S   AS  PY L++F+F PIK+SIV+REMTRRY
Sbjct  23   ESSFHGVPIKPLSFHFKTKSSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRY  82

Query  263  MTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            M DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  83   MMDMITYADTDVVVVGAGSAGLSCAYELSKNPS  115



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 76/92 (83%), Gaps = 2/92 (2%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSV-SASHTP-YSLDSFKFQPIKQSIVAREMTRRYM  265
            +SSF+G  + ++ ++++      +LSV +AS  P Y LDSF+F+PIK+S+V+REMTRRYM
Sbjct  24   RSSFSGFRLPATALRSLPGRGRPSLSVTAASAAPRYDLDSFRFEPIKESVVSREMTRRYM  83

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDMITYADTDV+V+GAGSAGLSCA++I+ +P+
Sbjct  84   TDMITYADTDVVVIGAGSAGLSCAYEISKDPS  115



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHNLSVS---ASHTPYSLDSFKFQPIKQSIVAREMTRRYM  265
            SSF+G P+          SS  N S+S   AS  PY L++F+F PIK+SIV+REMTRRYM
Sbjct  24   SSFHGVPIKPLSFHFKTKSSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRYM  83

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
             DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  84   MDMITYADTDVVVVGAGSAGLSCAYELSKNPS  115



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + ++ +   +K  S   +SV A+   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPISIGLKPRSGSVVSVRATTAGYDLNAFTFDPIKESIVSREMT  74

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  75   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  110



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +2

Query  125  SRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIV  304
            S V   +A +  N S+SAS  PY L++FKF PIK+SIV+REMTRRYMTDMITYADTDV++
Sbjct  30   SSVATPRAGAICN-SISASTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADTDVVI  88

Query  305  VGAGSAGLSCAHDITTNPN  361
            VGAGSAGLSCA++++ +P+
Sbjct  89   VGAGSAGLSCAYELSKDPS  107



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
             FD   SSF+G+ + ++ +         ++SV AS   Y L++F F PIK+SIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISIGLKPRSASVSVRASTAGYDLNAFTFDPIKESIVSREMTR  74

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  75   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  109



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS--RVQAVKASSFHNLSVS-ASHTPYSLDSFKFQPIKQSIVARE  247
             F+ + SSF GTP+  S  RVQ  KA +  ++S+S A   PY L +F F PIK+SIV+RE
Sbjct  14   LFENSASSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSRE  73

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYM DMITYADTDV+VVGAGS+GL C ++++ NP+
Sbjct  74   MTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPS  110



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 82/105 (78%), Gaps = 14/105 (13%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSS----RVQAVKASSFHNLSVSASHTP------YSLDSFKFQPIK  226
             FD+  S+F GTPV ++    R+Q  K++   ++S+SA +TP      Y+L+SF+F PIK
Sbjct  14   LFDS--SAFYGTPVAAAPPSLRMQPTKSNGV-SISMSA-NTPSSSVPQYNLNSFRFDPIK  69

Query  227  QSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            +SIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  70   ESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPS  114



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 6/95 (6%)
 Frame = +2

Query  92   KSSFNGTPV-----VSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            K+SF+G  +       S V   +A +  N S+S+S  PY L++FKF PIK+SIV+REMTR
Sbjct  10   KTSFSGVRLPAAARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTR  68

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV++VGAGSAGLSCA++++ +P+
Sbjct  69   RYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPS  103



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 6/95 (6%)
 Frame = +2

Query  92   KSSFNGTPV-----VSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            K+SF+G  +       S V   +A +  N S+S+S  PY L++FKF PIK+SIV+REMTR
Sbjct  10   KTSFSGVRLPAAARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTR  68

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV++VGAGSAGLSCA++++ +P+
Sbjct  69   RYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPS  103



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
             FD   SSF+G+ + ++ +         ++SV AS   Y L++F F PIK+SIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISIGLKPRSVSVSVRASTAGYDLNAFTFDPIKESIVSREMTR  74

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  75   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  109



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + ++ V   +K  S   +SV AS   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPVSVGLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMT  74

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMIT A+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  75   RRYMTDMITSAETDVVVVGAGSAGLSCAYEISKNPN  110



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 10/96 (10%)
 Frame = +2

Query  101  FNGTPVV----SSRVQAVKASSFHNLSVS-----ASHTPYSLDSFKFQPIKQSIVAREMT  253
            F+GTP+     S R+ A + SS H+  +S     A+  PY L++F+F PIK+SIV+REMT
Sbjct  21   FHGTPLAPAAQSLRLPAPR-SSAHSSGISMSAAAANPPPYDLNAFRFDPIKESIVSREMT  79

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  80   RRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPD  115



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  164  LSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            +S+S+S+ PY L SF+F PIK+SIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCA++
Sbjct  1    MSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYE  60

Query  344  ITTNP  358
            ++ +P
Sbjct  61   LSKDP  65



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 5/96 (5%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + +S V   +K  S   +SV A+   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSSISASPVSVGLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMT  73

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  74   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  109



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 5/96 (5%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + +S V   +K  S   +SV A+   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSSISASPVSVGLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMT  73

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  74   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  109



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSVS---ASHTPYSLDSFKFQPIKQSIVAREMTRRY  262
            +SSF+G P+          SS  N S+S   AS  PY  ++F+F PIK+SIV+REMTRRY
Sbjct  23   ESSFHGVPIKPLSFHFKTKSSHCNASISMSAASPPPYDFNNFRFDPIKESIVSREMTRRY  82

Query  263  MTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            M DMI YADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  83   MMDMIIYADTDVVVVGAGSAGLSCAYELSKNPS  115



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            F D  KSSF+GTP+ ++       S+   +S+S +       SFKFQPIK+SIV+REMTR
Sbjct  17   FLDT-KSSFHGTPITTTTRFTPIKSTSPAISMSLTQPSCDFQSFKFQPIKESIVSREMTR  75

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDM+TYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  76   RYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPS  110



>gb|AFG52195.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52197.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
Length=66

 Score =   101 bits (251),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+ADTDV++VGAGSAGLSCA++I+ NP+
Sbjct  4    YDLQSFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYEISKNPD  60



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
             FD   SSF+G+ + +     +K  S  ++SV AS   Y L++F F PIK+SIV+REMTR
Sbjct  18   LFD---SSFHGSSISAPISIGLKPRS-GSVSVRASTAGYDLNAFTFDPIKESIVSREMTR  73

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  74   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  108


 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  161  NLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            ++SV AS   Y L++F F PIK+SIV+REMTRRYMTDMITYA+TDV+VVGAGSAGLSCA+
Sbjct  240  SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  299

Query  341  DITTNPN  361
            +I+ NPN
Sbjct  300  EISKNPN  306



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            PY L+SFKF PIK+SIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  2    PYDLNSFKFAPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPS  59



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 10/96 (10%)
 Frame = +2

Query  101  FNGTPVV----SSRVQAVKASSFHNLSVS-----ASHTPYSLDSFKFQPIKQSIVAREMT  253
            F+GTP+     S R+ A + SS H+  +S     A+  PY L++F+F PIK+SIV+REMT
Sbjct  151  FHGTPLAPAAQSLRLPAPR-SSAHSSGISMSAAAANPPPYDLNAFRFDPIKESIVSREMT  209

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYM DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  210  RRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPD  245



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
             FD   SSF+G+ + ++ +         +LSV A+ + Y L++F F PIK+SIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISVGLKPRSASLSVRAT-SGYDLNAFTFDPIKESIVSREMTR  73

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  74   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  108



>gb|AEW09378.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus radiata]
 gb|AFG52194.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52196.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52198.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52199.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
Length=66

 Score =   100 bits (249),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  4    YDLQSFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPD  60



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 62/67 (93%), Gaps = 2/67 (3%)
 Frame = +2

Query  167  SVSASHTP--YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            SV+A+++P  Y L+SFKF PIK+SIV+REMTRRYMTDM+T+ADTDV++VGAGSAGL+CA+
Sbjct  43   SVAAANSPPPYDLNSFKFDPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLTCAY  102

