BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028L13

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011003162.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    253   1e-81   Populus euphratica
ref|XP_006488031.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    251   2e-81   Citrus sinensis [apfelsine]
gb|AAZ83341.1|  ubiquitin extension protein                             251   2e-81   Gossypium hirsutum [American cotton]
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    253   3e-81   
gb|KJB49764.1|  hypothetical protein B456_008G136200                    252   4e-81   Gossypium raimondii
gb|KJB06862.1|  hypothetical protein B456_001G146500                    251   4e-81   Gossypium raimondii
ref|XP_006424488.1|  hypothetical protein CICLE_v10029476mg             250   4e-81   Citrus clementina [clementine]
ref|XP_008389677.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    249   6e-81   Malus domestica [apple tree]
ref|NP_001275598.1|  ubiquitin-40S ribosomal protein S27a-like          249   6e-81   Solanum tuberosum [potatoes]
ref|XP_002279878.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    249   7e-81   Vitis vinifera
ref|XP_007157375.1|  hypothetical protein PHAVU_002G065000g             249   7e-81   Phaseolus vulgaris [French bean]
ref|XP_006374591.1|  ubiquitin/ribosomal protein 27a                    249   1e-80   Populus trichocarpa [western balsam poplar]
gb|ABN72579.1|  ubiquitin extension protein                             249   1e-80   Hevea brasiliensis [jebe]
ref|XP_008781194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    248   1e-80   Phoenix dactylifera
gb|ACJ83917.1|  unknown                                                 248   1e-80   Medicago truncatula
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    251   2e-80   Eucalyptus grandis [rose gum]
ref|XP_004504241.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    248   2e-80   
ref|XP_008358198.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    248   2e-80   
gb|AAZ53360.1|  ubiquitin extension protein                             248   2e-80   Nicotiana tabacum [American tobacco]
ref|XP_003613203.1|  Ubiquitin                                          248   2e-80   Medicago truncatula
ref|XP_003629895.1|  Ubiquitin                                          251   2e-80   
ref|XP_011040332.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    248   2e-80   Populus euphratica
ref|XP_003634320.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    248   2e-80   Vitis vinifera
ref|XP_008793306.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    248   2e-80   Phoenix dactylifera
ref|XP_004489824.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    248   2e-80   Cicer arietinum [garbanzo]
ref|XP_004288657.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    248   2e-80   Fragaria vesca subsp. vesca
gb|AFK49579.1|  unknown                                                 248   2e-80   Lotus japonicus
ref|XP_002525394.1|  ubiquitin, putative                                248   3e-80   Ricinus communis
gb|ABK42077.1|  ubiquitin extension protein                             248   3e-80   Capsicum annuum
gb|KGN51791.1|  hypothetical protein Csa_5G600925                       249   3e-80   Cucumis sativus [cucumbers]
gb|ABI84265.1|  ubiquitin/ribosomal protein S27a                        248   3e-80   Arachis hypogaea [goober]
ref|XP_002270170.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    248   3e-80   Vitis vinifera
gb|AIX10775.1|  ubiquitin                                               247   4e-80   Panax notoginseng [san-qi]
ref|XP_002320950.1|  ubiquitin/ribosomal protein 27a                    247   4e-80   Populus trichocarpa [western balsam poplar]
ref|XP_006492389.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    247   4e-80   
gb|ADF36485.1|  ubiquitin extension protein                             247   4e-80   Ageratina adenophora
gb|KDP26615.1|  hypothetical protein JCGZ_17773                         247   4e-80   Jatropha curcas
ref|XP_011082406.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    247   4e-80   Sesamum indicum [beniseed]
ref|NP_001269170.1|  ubiquitin-40S ribosomal protein S27a-like          247   4e-80   Cucumis sativus [cucumbers]
ref|XP_004142977.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    247   5e-80   Cucumis sativus [cucumbers]
emb|CAN80663.1|  hypothetical protein VITISV_036195                     247   5e-80   Vitis vinifera
ref|XP_010941490.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    247   5e-80   Elaeis guineensis
ref|XP_010040181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    247   5e-80   Eucalyptus grandis [rose gum]
gb|AAL66206.1|AF386524_1  ubiquitin extension protein                   247   6e-80   Pyrus communis