Query  341  DITTNPN  361
            +++ NPN
Sbjct  103  ELSKNPN  109



>gb|AFK49080.1| unknown [Medicago truncatula]
Length=195

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L++FKF PIK+SIVAREMTRRYMTDM+T+ADTDV++VGAGSAGLSCA++++ NPN
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPN  110



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S+S+S+ PY L SF+F PIK+S+V+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCA+++
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  347  TTNP  358
            + +P
Sbjct  107  SKDP  110



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S+S+S+ PY L SF+F PIK+S+V+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCA+++
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  347  TTNP  358
            + +P
Sbjct  107  SKDP  110



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S+S+S+ PY L SF+F PIK+S+V+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCA+++
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  347  TTNP  358
            + +P
Sbjct  107  SKDP  110



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S+S+S+ PY L SF+F PIK+S+V+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCA+++
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  347  TTNP  358
            + +P
Sbjct  107  SKDP  110



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 7/96 (7%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQ-AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + ++ +   +K  SF   SV A+   Y L++F F PIK+SIV+REMT
Sbjct  18   LFD---SSFHGSAISAAPISIGLKPRSF---SVRATTAGYDLNAFTFDPIKESIVSREMT  71

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLS A++I+ NPN
Sbjct  72   RRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPN  107



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 7/79 (9%)
 Frame = +2

Query  125  SRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIV  304
            +R+ A  AS +       S   Y L+++KF+PIK+SIVAREMTRRYMTDMIT+ADTDV+V
Sbjct  44   ARLPAASASMY-------SDAKYDLNNYKFEPIKESIVAREMTRRYMTDMITHADTDVVV  96

Query  305  VGAGSAGLSCAHDITTNPN  361
            VGAGSAGLSCA++++ NPN
Sbjct  97   VGAGSAGLSCAYELSKNPN  115



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  161  NLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            ++S + S+ PY L SF+F PIK+SIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCA+
Sbjct  41   SISSTPSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAY  100

Query  341  DITTNPN  361
            +++ +P+
Sbjct  101  ELSKDPS  107



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 7/79 (9%)
 Frame = +2

Query  125  SRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIV  304
            +RV  V AS +       S   Y L+++KF PIK+SIVAREMTRRYMTDMIT+ADTDV+V
Sbjct  46   TRVPVVSASLY-------SDAKYDLNNYKFDPIKESIVAREMTRRYMTDMITHADTDVVV  98

Query  305  VGAGSAGLSCAHDITTNPN  361
            VGAGSAGLSCA++++ NPN
Sbjct  99   VGAGSAGLSCAYELSKNPN  117



>gb|ACN36998.1| unknown [Zea mays]
Length=218

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +2

Query  167  SVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            S+S+S TP Y L SF+F PIK+SIV+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCA++
Sbjct  46   SISSSPTPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYE  105

Query  344  ITTNPN  361
            ++ +P 
Sbjct  106  LSKDPT  111



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S+S+S+ PY L SF+F PIK+S+V+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCA+++
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  106

Query  347  TTNP  358
            + +P
Sbjct  107  SKDP  110



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDM  274
            S  +G P+   R+  +K SS  + S  +    Y L  FKF+PIK+SIV+REMTRRYM DM
Sbjct  27   SVIHGVPL---RLNYLKCSSSLSASSLSVSAKYDLKDFKFEPIKESIVSREMTRRYMMDM  83

Query  275  ITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            ITYADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  84   ITYADTDVVVVGAGSAGLSCAYELSKNPN  112



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  161  NLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            ++S ++S  PY L + KF PI++SIVAREMTRRYMTDMITYADTDV+++GAGSAGLSCA+
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  341  DITTNPN  361
            +++ NP+
Sbjct  106  ELSKNPD  112



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  161  NLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            ++S ++S  PY L + KF PI++SIVAREMTRRYMTDMITYADTDV+++GAGSAGLSCA+
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  341  DITTNPN  361
            +++ NP+
Sbjct  106  ELSKNPD  112



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  161  NLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            ++S ++S  PY L + KF PI++SIVAREMTRRYMTDMITYADTDV+++GAGSAGLSCA+
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  341  DITTNPN  361
            +++ NP+
Sbjct  106  ELSKNPD  112



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  164  LSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            +  S S+ PY L SFKF PIK+SIV+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCA++
Sbjct  41   IRASISNPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYE  100

Query  344  ITTNPN  361
            ++ +P+
Sbjct  101  LSKDPS  106



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            PY L+SFKF PIK+SIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCA++++ NP
Sbjct  53   PYDLNSFKFNPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNP  109



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
             FD   SSF+G+ + ++ +     S   ++SV A+   Y L++F F PIK+SIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISIGLKSRSVSVSVRAT-AGYDLNAFTFDPIKESIVSREMTR  73

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMIT+A+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  74   RYMTDMITFAETDVVVVGAGSAGLSCAYEISKNPN  108



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 60/65 (92%), Gaps = 1/65 (2%)
 Frame = +2

Query  167  SVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            S+SA+ +P Y L SF+FQPIK+SIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCA++
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  344  ITTNP  358
            ++ NP
Sbjct  102  LSKNP  106



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 60/65 (92%), Gaps = 1/65 (2%)
 Frame = +2

Query  167  SVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            S+SA+ +P Y L SF+FQPIK+SIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCA++
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  344  ITTNP  358
            ++ NP
Sbjct  102  LSKNP  106



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 63/79 (80%), Gaps = 7/79 (9%)
 Frame = +2

Query  125  SRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIV  304
            +R+ A  AS +       S   Y L+++KF+PIK+SIVAREMTRRYMT+MIT+ADTDV+V
Sbjct  31   ARLPAASASMY-------SDAKYDLNNYKFEPIKESIVAREMTRRYMTEMITHADTDVVV  83

Query  305  VGAGSAGLSCAHDITTNPN  361
            VGAGSAGLSCA++++ NPN
Sbjct  84   VGAGSAGLSCAYELSKNPN  102



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S+S+ + PY L SF+F PIK+SIV+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCA+++
Sbjct  46   SISSPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  105

Query  347  TTNP  358
            + +P
Sbjct  106  SKDP  109



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSVSASHT----PYSLDSFKFQPIKQSIVAREMTRR  259
            +SSF+G P+          SS  N SVS S      PY L++F+F PIK+SIV+REMTRR
Sbjct  23   ESSFHGVPITPLSFHLKAKSSPRNASVSMSAASSPPPYDLNNFRFDPIKESIVSREMTRR  82

Query  260  YMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            YM DMIT+ADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  83   YMMDMITHADTDVVVVGAGSAGLSCAYELSKNPS  116



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 8/95 (8%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            F  ++  SF+ TP +  R  A +AS      +SAS  PY   SF+F PI++SIV+REMTR
Sbjct  19   FNKSSSPSFHATPTL--RPLAPRAS------MSASAPPYDFGSFRFDPIRESIVSREMTR  70

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYM DM+T+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  71   RYMIDMVTHADTDVVIVGAGSAGLSCAYELSKNPS  105



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L++FKF PIK+SIVAREMTRRYMTDM+T+ADTDV++VGAGSAGLSCA++++ NPN
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPN  110



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 8/95 (8%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            F  ++  SF+ TP +  R  A +AS      +SAS  PY   SF+F PI++SIV+REMTR
Sbjct  19   FNKSSSPSFHATPTL--RPLAPRAS------MSASAPPYDFGSFRFDPIRESIVSREMTR  70

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYM DM+T+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  71   RYMIDMVTHADTDVVIVGAGSAGLSCAYELSKNPS  105



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L+++KF PIK+SIVAREMTRRYMTDMIT+ADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  60   YDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNPN  116



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L+++KF PIK+SIVAREMTRRYMTDMIT+ADTDV+VVGAGSAGLSCA++++ NPN
Sbjct  60   YDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNPN  116



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 3/69 (4%)
 Frame = +2

Query  164  LSVSASHTP---YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSC  334
            +S S S +P   Y L+ F F PIK+S+VAREMTRRYMTDMITYADTDV++VGAGSAGLSC
Sbjct  45   ISCSNSISPSARYDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSC  104

Query  335  AHDITTNPN  361
            A++++ NPN
Sbjct  105  AYELSKNPN  113



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L+ F F PIK+S+VAREMTRRYMTDMITYADTDV++VGAGSAGLSCA++++ NPN
Sbjct  57   YDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPN  113



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  158  HNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCA  337
             +LSV A+   Y L++F F PIK+SIV+REMTRRYMTDMITYA+TDV+VVGAGSAGLSCA
Sbjct  41   RSLSVRAT-AGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCA  99

Query  338  HDITTNPN  361
            ++I+ NPN
Sbjct  100  YEISKNPN  107



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  158  HNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCA  337
             +LSV A+   Y L++F F PIK+SIV+REMTRRYMTDMITYA+TDV+VVGAGSAGLSCA
Sbjct  41   RSLSVRAT-AGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCA  99

Query  338  HDITTNPN  361
            ++I+ NPN
Sbjct  100  YEISKNPN  107



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S S+S+ PY L SF+F PIK+S+V+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCA+++
Sbjct  47   SFSSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  106

Query  347  TTNP  358
            + +P
Sbjct  107  SKDP  110



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L+SFKF+PI++SIVAREMTRRYM DMIT+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPD  127



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L+SFKF+PI++SIVAREMTRRYM DMIT+ADTDV++VGAGSAGLSCA++++ NP+
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPD  127



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            PY L SF+F PIK+SIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCA++++ +P
Sbjct  56   PYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDP  112



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  182  HTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            + PY L SF+F PIK+SIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCA++++ +P
Sbjct  54   NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDP  112



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  167  SVSASHTP-YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            S+S+S TP Y L SF+F PIK+SIV+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCA++
Sbjct  46   SISSSPTPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYE  105

Query  344  ITTNP  358
            ++ +P
Sbjct  106  LSKDP  110



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  92   KSSFNGTPVVSSRVQAVKASSFHNLSV-SASHTP-YSLDSFKFQPIKQSIVAREMTRRYM  265
            +SSF+G  + ++ + +   S    LSV SA   P Y L SF F+PI++SIV+REMTRRYM
Sbjct  25   RSSFSGLRLAATPLPSHSGSGKAALSVTSALAAPKYDLGSFSFKPIQESIVSREMTRRYM  84

Query  266  TDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TDMI+YADTDV+V+GAGSAGLSCA++I+ +P+
Sbjct  85   TDMISYADTDVVVIGAGSAGLSCAYEISKDPS  116



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 8/96 (8%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTP-YSLDSFKFQPIKQSIVAREMT  253
             FD   SSF+G+ + ++ V      S  + SVS   T  Y L++F F PIK+SIV+REMT
Sbjct  15   LFD---SSFHGSSISAAPVSL----SLKSRSVSVRATAGYDLNAFTFDPIKESIVSREMT  67

Query  254  RRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RRYMTDMITYA+TDV+VVGAGSAGLS A++I+ NPN
Sbjct  68   RRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPN  103



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  182  HTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            + PY L SF+F PIK+S+V+REMTRRYMTDMITYADTDV++VGAGSAGLSCA++++ +P+
Sbjct  49   NPPYDLTSFRFSPIKESVVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPS  108



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L++FKF PIK+SIVAREMTRRYMTDM T+ADTDV++VGAGSAGLSCA++++ NPN
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMATHADTDVVIVGAGSAGLSCAYELSKNPN  110



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  173  SASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            +A+  PY   SF+F+PI++SIV+REMTRRYMTDM+T+ADTDV+VVGAGSAGLSCA++++ 
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  353  NPN  361
            NP+
Sbjct  107  NPS  109



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  173  SASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            +A+  PY   SF+F+PI++SIV+REMTRRYMTDM+T+ADTDV+VVGAGSAGLSCA++++ 
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  353  NPN  361
            NP+
Sbjct  107  NPS  109



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            PY L SFKF PIK+SIV+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCA++++ +P
Sbjct  52   PYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDP  108



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            PY L++ +F PIK+SIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ +P+
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  106



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            PY L++ +F PIK+SIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ +P+
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  106



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 7/101 (7%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASS-----FHNLSVSASHTP-YSLDSFKFQPIKQSIV  238
            F D   SSF+G  +  SRV    A+            +++ TP Y L+S +F PIK+SIV
Sbjct  17   FLDHHHSSFHGLSL-PSRVSTAAAAGRSPSSASLSISASAATPKYDLNSIRFDPIKESIV  75

Query  239  AREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            +REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ +P+
Sbjct  76   SREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  116



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            PY L++ +F PIK+SIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ +P+
Sbjct  52   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  109



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            PY L++ +F PIK+SIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ +P+
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  106



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            PY L++ +F PIK+SIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ +P+
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  106



>ref|XP_008336996.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=160

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 4/71 (6%)
 Frame = +2

Query  161  NLSVSAS----HTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGL  328
             LSVS S    ++ Y L +FKF PIK+SIV+REMTR YMTDMITYADT +++VGAGSAGL
Sbjct  28   GLSVSTSANGLNSSYDLSAFKFDPIKESIVSREMTRHYMTDMITYADTGIVLVGAGSAGL  87

Query  329  SCAHDITTNPN  361
            SCA++++ NP+
Sbjct  88   SCAYELSKNPD  98



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  188  PYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            PY L++ +F PIK+SIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCA++++ +P+
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  106



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF PIK+SIV+REM RRYMTDM+T+ADTDV++VGAGSAGL+CA++++ NPN
Sbjct  63   YDLGSFKFAPIKESIVSREMARRYMTDMVTFADTDVVIVGAGSAGLTCAYELSKNPN  119



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTP--YSLDSFKFQPIKQSIVAREM  250
            F D   SSF+G  ++ SRV A ++ S  +LS+SAS     Y L+S +F PIK+SIV+REM
Sbjct  17   FVDHYHSSFSGL-ILPSRVSATRSHSSPSLSISASAAAPRYDLNSIRFNPIKESIVSREM  75

Query  251  TRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TRRYMTDMIT+ADTDV+V+GAGSAGLSCA++++ +P+
Sbjct  76   TRRYMTDMITHADTDVVVIGAGSAGLSCAYELSKDPS  112



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L+S +F+PIK+SIV+REMTRRYMTDMITYADTDV+V+GAGSAGLSCA++++ +P+
Sbjct  58   YDLNSIRFEPIKESIVSREMTRRYMTDMITYADTDVVVIGAGSAGLSCAYELSKDPS  114



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L SFKF+PI++SIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCA++++ NP+
Sbjct  46   YDLHSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPD  102



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L++F F PIK+SIV+REMTRRYMTDMITYA+TDV+VVGAGSAGLS A++I+ NPN
Sbjct  7    YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPN  63



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 5/82 (6%)
 Frame = +2

Query  125  SRVQAVKASSFHN-----LSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYAD  289
            SRV A  A    N     +S SA+   Y L+S +F PIK+SIV+REMTRRYMTDMIT+AD
Sbjct  34   SRVSAAAAGRSPNSRSLFISASAATPKYDLNSIRFDPIKESIVSREMTRRYMTDMITHAD  93

Query  290  TDVIVVGAGSAGLSCAHDITTN  355
            TDV+V+GAGSAGLSCA++++ +
Sbjct  94   TDVVVIGAGSAGLSCAYELSKD  115



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  206  FKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            FKF+PIK+SIVAREMTRRYM DMITYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  42   FKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPS  93



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  197  LDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            LD+FKF  IK+SIV+RE TRRYMTDMIT+ADTDV+VVGAGSAGLSCA++I+ NPN
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPN  130



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  197  LDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            LD+FKF  IK+SIV+RE TRRYMTDMIT+ADTDV+VVGAGSAGLSCA++I+ NPN
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPN  130