gb|ACJ84122.1|  unknown                                                 246   1e-79   Medicago truncatula
ref|XP_008776477.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    246   1e-79   Phoenix dactylifera
sp|P62980.2|RS27A_SOLLC  RecName: Full=Ubiquitin-40S ribosomal pr...    246   1e-79   Solanum lycopersicum
ref|XP_011079491.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    246   1e-79   Sesamum indicum [beniseed]
emb|CAA80334.1|  ubiquitin extension protein                            246   1e-79   Lupinus albus
ref|XP_001774978.1|  predicted protein                                  246   1e-79   
ref|XP_003535084.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    246   1e-79   Glycine max [soybeans]
gb|AFK43562.1|  unknown                                                 246   2e-79   Medicago truncatula
ref|XP_010248517.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    246   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010270924.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    246   2e-79   Nelumbo nucifera [Indian lotus]
gb|AHA83529.1|  ubiquitin extension protein                             246   2e-79   Hevea brasiliensis [jebe]
ref|NP_001238181.1|  uncharacterized protein LOC100527579               245   2e-79   Glycine max [soybeans]
gb|AAO38879.1|  ubiquitin/ribosomal fusion protein                      245   3e-79   Malus domestica [apple tree]
gb|AAG13985.1|AF298826_1  ubiquitin/ribosomal protein 27a               244   5e-79   Prunus avium [gean]
gb|ABH08969.1|  ubiquitin extension protein                             244   5e-79   Morus bombycis
ref|XP_010270921.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    244   6e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004229050.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    244   7e-79   
gb|EYU38434.1|  hypothetical protein MIMGU_mgv1a015486mg                244   8e-79   Erythranthe guttata [common monkey flower]
ref|NP_001238483.1|  uncharacterized protein LOC100527854               244   8e-79   
sp|P47905.2|RS27A_LUPAL  RecName: Full=Ubiquitin-40S ribosomal pr...    244   9e-79   Lupinus albus
gb|ABR16172.1|  unknown                                                 244   1e-78   Picea sitchensis
ref|XP_001762629.1|  predicted protein                                  243   1e-78   
ref|XP_009104378.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    243   2e-78   Brassica rapa
ref|NP_566095.1|  ubiquitin-40S ribosomal protein S27a-2                243   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402395.1|  hypothetical protein EUTSA_v10006290mg             243   2e-78   Eutrema salsugineum [saltwater cress]
ref|XP_010506742.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    243   2e-78   Camelina sativa [gold-of-pleasure]
gb|AFX96040.1|  ubiquitin extension protein                             243   2e-78   Grimmia pilifera
ref|XP_001754264.1|  predicted protein                                  243   2e-78   
gb|EPS73110.1|  hypothetical protein M569_01646                         243   2e-78   Genlisea aurea
ref|XP_010507927.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    243   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009133797.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    243   2e-78   Brassica rapa
ref|XP_010675161.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    243   2e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_191784.1|  ubiquitin-40S ribosomal protein S27a-3                243   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397903.1|  hypothetical protein EUTSA_v10001668mg             243   3e-78   Eutrema salsugineum [saltwater cress]
ref|XP_010413295.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    243   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_002876668.1|  hypothetical protein ARALYDRAFT_486730             243   3e-78   
gb|EYU46866.1|  hypothetical protein MIMGU_mgv1a015483mg                242   3e-78   Erythranthe guttata [common monkey flower]
ref|XP_006832935.1|  hypothetical protein AMTR_s00095p00146440          242   3e-78   Amborella trichopoda
ref|XP_009416508.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    241   7e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010251196.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    241   7e-78   Nelumbo nucifera [Indian lotus]
gb|KFK35409.1|  hypothetical protein AALP_AA5G280900                    241   1e-77   Arabis alpina [alpine rockcress]
ref|XP_009414918.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    241   2e-77   
ref|XP_009772672.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    240   2e-77   Nicotiana sylvestris
ref|XP_009383724.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    240   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIH15195.1|  ubiquitin-40S ribosomal protein S27a-like protein       240   3e-77   Hedychium coronarium