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            Y L++ KF PIK++ V+REMTRRYMTDM+ +A+TDV+V+GAGSAGLSCA +++ NPN
Sbjct  31   YDLNNLKFNPIKEADVSREMTRRYMTDMLDHAETDVVVIGAGSAGLSCAWELSKNPN  87



>ref|XP_001754158.1| predicted protein [Physcomitrella patens]
 gb|EDQ81059.1| predicted protein [Physcomitrella patens]
Length=233

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  179  SHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            S   Y  +++ F PIK+SIVAREMTRRYMTDMIT+ADTDV+VV AGSA LSCA++++ NP
Sbjct  72   SDAKYDQNNYTFDPIKESIVAREMTRRYMTDMITHADTDVMVVDAGSARLSCAYELSKNP  131

Query  359  N  361
            +
Sbjct  132  S  132



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  167  SVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            S+S+   PY L SFKF P+K+S+ +REM RRYMTDMI   +TDVI++G GSAGLSCA+++
Sbjct  42   SISSCTPPYDLSSFKFSPMKESVASREMIRRYMTDMIADVNTDVIIIGTGSAGLSCAYEL  101

Query  347  TTNPN  361
            + +P+
Sbjct  102  SKDPS  106



>ref|XP_004496859.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=360

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDM  274
            S FNG  + +     +K++S +N S+S S   ++L SFKF+PI++SIV+RE++R Y+T+M
Sbjct  56   SFFNGRTIATHTSHIIKSTSHNNSSISMSLNTHNLHSFKFKPIEESIVSREISRCYITNM  115

Query  275  ITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            +TY  TDV+++G  S+GLSCA+ ++ NPN
Sbjct  116  VTY--TDVVILGDSSSGLSCAYGLSKNPN  142



>ref|XP_005648929.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE24385.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
Length=317

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  143  KASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSA  322
            +A+  H L+ + S TP+  D+FKF+PI +  V+R MT RY  D+  YA+TDVI+VGAGSA
Sbjct  7    RAADAHRLNQAFSETPF--DNFKFEPITEHQVSRAMTSRYFKDLDEYAETDVIIVGAGSA  64

Query  323  GLSCAHDITTNPN  361
            GLSCA++++  PN
Sbjct  65   GLSCAYELSKYPN  77



>gb|EPB86412.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  152  SFHNLSVSASHTPY----SLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGS  319
            S H L  ++ + P       D++KF PI++S V+REM  RYM DM+ YA++DV++VG GS
Sbjct  13   SGHRLGGASEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  72

Query  320  AGLSCAHDITTNP  358
            AGLSCA +++ +P
Sbjct  73   AGLSCAWELSKDP  85



>dbj|GAN03507.1| thiamin biosynthetic enzyme [Mucor ambiguus]
Length=313

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  152  SFHNLSVSASHTPY----SLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGS  319
            S H L  +  + P       D++KF PI++S V+REM  RYM DM+ YA++DV++VG GS
Sbjct  15   SGHRLGGANEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  74

Query  320  AGLSCAHDITTNP  358
            AGLSCA +++ +P
Sbjct  75   AGLSCAWELSKDP  87



>emb|CEI86767.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=189

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            D++KF PI++S V+REM  RYM DM+ YA++DV++VG GSAGLSCA +++ +P
Sbjct  30   DNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDP  82



>emb|CEG62855.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=307

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            D++KF PI++S V+REM  RYM DM+ YA++DV++VG GSAGLSCA +++ +P+
Sbjct  30   DNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPS  83



>emb|CEG76808.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=261

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNP  358
            D++KF PI++S V+REM  RYM DM+ YA++DV++VG GSAGLSCA +++ +P
Sbjct  30   DNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDP  82



>emb|CEI86769.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=273

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            D++KF PI++S V+REM  RYM DM+ YA++DV++VG GSAGLSCA +++ +P+
Sbjct  30   DNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPS  83



>gb|EIE83081.1| thiazole biosynthetic enzyme, chloroplastic [Rhizopus delemar 
RA 99-880]
Length=305

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            D +KF PI++S V+REM  RYM DM+ YA++DV++VG GSAGLSCA +++ +P+
Sbjct  28   DGYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPS  81



>gb|EYU27823.1| hypothetical protein MIMGU_mgv1a009995mg [Erythranthe guttata]
Length=325

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 32/95 (34%)
 Frame = +2

Query  77   FFDAAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTR  256
            FFD  KSSF+G+P VS+R              +A+H           PIK         +
Sbjct  18   FFDTNKSSFHGSP-VSTR--------------AAAH-----------PIKSG------PQ  45

Query  257  RYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            RYMTDMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  46   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPD  80



>ref|XP_007794010.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
 gb|EMR66906.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
Length=326

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  104  NGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITY  283
             G PV + ++    A+   NL+V  S      + F F+PI++S VAR M RRY TD+ TY
Sbjct  18   GGVPVSNGKIHQANANGGKNLAVGDSK----WEEFSFEPIRESQVARAMVRRYFTDLDTY  73

Query  284  ADTDVIVVGAGSAGLSCAHDI  346
            A++D+++VGAGS GLS A+ +
Sbjct  74   AESDIVIVGAGSCGLSTAYTL  94



>gb|KCW75370.1| hypothetical protein EUGRSUZ_E04118 [Eucalyptus grandis]
Length=234

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  170  VSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDIT  349
            +S    PY L  F+F+PIK+ I++ EMT R M DMITY++TDVIVVG  SAG S A++++
Sbjct  26   MSPGSIPYDLRLFEFEPIKEFIMSHEMTCRSMMDMITYSETDVIVVGVSSAGFSYAYELS  85

Query  350  TNPN  361
             NP+
Sbjct  86   KNPS  89



>emb|CDY41008.1| BnaA02g27980D [Brassica napus]
Length=280

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYMTDMITYA+TDV+VVGAGSAGLSCA++I+ NPN
Sbjct  1    MTRRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPN  38



>ref|XP_002784437.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER16233.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=325

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            YS +  +F PI++S V+REMT RYM D+  +ADTDV++ GAGSAGLS A++++ NPN
Sbjct  27   YSPEFSRFAPIRESEVSREMTTRYMKDLYDFADTDVVITGAGSAGLSAAYELSKNPN  83



>emb|CEP18429.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTN  355
            D++KF PI++S V+REM  RYM DM+ YA++DV++VG GSAGLSCA +++ +
Sbjct  32   DNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKD  83



>gb|KDO30626.1| hypothetical protein SPRG_04526 [Saprolegnia parasitica CBS 223.65]
Length=334

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  173  SASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            +A  TP+  D + F P+K++ V+REMT RYM DM  YAD+DVI+ GAGSAGL  A++++ 
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDYADSDVIIAGAGSAGLCAAYELSK  99

Query  353  NPN  361
             PN
Sbjct  100  YPN  102



>ref|XP_002172093.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
 gb|EEB05800.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
Length=326

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            + FKF PI++SIVAR M +RY  D+ TYA++D+++VGAGSAGL+CA+ I T
Sbjct  41   EDFKFAPIRESIVARAMIKRYWKDLETYAESDIVIVGAGSAGLTCAYYIGT  91



>gb|ABK95834.1| unknown [Populus trichocarpa]
Length=278

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYMTDM+TYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  1    MTRRYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPS  38



>ref|XP_009844132.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 ref|XP_009844133.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
 gb|ETV66357.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 gb|ETV66358.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
Length=333

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  173  SASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            +A  TP+  D + F P+K++ V+REMT RYM DM  +AD+DVI+ GAGSAGL  A++++ 
Sbjct  41   AARTTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  98

Query  353  NPN  361
            +PN
Sbjct  99   HPN  101



>emb|CBI23938.3| unnamed protein product [Vitis vinifera]
Length=212

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYM DMITYADTDV+VVGAGSAGLSCA++++ NP+
Sbjct  1    MTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPS  38



>ref|XP_008616182.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
 gb|EQC30329.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
Length=334

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  173  SASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            +A  TP+  D + F P+K++ V+REMT RYM DM  +AD+DVI+ GAGSAGL  A++++ 
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  99

Query  353  NPN  361
             PN
Sbjct  100  YPN  102



>gb|KID99833.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
majus ARSEF 297]
Length=323

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 54/77 (70%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  TPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYAD  289
            TP  SS++ AVKA S +  ++      +  D+FKF PI++S V+R MTRRY  D+ TYA+
Sbjct  18   TPTSSSKL-AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFQDLDTYAE  74

Query  290  TDVIVVGAGSAGLSCAH  340
            +D++++GAGS GLS A+
Sbjct  75   SDIVIIGAGSCGLSAAY  91



>ref|XP_007821738.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EFY99491.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EXV04465.1| Thi4 family protein [Metarhizium robertsii]
 gb|KFG84393.1| thiazole biosynthetic enzyme variant 1 [Metarhizium anisopliae]
 gb|KID68776.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
anisopliae ARSEF 549]
 gb|KID80311.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
brunneum ARSEF 3297]
Length=323

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 54/77 (70%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  TPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYAD  289
            TP  SS++ AVKA S +  ++      +  D+FKF PI++S V+R MTRRY  D+ TYA+
Sbjct  18   TPTSSSKL-AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDTYAE  74

Query  290  TDVIVVGAGSAGLSCAH  340
            +D++++GAGS GLS A+
Sbjct  75   SDIVIIGAGSCGLSAAY  91



>emb|CDP05793.1| unnamed protein product [Coffea canephora]
Length=280

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  248  MTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            MTRRYM DMITYADTDV++VGAGSAGLSCA++++ NP+
Sbjct  1    MTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPS  38



>ref|XP_008877253.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
 ref|XP_008877254.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94050.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94051.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
Length=333

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            D + F P+K++ V+REMT RYM DM  +AD+DVI+ GAGSAGL  A++++ +PN
Sbjct  48   DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSKHPN  101



>emb|CAA57779.1| nmt2 [Schizosaccharomyces pombe]
Length=301

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  167  SVSASHTPYSLD-SFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            ++S ++  YSLD SF F PI++S V+R MTRRY +D+  YA++D+++VGAGSAGL+ A+ 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  344  ITT  352
            I T
Sbjct  95   IGT  97



>ref|NP_596642.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 sp|P40998.2|THI4_SCHPO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 emb|CAA21093.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe]
Length=328

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  167  SVSASHTPYSLD-SFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            ++S ++  YSLD SF F PI++S V+R MTRRY +D+  YA++D+++VGAGSAGL+ A+ 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  344  ITT  352
            I T
Sbjct  95   IGT  97



>ref|XP_001904665.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP64572.1| unnamed protein product [Podospora anserina S mat+]
Length=276

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            DSF F PI++S V+R MTRRY  D+ TY ++D+ +VGAGSAGLSCA+ + T
Sbjct  75   DSFTFAPIRESTVSRAMTRRYFNDLDTYTESDITIVGAGSAGLSCAYVLGT  125



>gb|ESW99744.1| Thiamine thiazole synthase [Ogataea parapolymorpha DL-1]
Length=304

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            Y  D+FKF PI++S V+R MTRRY  D+  YA++D+++VGAGSAGLS A+
Sbjct  21   YDWDTFKFAPIRESTVSRAMTRRYFADLDKYAESDIVIVGAGSAGLSAAY  70



>gb|KID90425.1| thiazole biosynthetic enzyme variant 1 [Metarhizium guizhouense 
ARSEF 977]
Length=323

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  TPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYAD  289
            TP   S++ AVKA S +  ++      +  D+FKF PI++S V+R MTRRY  D+ TYA+
Sbjct  18   TPTSGSKL-AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDTYAE  74

Query  290  TDVIVVGAGSAGLSCAH  340
            +D++++GAGS GLS A+
Sbjct  75   SDIVIIGAGSCGLSAAY  91



>ref|XP_005834399.1| putative THI4, thiamine [Guillardia theta CCMP2712]
 gb|EKX47419.1| putative THI4, thiamine [Guillardia theta CCMP2712]
Length=325

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  185  TPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDIT  349
            TP+  D +KF+PI+++ V R MT RY  D+  YA++D+++VGAGSAGLSCA++++
Sbjct  37   TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGSAGLSCAYELS  89



>emb|CAH25337.1| thiazole biosynthetic enzyme [Guillardia theta]
Length=328

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  185  TPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDIT  349
            TP+  D +KF+PI+++ V R MT RY  D+  YA++D+++VGAGSAGLSCA++++
Sbjct  40   TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGSAGLSCAYELS  92



>ref|XP_007807526.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
 gb|EFY92948.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
Length=350

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  TPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYAD  289
            TP  SS++ AVKA S +  ++      +  D+FKF PI++S V+R MTRRY  D+  YA+
Sbjct  45   TPTSSSKL-AVKAGSNNTQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDAYAE  101

Query  290  TDVIVVGAGSAGLSCAH  340
            +D++++GAGS GLS A+
Sbjct  102  SDIVIIGAGSCGLSAAY  118



>gb|EPB91714.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  149  SSFHNLSVSASHTP----YSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAG  316
            +S H L     + P       + +KF PI++S V+REM  RYM DM+ YA++DV++VG G
Sbjct  12   ASGHRLGGPNEYKPDMKYEDFNGYKFAPIRESQVSREMVTRYMNDMLYYAESDVVIVGCG  71

Query  317  SAGLSCAHDITTN  355
            SA LSCA +++ +
Sbjct  72   SANLSCAWELSKD  84



>gb|KIW79545.1| thiamine thiazole synthase [Fonsecaea pedrosoi CBS 271.37]
Length=329

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 11/94 (12%)
 Frame = +2

Query  80   FDAAKSSFNGTP-----VVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAR  244
            FDA    +NGT       V +   A+KA+  HN  +      +  D+FKF PI++S V+R
Sbjct  11   FDA----YNGTKELKQGAVGTTKVALKAAGEHNNLLEQFGDKW--DAFKFAPIRESQVSR  64

Query  245  EMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
             MTRRY  D+  YA++DV++VGAGS GLS A+ +
Sbjct  65   AMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTL  98



>ref|XP_005847930.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
 gb|EFN55828.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
Length=300

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +2

Query  185  TPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TP+  D FKF+ I++S ++R MT+RY  D+  +A+ DV++VGAGSAGLSCA++++  P+
Sbjct  3    TPF--DGFKFESIRESQISRAMTQRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPD  59



>emb|CDP29968.1| Putative mitochondrial thiazole biosynthetic enzyme precursor 
[Podospora anserina S mat+]
Length=357

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  194  SLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            + DSF F PI++S V+R MTRRY  D+ TY ++D+ +VGAGSAGLSCA+ + T
Sbjct  73   NWDSFTFAPIRESTVSRAMTRRYFNDLDTYTESDITIVGAGSAGLSCAYVLGT  125



>ref|XP_007591792.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
 gb|EXF84591.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY +D+ TYA++DV++VGAGS GLS A+
Sbjct  47   DSFKFAPIRESQVSRAMTRRYFSDLDTYAESDVVIVGAGSCGLSTAY  93



>ref|XP_001698672.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
 sp|A8J9T5.1|THI4_CHLRE RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|EDO99354.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
Length=357

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = +2

Query  185  TPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            TPY  D +KF PI+++ V R MTRRY  DM  +A++DV++VGAGSAGL+CA ++
Sbjct  59   TPY--DDYKFAPIREAEVNRAMTRRYFKDMDEFAESDVVIVGAGSAGLACAFEL  110



>ref|XP_002541542.1| thiazole biosynthesis enzyme [Uncinocarpus reesii 1704]
 gb|EEP76209.1| thiazole biosynthesis enzyme [Uncinocarpus reesii 1704]
Length=324

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            DSFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+ + T
Sbjct  42   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAT  92



>gb|EIF46156.1| thiazole biosynthetic enzyme [Brettanomyces bruxellensis AWRI1499]
Length=326