ref|XP_009116899.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    239   7e-77   Brassica rapa
ref|NP_001042915.1|  Os01g0328400                                       238   1e-76   
ref|XP_004968668.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    238   1e-76   Setaria italica
ref|XP_003568865.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    238   1e-76   Brachypodium distachyon [annual false brome]
ref|XP_003567648.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    238   2e-76   Brachypodium distachyon [annual false brome]
ref|XP_006846976.1|  hypothetical protein AMTR_s00017p00094950          238   2e-76   Amborella trichopoda
ref|NP_001275323.1|  putative ubiquitin extension protein               237   3e-76   Solanum tuberosum [potatoes]
gb|AEE98366.1|  ubiquitin                                               237   4e-76   Deschampsia antarctica
sp|P0CG86.1|RS271_HORVU  RecName: Full=Ubiquitin-40S ribosomal pr...    237   5e-76   Hordeum vulgare [barley]
ref|XP_004977103.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    237   5e-76   Setaria italica
gb|AFI60245.1|  ubiquitin                                               236   5e-76   Panicum virgatum
ref|XP_002457768.1|  hypothetical protein SORBIDRAFT_03g013260          237   6e-76   Sorghum bicolor [broomcorn]
ref|XP_009385375.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    237   6e-76   
gb|ACA24140.1|  ubiquitin                                               236   6e-76   Lolium temulentum
gb|ABR29645.1|  ubiquitin                                               236   6e-76   Lolium perenne [perennial ryegrass]
ref|XP_010914703.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    237   3e-75   
ref|NP_001131602.1|  ubiquitin                                          235   3e-75   Zea mays [maize]
ref|XP_010914702.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    236   4e-75   Elaeis guineensis
ref|XP_010914705.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    236   4e-75   Elaeis guineensis
ref|XP_006654079.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    234   4e-75   Oryza brachyantha
ref|NP_001054720.2|  Os05g0160200                                       234   4e-75   
ref|XP_010914704.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    236   5e-75   Elaeis guineensis
ref|XP_010544941.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    234   6e-75   Tarenaya hassleriana [spider flower]
ref|XP_008649366.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    234   8e-75   Zea mays [maize]
ref|XP_010519353.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    233   9e-75   Tarenaya hassleriana [spider flower]
ref|XP_006306408.1|  hypothetical protein CARUB_v10012327mg             233   1e-74   Capsella rubella
gb|AEO11783.1|  ubiquitin                                               233   2e-74   Lolium perenne [perennial ryegrass]
gb|ACG31121.1|  40S ribosomal protein S27a                              233   2e-74   Zea mays [maize]
gb|AAA70104.1|  ubiquitin fusion protein                                233   2e-74   Zea mays [maize]
ref|XP_010914701.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    235   2e-74   
ref|NP_001150700.1|  40S ribosomal protein S27a                         232   4e-74   Zea mays [maize]
ref|XP_009103181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    232   4e-74   Brassica rapa
gb|AFX60090.1|  ribosomal protein S27a                                  232   4e-74   Brassica oleracea
ref|XP_002890580.1|  hypothetical protein ARALYDRAFT_472603             232   5e-74   
ref|NP_001105472.1|  ubiquitin-40S ribosomal protein S27a               231   8e-74   
gb|ADE58112.1|  ubiquitin/ribosomal fusion protein                      231   8e-74   Citrus trifoliata [hardy orange]
gb|KHN22999.1|  Ubiquitin-40S ribosomal protein S27a                    231   9e-74   Glycine soja [wild soybean]
ref|NP_173755.1|  40S ribosomal protein S27a-1                          231   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416085.1|  hypothetical protein EUTSA_v10008988mg             231   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_010498849.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    230   2e-73   Camelina sativa [gold-of-pleasure]
emb|CDY04715.1|  BnaC05g18740D                                          230   3e-73   
ref|XP_010460127.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    229   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010477636.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    229   7e-73   Camelina sativa [gold-of-pleasure]
gb|AAW56553.1|  ubiquitin/s27a 40s ribosomal protein                    228   9e-73   Nicotiana benthamiana
ref|XP_006349858.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    229   1e-72   Solanum tuberosum [potatoes]
gb|KFK44432.1|  hypothetical protein AALP_AA1G255700                    228   2e-72   Arabis alpina [alpine rockcress]
ref|XP_007514688.1|  predicted protein                                  227   7e-72   Bathycoccus prasinos
ref|XP_007051235.1|  Ribosomal protein S27a / Ubiquitin family pr...    226   1e-71   
gb|KCW58175.1|  hypothetical protein EUGRSUZ_H00892                     225   1e-71   Eucalyptus grandis [rose gum]
ref|XP_006001599.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    225   2e-71   Latimeria chalumnae
gb|AGC65581.1|  UBQ5                                                    225   2e-71   Agrostis stolonifera [creeping bent grass]
ref|XP_010552656.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    225   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_010216499.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    225   2e-71   Tinamus guttatus
ref|XP_004644620.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    225   2e-71   
ref|XP_011482499.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    225   3e-71   
gb|ACH71005.1|  ribosomal protein S27-3                                 225   3e-71   Salmo salar
gb|EHH55578.1|  hypothetical protein EGM_04813                          225   3e-71   Macaca fascicularis [crab eating macaque]
gb|KGL79724.1|  Ubiquitin-40S ribosomal protein S27a                    225   3e-71   Tinamus guttatus
gb|AER12038.1|  ubiquitin extension protein                             224   3e-71   Paeonia suffruticosa [moutan peony]
ref|NP_956796.1|  ubiquitin-40S ribosomal protein S27a                  224   4e-71   Danio rerio [leopard danio]
gb|AAM27203.1|AF502248_1  40s ribosomal protein S27a                    224   5e-71   Epinephelus coioides [estuary cod]
gb|KDO86852.1|  hypothetical protein CISIN_1g031604mg                   223   8e-71   Citrus sinensis [apfelsine]
ref|XP_003216177.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    223   9e-71   Anolis carolinensis [Carolina anole]
ref|NP_990284.1|  ubiquitin-40S ribosomal protein S27a                  223   1e-70   
gb|KFV68543.1|  Ubiquitin-40S ribosomal protein S27a                    223   1e-70   Picoides pubescens
gb|AAH49478.1|  Zgc:66168 protein                                       223   2e-70   Danio rerio [leopard danio]
gb|KFP00438.1|  Ubiquitin-40S ribosomal protein S27a                    223   2e-70   Calypte anna
ref|NP_002945.1|  ubiquitin-40S ribosomal protein S27a precursor        223   2e-70   Homo sapiens [man]
gb|AAA57047.1|  ubiquitin                                               223   2e-70   synthetic construct
gb|AAA36788.1|  pro-ubiquitin                                           222   2e-70   Homo sapiens [man]
gb|AAH53371.1|  Ribosomal protein S27a                                  222   3e-70   Homo sapiens [man]
ref|XP_007400913.1|  hypothetical protein PHACADRAFT_264025             222   3e-70   Phanerochaete carnosa HHB-10118-sp
gb|EGN96831.1|  hypothetical protein SERLA73DRAFT_185014                222   3e-70   Serpula lacrymans var. lacrymans S7.3
ref|XP_002733357.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    222   4e-70   Saccoglossus kowalevskii
ref|XP_005575916.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    223   4e-70   
gb|KIO10764.1|  hypothetical protein M404DRAFT_20998                    222   4e-70   Pisolithus tinctorius Marx 270
ref|XP_007343921.1|  ubiquitin-domain-containing protein                222   4e-70   
ref|XP_008065389.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    222   4e-70   Carlito syrichta
gb|AGO97083.1|  ubiquitin                                               221   5e-70   Cymbidium faberi
ref|XP_010573169.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    221   5e-70   Haliaeetus leucocephalus
ref|XP_005513215.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    221   5e-70   Columba livia [carrier pigeon]
ref|XP_003758323.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    224   7e-70   
gb|ACO51599.1|  Ubiquitin                                               221   7e-70   Rana catesbeiana [bullfrog]
gb|EMC80037.1|  40S ribosomal protein S27a                              221   7e-70   
gb|ACO08409.1|  Ubiquitin                                               221   7e-70   Oncorhynchus mykiss
gb|AEA51100.1|  ubiquitin                                               221   8e-70   Oryzias melastigma [Java medaka]
gb|KIP07142.1|  hypothetical protein PHLGIDRAFT_106094                  221   8e-70   Phlebiopsis gigantea 11061_1 CR5-6
emb|CCO31835.1|  Ubiquitin-40S ribosomal protein S27a AltName: Fu...    221   8e-70   Rhizoctonia solani AG-1 IB
ref|XP_009549036.1|  hypothetical protein HETIRDRAFT_441019             221   8e-70   Heterobasidion irregulare TC 32-1