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = +2

Query  110  TPVVSSRVQAVKASSFHNLSVSASHTP--------YSLDSFKFQPIKQSIVAREMTRRYM  265
            T V+S   +  K S  H  +V    +P        +  D+FKF PI++S V+R MT RY 
Sbjct  9    TTVISQTEEQXKLS-LHTTNVYNKKSPVGKTTEAVFDWDTFKFAPIRESQVSRAMTSRYF  67

Query  266  TDMITYADTDVIVVGAGSAGLSCAH  340
             D+  YA++D+++VGAGSAGL+CA+
Sbjct  68   KDLNKYAESDIVIVGAGSAGLTCAY  92



>ref|XP_004198891.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE82554.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +2

Query  131  VQAVKASSFHNLSVSASHTPYSL---DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVI  301
            ++  K +   NL+ + S+   S    D FKF PI++S V+R MT+RY  D+  YA++DV+
Sbjct  17   LKGSKEAKVVNLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESDVV  76

Query  302  VVGAGSAGLSCAHDITTN  355
            ++GAGSAGLS A+ +  N
Sbjct  77   IIGAGSAGLSAAYVLAKN  94



>ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
 gb|EGX96980.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
Length=330

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = +2

Query  110  TPVVSSRVQAVKASSFHN-LSVSASHTPY--------SLDSFKFQPIKQSIVAREMTRRY  262
            +P   + V   KA+S HN ++V A+ +            DSFKF PI++S V+R MTRRY
Sbjct  8    SPPQYAAVPVTKAASGHNAVAVPAADSTRLAIDDMLGQWDSFKFAPIRESQVSRAMTRRY  67

Query  263  MTDMITYADTDVIVVGAGSAGLSCAH  340
              D+ TYA++D++++GAGS GLS A+
Sbjct  68   FEDLDTYAESDIVIIGAGSCGLSAAY  93



>ref|XP_008026201.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
 gb|EOA86208.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
Length=335

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  137  AVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAG  316
            AVKA++    + + +   ++ DSF F PI++S V+R MTRRY  D+ TYA++DV++VGAG
Sbjct  30   AVKAAA-SGQAKTVAELEHNWDSFAFAPIRESQVSRAMTRRYFADLDTYAESDVVIVGAG  88

Query  317  SAGLSCAHDITTN  355
            S GLS A  + T 
Sbjct  89   SCGLSTAFTLATK  101



>gb|AAF25444.1|AF217503_1 putative thiazole synthase [Aspergillus oryzae]
 gb|ADM43597.1| ThiA protein [Cloning vector pSK485]
 gb|EIT72848.1| protein involved in thiamine biosynthesis and DNA damage tolerance 
[Aspergillus oryzae 3.042]
 gb|KDE83469.1| hypothetical protein AO1008_10087 [Aspergillus oryzae 100-8]
Length=327

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +2

Query  89   AKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMT  268
            A +   G  VVS  V    AS    L     H     D FKF PI++S V+R MTRRY  
Sbjct  13   AATGLKGKVVVSETVPVEGASQTKLLD----HFGGKWDEFKFAPIRESQVSRAMTRRYFE  68

Query  269  DMITYADTDVIVVGAGSAGLSCAH  340
            D+  YA++DV++VGAGS GLS A+
Sbjct  69   DLDKYAESDVVIVGAGSCGLSTAY  92



>ref|XP_001267966.1| thiazole biosynthesis enzyme [Aspergillus clavatus NRRL 1]
 gb|EAW06540.1| thiazole biosynthesis enzyme [Aspergillus clavatus NRRL 1]
Length=331

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = +2

Query  86   AAKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYM  265
            A  +   G  VV   V A   S  H L     H     D FKF PI++S V+R MTRRY 
Sbjct  13   APTAGLKGKVVVPETVPASGTSQTHLLD----HFGGKWDDFKFAPIRESQVSRAMTRRYF  68

Query  266  TDMITYADTDVIVVGAGSAGLSCAH  340
             D+  YA++D+++VGAGS GLS A+
Sbjct  69   QDLDKYAESDIVIVGAGSCGLSTAY  93



>gb|ABR01228.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01230.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01236.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
Length=340

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = +2

Query  185  TPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTNPN  361
            TP+  D FKF+ I++S ++R MT RY  D+  +A+ DV++VGAGSAGLSCA++++  P+
Sbjct  46   TPF--DGFKFESIRESQISRAMTSRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPD  102



>ref|XP_004199741.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE81622.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +2

Query  161  NLSVSASHTPYSL---DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLS  331
            NL+ + S+   S    D FKF PI++S V+R MT+RY  D+  YA++DV+++GAGSAGLS
Sbjct  27   NLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESDVVIIGAGSAGLS  86

Query  332  CAHDITTN  355
             A+ +  N
Sbjct  87   AAYVLAKN  94



>ref|XP_001247344.1| thiazole biosynthetic enzyme, mitochondrial precursor [Coccidioides 
immitis RS]
 gb|KJF60209.1| thiamine thiazole synthase [Coccidioides immitis RS]
 gb|KJF60210.1| thiamine thiazole synthase, variant [Coccidioides immitis RS]
Length=328

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAY  92



>ref|XP_009853231.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO55392.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ69381.1| CyPBP37 protein [Neurospora tetrasperma FGSC 2509]
Length=344

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            D+F F PI++S V+R MTRRY  D+  +A+TD+++VGAGS GLSCA+ ++T
Sbjct  50   DAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSCAYVLST  100



>gb|EFW21941.1| thiazole biosynthetic enzyme [Coccidioides posadasii str. Silveira]
Length=328

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAY  92



>gb|KDB14289.1| thiazole biosynthetic enzyme variant 1 [Ustilaginoidea virens]
Length=321

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  43   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIVGAGSCGLSAAY  89



>ref|XP_003066032.1| thiazole biosynthetic enzyme, mitochondrial precursor, putative 
[Coccidioides posadasii C735 delta SOWgp]
 gb|EER23887.1| thiazole biosynthetic enzyme, mitochondrial precursor, putative 
[Coccidioides posadasii C735 delta SOWgp]
Length=328

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAY  92



>ref|XP_007586590.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD45932.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
Length=329

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  161  NLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            N+S +        ++FKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  34   NMSKTVDEMAGQWENFKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAY  93

Query  341  DI  346
             I
Sbjct  94   MI  95



>gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe typhina]
 gb|ABN45969.1| thiazole biosynthetic enzyme variant 2 [Epichloe typhina]
 gb|ABN45970.1| thiazole biosynthetic enzyme variant 3 [Epichloe typhina]
 gb|ABN45971.1| thiazole biosynthetic enzyme variant 4 [Epichloe typhina]
 gb|ABN45972.1| thiazole biosynthetic enzyme variant 5 [Epichloe typhina]
Length=320

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  42   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIVGAGSCGLSAAY  88



>ref|XP_003005955.1| STI35 protein [Verticillium alfalfae VaMs.102]
 gb|EEY17799.1| STI35 protein [Verticillium alfalfae VaMs.102]
Length=292

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  ASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            A  T  + D+F F+PI++S VAR M RRY  D+ TYA++DV++VGAGS GLS A+ +
Sbjct  32   APKTNSNWDAFAFEPIRESQVARTMGRRYFEDLDTYAESDVVIVGAGSCGLSAAYSL  88



>gb|KHN95056.1| thiazole biosynthetic enzyme variant 1 [Metarhizium album ARSEF 
1941]
Length=321

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+ TYA++D++++GAGS GLS A+
Sbjct  43   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIIGAGSCGLSAAY  89



>ref|XP_002419419.1| thiamine biosynthesis enzyme, putative; thiazole biosynthetic 
enzyme, putative [Candida dubliniensis CD36]
 emb|CAX43013.1| thiamine biosynthesis enzyme, putative [Candida dubliniensis 
CD36]
Length=354

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +2

Query  95   SSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDM  274
             SF+  P  + +V  +K+ +  N  VS ++     D FKF PI++S V+R MTRRY  D+
Sbjct  13   ESFSLNPKFTQQVINLKSDA-KNGKVSFAN----WDEFKFAPIRESTVSRAMTRRYFADL  67

Query  275  ITYADTDVIVVGAGSAGLSCAHDITTN  355
              +A++D++++GAGSAGLS A+ +  N
Sbjct  68   DKFAESDIVIIGAGSAGLSAAYTLGKN  94



>ref|XP_009648318.1| STI35 protein [Verticillium dahliae VdLs.17]
 gb|EGY17455.1| STI35 protein [Verticillium dahliae VdLs.17]
Length=318

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  ASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            A  T  + D+F F+PI++S VAR M RRY  D+ TYA++DV++VGAGS GLS A+ +
Sbjct  32   APKTNSNWDAFAFEPIRESQVARTMGRRYFEDLDTYAESDVVIVGAGSCGLSAAYSL  88



>ref|XP_007376158.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW31380.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
Length=353

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  194  SLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTN  355
            + D FKF PI++S V+R MTRRY  D+  Y ++DV++VGAGSAGLS A+ +  N
Sbjct  42   NWDKFKFAPIRESTVSRAMTRRYFADLDKYTESDVVIVGAGSAGLSAAYVLAKN  95



>ref|XP_499918.1| YALI0A09768p [Yarrowia lipolytica]
 sp|Q3V7I4.1|THI4_YARLI RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Yarrowia lipolytica CLIB122]
 emb|CAG83845.1| YALI0A09768p [Yarrowia lipolytica CLIB122]
Length=317

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  158  HNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCA  337
              L+ S  HT    +SFKF PI++S V+R MTRRY  D+  YA++DV+++GAGS GLS A
Sbjct  27   QKLTKSDEHT---WESFKFAPIRESTVSRAMTRRYFEDLDKYAESDVVIIGAGSCGLSAA  83

Query  338  H  340
            +
Sbjct  84   Y  84



>gb|KHC63824.1| thiazole biosynthesis enzyme [Candida albicans P75010]
Length=354

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTN  355
            + FKF PI++SIV+R MTRRY  D+  +A++D++++GAGSAGLS A+ +  N
Sbjct  43   NEFKFAPIRESIVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKN  94



>gb|EMG50374.1| hypothetical protein G210_4595 [Candida maltosa Xu316]
Length=329

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  197  LDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTN  355
             ++FKF PI++S VAREM RRY  D+  YA++DV+V+G GSAG S A+ +  N
Sbjct  41   WENFKFAPIRESQVAREMGRRYFQDLDKYAESDVVVIGGGSAGFSAAYTLAKN  93



>emb|CDG58548.1| Thi4-1 protein [Verticillium longisporum]
Length=336

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  ASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            A  T  + D+F F+PI++S VAR M RRY  D+ TYA++DV++VGAGS GLS A+ +
Sbjct  32   APKTNSNWDAFAFEPIRESQVARTMGRRYFEDLDTYAESDVVIVGAGSCGLSAAYSL  88



>emb|CDG58546.1| Thi4 protein [Verticillium dahliae JR2]
Length=336

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  ASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            A  T  + D+F F+PI++S VAR M RRY  D+ TYA++DV++VGAGS GLS A+ +
Sbjct  32   APKTNSNWDAFAFEPIRESQVARTMGRRYFEDLDTYAESDVVIVGAGSCGLSAAYSL  88



>gb|KIV92747.1| thiamine thiazole synthase [Exophiala mesophila]
 gb|KIV92748.1| thiamine thiazole synthase, variant 1 [Exophiala mesophila]
 gb|KIV92749.1| thiamine thiazole synthase, variant 2 [Exophiala mesophila]
Length=330

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            DSFKF PI++S V+R MTRRY  D+  YA++DV++VGAGS GLS A+ +
Sbjct  51   DSFKFAPIRESQVSRAMTRRYFADLDKYAESDVVIVGAGSCGLSAAYTL  99



>emb|CDG58547.1| Thi4 protein [Verticillium albo-atrum]
Length=336

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  ASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            A  T  + D+F F+PI++S VAR M RRY  D+ TYA++DV++VGAGS GLS A+ +
Sbjct  32   APKTNSNWDAFAFEPIRESQVARTMGRRYFEDLDTYAESDVVIVGAGSCGLSAAYSL  88



>gb|EPX71211.1| thiazole biosynthetic enzyme [Schizosaccharomyces octosporus 
yFS286]
Length=327

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +2

Query  101  FNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDS-FKFQPIKQSIVAREMTRRYMTDMI  277
            FN  P+   +  A+  +  + L+ S  +  Y LD+ F F PI++S V+R MTRRY  D+ 
Sbjct  14   FNADPLKVDKEDALVKTEQNALTKSFPN--YQLDNEFTFSPIRESTVSRAMTRRYFADLD  71

Query  278  TYADTDVIVVGAGSAGLSCAHDITT  352
             YA++D+++VGAGSAGL+ A+ + T
Sbjct  72   KYAESDIVIVGAGSAGLTAAYYLGT  96



>ref|XP_003344754.1| hypothetical protein SMAC_06409 [Sordaria macrospora k-hell]
 emb|CCC13190.1| unnamed protein product [Sordaria macrospora k-hell]
Length=319

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITT  352
            D+F F PI++S V+R MTRRY  D+  +A++D+++VGAGS GLSCA+ ++T
Sbjct  52   DAFTFSPIRESTVSRAMTRRYFADLDAHAESDIVIVGAGSCGLSCAYVLST  102



>emb|CDG58549.1| Thi4-2 protein [Verticillium longisporum]
Length=336

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  ASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            A  T  + D+F F+PI++S VAR M RRY  D+ TYA++DV++VGAGS GLS A+ +
Sbjct  32   AHKTNSNWDAFAFEPIRESQVARTMGRRYFEDLDTYAESDVVIVGAGSCGLSAAYSL  88



>ref|XP_002797266.1| thiazole biosynthesis enzyme [Paracoccidioides sp. 'lutzii' Pb01]
Length=332

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            D FKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAY  92



>ref|XP_001819323.1| thiazole biosynthetic enzyme [Aspergillus oryzae RIB40]
 sp|Q9UUZ9.2|THI4_ASPOR RecName: Full=Thiamine thiazole synthase; AltName: Full=Pyrithiamine 
resistance protein; AltName: Full=Thiazole biosynthetic 
enzyme [Aspergillus oryzae RIB40]
 dbj|BAE57321.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=327

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 4/84 (5%)
 Frame = +2

Query  89   AKSSFNGTPVVSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMT  268
            A +   G  VVS       AS    L     H     D FKF PI++S V+R MTRRY  
Sbjct  13   AATGLKGKVVVSETAPVEGASQTKLLD----HFGGKWDEFKFAPIRESQVSRAMTRRYFE  68

Query  269  DMITYADTDVIVVGAGSAGLSCAH  340
            D+  YA++DV++VGAGS GLS A+
Sbjct  69   DLDKYAESDVVIVGAGSCGLSTAY  92



>gb|EEH19379.2| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb03]
Length=332

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            D FKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAY  92



>gb|KIX08964.1| thiamine thiazole synthase [Rhinocladiella mackenziei CBS 650.93]
Length=329

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  182  HTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            H     D+FKF PI++S V+R MTRRY  D+  YA++DV++VGAGS GLS A+ +
Sbjct  44   HFAGKWDAFKFDPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTL  98



>ref|XP_010759569.1| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb18]
 gb|EEH47624.1| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb18]
Length=332

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            D FKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAY  92



>ref|XP_003851349.1| hypothetical protein MYCGRDRAFT_44262 [Zymoseptoria tritici IPO323]
 gb|EGP86325.1| hypothetical protein MYCGRDRAFT_44262 [Zymoseptoria tritici IPO323]
Length=318

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  203  SFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            SFKF PI++S V+R MTRRY +D+ TYA++D+++VGAGS GLS A+
Sbjct  37   SFKFAPIRESQVSRAMTRRYFSDLDTYAESDIVIVGAGSCGLSAAY  82



>dbj|GAM35876.1| thiazole biosynthetic enzyme [Talaromyces cellulolyticus]
Length=334