gb|KDQ26602.1|  hypothetical protein PLEOSDRAFT_1113129                 221   9e-70   Pleurotus ostreatus PC15
gb|KIM90371.1|  hypothetical protein PILCRDRAFT_812107                  221   1e-69   Piloderma croceum F 1598
ref|XP_007865027.1|  ubiquitin-domain-containing protein                221   1e-69   Gloeophyllum trabeum ATCC 11539
gb|KIY49962.1|  ubiquitin/40s ribosomal protein S27a fusion             221   1e-69   Fistulina hepatica ATCC 64428
ref|XP_010376465.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    221   1e-69   Rhinopithecus roxellana
gb|KIY63590.1|  ubiquitin-domain-containing protein                     221   1e-69   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_007304445.1|  ubiquitin/40s ribosomal protein S27a fusion        221   1e-69   Stereum hirsutum FP-91666 SS1
ref|XP_003032858.1|  ubiquitin-40S ribosomal protein S31 fusion p...    221   1e-69   Schizophyllum commune H4-8
ref|XP_003504023.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    221   1e-69   Cricetulus griseus [Chinese hamsters]
ref|XP_007771051.1|  ubiquitin-domain-containing protein                221   1e-69   Coniophora puteana RWD-64-598 SS2
gb|KDQ61543.1|  hypothetical protein JAAARDRAFT_30995                   221   1e-69   Jaapia argillacea MUCL 33604
ref|XP_001104764.1|  PREDICTED: hypothetical protein LOC709143          221   1e-69   
gb|KDR80707.1|  hypothetical protein GALMADRAFT_241118                  221   1e-69   Galerina marginata CBS 339.88
gb|KII87325.1|  hypothetical protein PLICRDRAFT_42950                   221   1e-69   Plicaturopsis crispa FD-325 SS-3
gb|KIM66010.1|  hypothetical protein SCLCIDRAFT_1211653                 220   2e-69   Scleroderma citrinum Foug A
ref|XP_006083528.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    223   2e-69   
gb|EMD39293.1|  hypothetical protein CERSUDRAFT_112941                  220   2e-69   Gelatoporia subvermispora B
ref|NP_077239.1|  ubiquitin-40S ribosomal protein S27a precursor        220   2e-69   Mus musculus [mouse]
ref|XP_006738708.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    220   2e-69   Leptonychotes weddellii
ref|XP_003125184.2|  PREDICTED: ubiquitin-40S ribosomal protein S27a    222   2e-69   
ref|XP_004643097.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    220   3e-69   
ref|XP_006068942.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    220   3e-69   
gb|ACO08429.1|  Ubiquitin                                               220   3e-69   Oncorhynchus mykiss
ref|NP_476778.1|  ribosomal protein S27A                                219   3e-69   Drosophila melanogaster
ref|XP_007400915.1|  hypothetical protein PHACADRAFT_213544             219   3e-69   Phanerochaete carnosa HHB-10118-sp
gb|AAA74960.1|  ribosomal protein-linked ubiquitin                      219   3e-69   Oryza sativa [red rice]
gb|KIK48311.1|  hypothetical protein CY34DRAFT_705963                   219   3e-69   Suillus luteus UH-Slu-Lm8-n1
ref|XP_006888789.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    219   3e-69   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005175708.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    219   4e-69   Musca domestica
gb|KIO29915.1|  hypothetical protein M407DRAFT_242430                   219   4e-69   Tulasnella calospora MUT 4182
ref|XP_004092958.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    219   4e-69   Nomascus leucogenys [White-cheeked Gibbon]
emb|CCA70746.1|  probable ubiquitin/ribosomal protein S27a fusion...    219   4e-69   Serendipita indica DSM 11827
ref|XP_004411170.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    219   4e-69   
ref|XP_002002882.1|  GI10618                                            219   4e-69   Drosophila mojavensis
sp|P59272.2|RS27A_DAUCA  RecName: Full=Ubiquitin-40S ribosomal pr...    219   4e-69   Daucus carota [carrots]
ref|XP_005365195.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    219   4e-69   Microtus ochrogaster [prairie voles]
gb|AAV84206.1|  unknown                                                 219   4e-69   Culicoides sonorensis
gb|KIK50599.1|  hypothetical protein GYMLUDRAFT_51110                   219   4e-69   Gymnopus luxurians FD-317 M1
ref|XP_002469300.1|  ubiquitin/40s ribosomal protein S27a fusion        219   4e-69   
gb|KIM34102.1|  hypothetical protein M408DRAFT_19058                    219   5e-69   Serendipita vermifera MAFF 305830
gb|EUC60885.1|  ubiquitin/40S ribosomal protein S27a fusion protein     219   5e-69   Rhizoctonia solani AG-3 Rhs1AP
gb|KIK23888.1|  hypothetical protein PISMIDRAFT_678904                  219   5e-69   Pisolithus microcarpus 441
ref|XP_004396839.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    219   7e-69   
ref|XP_001831329.1|  ubiquitin-40S ribosomal protein S31 fusion p...    219   7e-69   Coprinopsis cinerea okayama7#130
ref|XP_007855532.1|  ubiquitin                                          219   7e-69   
ref|XP_001874554.1|  ubiquitin-40S ribosomal protein S31 fusion p...    219   8e-69   Laccaria bicolor S238N-H82
gb|EJU03816.1|  ubiquitin                                               218   9e-69   Dacryopinax primogenitus
gb|KIJ65589.1|  hypothetical protein HYDPIDRAFT_39518                   218   9e-69   Hydnomerulius pinastri MD-312
gb|AGO97081.1|  ubiquitin                                               218   1e-68   Cymbidium faberi
ref|XP_011194777.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    218   1e-68   Zeugodacus cucurbitae [melon fruit fly]
gb|KIJ55337.1|  hypothetical protein M422DRAFT_23939                    218   1e-68   Sphaerobolus stellatus SS14
ref|XP_007368145.1|  ubiquitin/40s ribosomal protein S27a fusion        218   1e-68   Dichomitus squalens LYAD-421 SS1
ref|XP_008038358.1|  ubiquitin/40s ribosomal protein S27a fusion        218   1e-68   Trametes versicolor FP-101664 SS1
gb|ACQ59064.1|  Ubiquitin                                               218   1e-68   Anoplopoma fimbria
gb|KIK67659.1|  hypothetical protein GYMLUDRAFT_215796                  218   2e-68   Gymnopus luxurians FD-317 M1
ref|XP_004519374.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    218   2e-68   Ceratitis capitata [medfly]
gb|EPT02993.1|  hypothetical protein FOMPIDRAFT_1142989                 218   2e-68   Fomitopsis pinicola FP-58527 SS1
ref|XP_009235580.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    219   2e-68   
gb|KDQ06872.1|  hypothetical protein BOTBODRAFT_39300                   218   2e-68   Botryobasidium botryosum FD-172 SS1
ref|XP_007185405.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    217   3e-68   
ref|XP_006860476.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    217   3e-68   Chrysochloris asiatica
ref|XP_011208987.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    217   3e-68   Bactrocera dorsalis [papaya fruit fly]
ref|XP_006461860.1|  hypothetical protein AGABI2DRAFT_193235            217   3e-68   Agaricus bisporus var. bisporus H97
gb|KIK08837.1|  hypothetical protein K443DRAFT_671895                   217   3e-68   Laccaria amethystina LaAM-08-1
emb|CCM02543.1|  predicted protein                                      217   3e-68   Fibroporia radiculosa
gb|AGF25315.1|  ubiquitin 2                                             216   4e-68   x Doritaenopsis hybrid cultivar
ref|XP_002501200.1|  predicted protein                                  217   4e-68   Micromonas commoda
ref|XP_007261488.1|  ubiquitin-domain-containing protein                217   4e-68   Fomitiporia mediterranea MF3/22
gb|KFB48180.1|  ubiquitin (ribosomal protein L40)                       216   5e-68   Anopheles sinensis
ref|XP_005345114.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    216   5e-68   
ref|NP_001133210.1|  ribosomal protein S27-3                            216   5e-68   Salmo salar
ref|XP_004663256.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    216   5e-68   
ref|XP_006901676.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    217   5e-68   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ERE90935.1|  ubiquitin-40S ribosomal protein S27a-like protein       216   6e-68   Cricetulus griseus [Chinese hamsters]
ref|XP_006887475.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    216   6e-68   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006889610.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    216   7e-68   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_001663729.1|  AAEL013536-PA                                      216   8e-68   Aedes aegypti
ref|XP_007382777.1|  ubiquitin-domain-containing protein                216   9e-68   Punctularia strigosozonata HHB-11173 SS5
gb|ELU44102.1|  ubiquitin                                               218   9e-68   Rhizoctonia solani AG-1 IA
gb|AAS79344.1|  ribosomal protein S27a                                  216   1e-67   Aedes aegypti
ref|XP_004015152.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    216   1e-67   
gb|ADV40075.1|  60S ribosomal protein L40A                              216   1e-67   Latrodectus hesperus [black widow]
gb|AGO97082.1|  ubiquitin                                               215   1e-67   Cymbidium faberi
gb|KIJ20902.1|  hypothetical protein PAXINDRAFT_165728                  215   2e-67   Paxillus involutus ATCC 200175
gb|ADF45325.1|  ubiquitin/ribosomal S27 fusion protein 1                215   2e-67   Eriocheir sinensis [Chinese hairy crab]
ref|XP_004629417.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    215   2e-67   
ref|XP_007410422.1|  hypothetical protein MELLADRAFT_71955              215   2e-67   Melampsora larici-populina 98AG31
ref|XP_002825892.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    214   3e-67   