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+  YA++D+++VGAGS GLS A+
Sbjct  50   DSFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAY  96



>ref|XP_009154920.1| thiazole biosynthetic enzyme, mitochondrial [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY54459.1| thiazole biosynthetic enzyme, mitochondrial [Exophiala dermatitidis 
NIH/UT8656]
Length=331

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +2

Query  161  NLSVSASHTPY------SLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSA  322
            N + +A+HT          D+FKF PI++S V+R MTRRY  D+  YA++DV++VGAGS 
Sbjct  33   NANGNATHTKLLDEFGGKWDAFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSC  92

Query  323  GLSCAHDI  346
            GLS A+ +
Sbjct  93   GLSTAYTL  100



>ref|XP_002479053.1| thiazole biosynthesis enzyme [Talaromyces stipitatus ATCC 10500]
 gb|EED22090.1| thiazole biosynthesis enzyme [Talaromyces stipitatus ATCC 10500]
Length=333

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            DSFKF PI++S V+R MTRRY  D+  YA++D+++VGAGS GLS A+
Sbjct  49   DSFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAY  95



>gb|ACN39013.1| thiazole synthase [Epichloe festucae]
Length=320

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            +SFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  42   NSFKFAPIRESQVSRAMTRRYFQDLDTYAESDIVIVGAGSCGLSAAY  88



>gb|EPY53594.1| thiazole biosynthetic enzyme [Schizosaccharomyces cryophilus 
OY26]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +2

Query  167  SVSASHTPYSLD-SFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHD  343
            +++ S   Y LD +F F PI++S V+R MTRRY  D+  YA++D+++VGAGSAGL+ A+ 
Sbjct  33   TLAKSFPTYQLDDAFNFSPIRESTVSRAMTRRYFADLDKYAESDIVIVGAGSAGLTAAYY  92

Query  344  ITT  352
            + T
Sbjct  93   LGT  95



>ref|XP_001227644.1| thiazole biosynthetic enzyme, mitochondrial precursor [Chaetomium 
globosum CBS 148.51]
 gb|EAQ83313.1| thiazole biosynthetic enzyme, mitochondrial precursor [Chaetomium 
globosum CBS 148.51]
Length=329

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  161  NLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
             L+ S +    S D+F F PI++S V+R MTRRY  D+ T+A++D+++VGAGS GLS A+
Sbjct  36   GLTKSLNEMMGSWDNFTFAPIRESTVSRAMTRRYFADLDTHAESDIVIVGAGSCGLSAAY  95

Query  341  DITT  352
             + T
Sbjct  96   TLGT  99



>ref|XP_007835960.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
 gb|ETS79335.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
Length=326

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 8/82 (10%)
 Frame = +2

Query  104  NGTPVVSSRVQAVKASSFHNLSVSASHTPYS-LDSFKFQPIKQSIVAREMTRRYMTDMIT  280
             G P+  S+V +       N+ V+      S  + F FQPI++S +AREM RRY  D+  
Sbjct  19   GGVPMADSKVHS-------NMEVATGAAVGSKWEDFTFQPIRESQIAREMARRYFADLDK  71

Query  281  YADTDVIVVGAGSAGLSCAHDI  346
            YA++D++++GAGS GLS A+ +
Sbjct  72   YAESDIVIIGAGSCGLSTAYTL  93



>gb|KIL95952.1| hypothetical protein FAVG1_00690 [Fusarium avenaceum]
Length=322

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            D FKF PI++S V+R MTRRY  D+ TYA++D++++GAGS GLS A+
Sbjct  44   DDFKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIIGAGSCGLSAAY  90



>gb|ABN45974.1| thiazole biosynthetic enzyme variant 1 [Epichloe festucae var. 
lolii]
 gb|ABN45975.1| thiazole biosynthetic enzyme variant 2 [Epichloe festucae var. 
lolii]
 gb|ABN45976.1| thiazole biosynthetic enzyme variant 3 [Epichloe festucae var. 
lolii]
 gb|ABN45977.1| thiazole biosynthetic enzyme variant 4 [Epichloe festucae var. 
lolii]
 gb|ABN45978.1| thiazole biosynthetic enzyme variant 5 [Epichloe festucae var. 
lolii]
Length=326

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            +SFKF PI++S V+R MTRRY  D+ TYA++D+++VGAGS GLS A+
Sbjct  42   NSFKFAPIRESQVSRAMTRRYFQDLDTYAESDIVIVGAGSCGLSAAY  88



>gb|EYE95075.1| Thi4 family thiamine biosynthetic enzyme [Aspergillus ruber CBS 
135680]
Length=334

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            D FKF PI++S V+R MTRRY  D+  YA+TD+++VGAGS GLS A+
Sbjct  49   DEFKFAPIRESQVSRAMTRRYFQDLDKYAETDILIVGAGSCGLSTAY  95



>gb|KIY92671.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=351

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +2

Query  185  TPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDIT  349
            TP+  D ++F PI+++ V+R MT RY  D+ +YA+ DVI+ GAGSAGL+CA++++
Sbjct  54   TPF--DDYRFAPIREATVSRAMTSRYFKDLDSYAEADVIIAGAGSAGLACAYELS  106



>ref|XP_007745751.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
 gb|EXJ69899.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
Length=331

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            D FKF PI++S V+R MTRRY  D+  YA++DV++VGAGS GLS A+ +
Sbjct  52   DGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTL  100



>gb|KIW92677.1| thiamine thiazole synthase [Cladophialophora bantiana CBS 173.52]
Length=331

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  119  VSSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDV  298
            + ++  A+ A++ H+ +          D FKF PI++S V+R MTRRY  D+  YA++DV
Sbjct  25   LGAKKVALTAANEHDNNSLLEQFGGKWDGFKFAPIRESQVSRAMTRRYFADLDRYAESDV  84

Query  299  IVVGAGSAGLSCAHDI  346
            ++VGAGS GLS A+ +
Sbjct  85   VIVGAGSCGLSTAYTL  100



>ref|XP_002375225.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
 gb|EED56443.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
Length=327

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  182  HTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAH  340
            H     D FKF PI++S V+R MTRRY  D+  YA++DV++VGAGS GLS A+
Sbjct  40   HFGGKWDEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAY  92



>gb|KIY99977.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=359

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDIT  349
            D ++F PI+++ V+R MT RY  D+ TYA+ DV++ GAGSAGL+CA++++
Sbjct  66   DDYRFAPIREATVSRAMTSRYFKDLDTYAEADVVIAGAGSAGLACAYELS  115



>ref|XP_007913237.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
 gb|EOO01967.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
Length=326

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDI  346
            D+F F PI++S V+R MTRRY +D+ TYA++D++++GAGS GLS A+ +
Sbjct  45   DTFTFNPIRESQVSRAMTRRYFSDLDTYAESDIVIIGAGSCGLSAAYTL  93



>ref|XP_461084.2| DEHA2F16654p [Debaryomyces hansenii CBS767]
 emb|CAG89466.2| DEHA2F16654p [Debaryomyces hansenii CBS767]
Length=321

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  200  DSFKFQPIKQSIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAHDITTN  355
            D FKF PI++S V+R MT RY  D+  YA++DV+++GAGSAGLS A+ +  N
Sbjct  42   DKFKFTPIRESTVSRAMTSRYFADLDKYAESDVVIIGAGSAGLSAAYILAKN  93



>ref|XP_002951140.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
 gb|EFJ47669.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
Length=359

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  122  SSRVQAVKASSFHNLSVSASHTPYSLDSFKFQPIKQSIVAREMTRRYMTDMITYADTDVI  301
             S+  A  AS      +  + TPY  D++ F  I+++ V R MTRRY  DM  +A++DV+
Sbjct  38   GSQSAAADASMLARAGLPPTTTPY--DNYVFASIREAEVNRAMTRRYFKDMDEFAESDVV  95

Query  302  VVGAGSAGLSCAHDI  346
            +VGAGSAGL+CA+++
Sbjct  96   IVGAGSAGLACAYEL  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563570228265