gb|KIK98182.1|  hypothetical protein PAXRUDRAFT_824145                  214   3e-67   Paxillus rubicundulus Ve08.2h10
ref|XP_784247.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a...    214   4e-67   Strongylocentrotus purpuratus [purple urchin]
gb|KDE06402.1|  ubiquitin-40S ribosomal protein S27a-1                  216   4e-67   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_004579614.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    214   4e-67   
gb|ABX75386.1|  60S ribosomal protein L40A                              214   4e-67   Lycosa singoriensis
ref|NP_001279942.1|  ribosomal protein S27a                             214   4e-67   Callorhinchus milii [Australian ghost shark]
ref|NP_001292281.1|  ubiquitin-40S ribosomal protein S27a               214   4e-67   Crassostrea gigas
ref|XP_008347677.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    216   5e-67   
emb|CCQ18633.1|  Ubiquitin and ubiquitin-like proteins                  216   5e-67   Sycon ciliatum
gb|AEB54653.1|  ubiquitin                                               214   5e-67   Procambarus clarkii
gb|AFK10704.1|  ubiquitin-40S ribosomal protein S27a-like protein       214   5e-67   Callorhinchus milii [Australian ghost shark]
gb|ACX50289.1|  ubiquitin                                               214   6e-67   Scylla paramamosain
gb|AFM86054.1|  ubiquitin-40S ribosomal protein S27a-like protein       214   7e-67   Callorhinchus milii [Australian ghost shark]
ref|XP_006871713.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    213   7e-67   
gb|KEZ38887.1|  Ubiquitin-40S ribosomal protein S27a                    213   1e-66   
ref|XP_006890603.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    213   1e-66   
ref|XP_007913990.1|  putative ubiquitin-40s ribosomal protein s31...    213   1e-66   
gb|ACD65153.1|  putative ubiquitin/40S ribosomal protein RPS27A f...    213   2e-66   
gb|ABR23473.1|  ubiquitin/40S ribosomal protein S27a                    213   2e-66   
gb|ABM55591.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    213   2e-66   
ref|XP_004652431.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    213   2e-66   
gb|ABD98741.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    213   2e-66   
ref|XP_003062279.1|  predicted protein                                  212   2e-66   
ref|XP_005356706.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    212   2e-66   
ref|XP_006896080.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    212   2e-66   
gb|AFM87647.1|  ubiquitin-40S ribosomal protein S27a-like protein       212   2e-66   
gb|AFM90373.1|  ubiquitin-40S ribosomal protein S27a-like protein       212   2e-66   
dbj|GAD99010.1|  ubiquitin                                              212   2e-66   
ref|XP_005352920.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    212   2e-66   
ref|XP_003272229.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    212   3e-66   
gb|AGF25314.1|  ubiquitin 1                                             211   3e-66   
gb|ABM74399.1|  ubiquitin                                               212   3e-66   
ref|XP_001244380.1|  ubiquitin-40S ribosomal protein S31 fusion p...    212   3e-66   
ref|XP_003788227.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    212   3e-66   
gb|AAY66925.1|  ubiquitin/ribosomal protein S27a fusion protein         212   4e-66   
ref|XP_001087600.1|  PREDICTED: hypothetical protein LOC697620          212   4e-66   
gb|AAL55470.1|  ubiquitin/ribosomal protein S27a fusion protein         212   4e-66   
gb|ACD65107.1|  putative ubiquitin/40S ribosomal protein RPS27A f...    211   4e-66   
ref|XP_011116118.1|  hypothetical protein H072_10672                    211   4e-66   
ref|XP_011123943.1|  hypothetical protein AOL_s00083g462                211   5e-66   
ref|XP_002399366.1|  40S ribosomal protein S27A, putative               212   5e-66   
emb|CEF98605.1|  Ubiquitin supergroup                                   211   6e-66   
gb|ABW23155.1|  ribosomal protein rps27a                                211   6e-66   
gb|KJB22478.1|  hypothetical protein B456_004G049300                    210   6e-66   
ref|XP_008029241.1|  hypothetical protein SETTUDRAFT_94331              211   7e-66   
ref|XP_003571935.2|  PREDICTED: ubiquitin-40S ribosomal protein S...    211   7e-66   
gb|ABI52648.1|  ubiquitin/40S ribosomal protein S27a fusion protein     214   7e-66   
gb|KIV96259.1|  ubiquitin-40S ribosomal protein S27a                    211   8e-66   
gb|ADF45326.1|  ubiquitin/ribosomal S27 fusion protein 2                211   8e-66   
ref|XP_003047931.1|  ubiquitin-40S ribosomal protein S31 fusion p...    211   8e-66   
ref|XP_006729877.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    211   8e-66   
gb|AFM86275.1|  ubiquitin-40S ribosomal protein S27a-like protein       211   9e-66   
ref|XP_011390893.1|  putative ubiquitin-ribosomal 40S subunit pro...    211   1e-65   
gb|EQB50539.1|  hypothetical protein CGLO_10017                         211   1e-65   
gb|AAX62431.1|  ribosomal protein S27a                                  211   1e-65   
ref|XP_005563631.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    211   1e-65   
ref|XP_001640566.1|  predicted protein                                  210   1e-65   
gb|EUC60891.1|  ubiquitin/40S ribosomal protein S27a fusion protein     220   1e-65   
gb|KJA28046.1|  hypothetical protein HYPSUDRAFT_197596                  211   1e-65   
ref|XP_754493.1|  ubiquitin (UbiC)                                      210   1e-65   
ref|XP_006692377.1|  40S ribosomal protein S27a-like protein            210   1e-65   
emb|CDI55091.1|  probable ubiquitin/ribosomal protein S27a fusion...    210   1e-65   
emb|CBQ69010.1|  probable ubiquitin/ribosomal protein S27a fusion...    210   1e-65   
ref|XP_007877229.1|  hypothetical protein PFL1_06937                    210   1e-65   
emb|CCF48698.1|  probable ubiquitin/ribosomal protein S27a fusion...    210   2e-65   
ref|XP_002626672.1|  ubiquitin-40S ribosomal protein S31 fusion p...    210   2e-65   
ref|XP_007779099.1|  ubiquitin-40S ribosomal protein S27a               210   2e-65   
dbj|BAC06474.1|  ubiquitin                                              210   2e-65   
ref|XP_009859843.1|  PREDICTED: r27a protein isoform X1                 210   2e-65   
ref|NP_001027675.1|  r27a protein                                       210   2e-65   
ref|XP_003296988.1|  ubiquitin-40S ribosomal protein S31 fusion p...    210   2e-65   
ref|XP_008773015.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    210   2e-65   
dbj|BAJ23937.1|  ribosomal protein S27a                                 209   2e-65   
dbj|GAA93464.1|  hypothetical protein E5Q_00105                         216   2e-65   
gb|KIH93873.1|  small subunit ribosomal protein S27Ae                   209   2e-65   
ref|XP_001538961.1|  ubiquitin-40S ribosomal protein S31 fusion p...    209   2e-65   
ref|XP_008216204.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    209   2e-65   
ref|XP_002582692.1|  ubiquitin                                          209   2e-65   
ref|XP_003326773.1|  ubiquitin-40S ribosomal protein S31 fusion p...    209   3e-65   
gb|KEY73810.1|  hypothetical protein S7711_03110                        209   3e-65   
gb|EPQ66886.1|  hypothetical protein BGT96224_2407                      209   3e-65   
gb|ETN58928.1|  hypothetical protein AND_009492                         218   3e-65   
gb|AGM32388.1|  ubiquitin-40S ribosomal protein                         209   4e-65   
tpg|DAA26453.1|  TPA: ubiquitin and ribosomal protein S27a-like         209   4e-65   
emb|CAJ01876.1|  ubiquitin/ribosomal protein S27Ae fusion protein       209   4e-65   
gb|ACF35544.1|  ubiquitin/ribosomal protein S27a fusion protein         209   4e-65   
gb|AFS89619.1|  ubiquitin ribosomal protein RpS27a                      209   4e-65   
sp|P68202.2|RS27A_PLUXY  RecName: Full=Ubiquitin-40S ribosomal pr...    209   4e-65   
ref|XP_003839401.1|  similar to ubiquitin / ribosomal protein S27a      209   4e-65   
gb|KIW43141.1|  ubiquitin-40S ribosomal protein S27a                    209   4e-65   
ref|XP_007722210.1|  ubiquitin-40S ribosomal protein S27a               209   5e-65   
gb|KIY03162.1|  ubiquitin-40S ribosomal protein S27a                    209   5e-65   
gb|KIW11051.1|  ubiquitin-40S ribosomal protein S27a                    209   5e-65   
gb|KEF62640.1|  ubiquitin-40S ribosomal protein S27a                    209   5e-65   
ref|XP_003263604.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    209   5e-65   
ref|XP_003400429.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    209   6e-65   
gb|KDR17238.1|  Ubiquitin                                               209   6e-65   
gb|KHJ33942.1|  putative ubiquitin-40s ribosomal protein s31 fusi...    209   6e-65   
ref|XP_007583549.1|  putative ubiquitin-40s ribosomal protein s31...    208   7e-65   
emb|CAJ01879.1|  ubiquitin/ribosomal protein S27Ae fusion protein       208   7e-65   
gb|ABM55417.1|  ribosomal protein S27                                   208   7e-65   
ref|XP_007841585.1|  Ubiquitin-40S ribosomal protein S27a               208   7e-65   
gb|KIV82057.1|  ubiquitin-40S ribosomal protein S27a                    208   8e-65   
emb|CAH04347.1|  ubiquitin/S27Ae ribosomal protein                      208   8e-65   
ref|XP_007195197.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    209   9e-65   
ref|XP_009159055.1|  ubiquitin-40S ribosomal protein S27a               208   9e-65   
gb|KIX00747.1|  ubiquitin-40S ribosomal protein S27a                    208   1e-64   
ref|XP_969023.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a       208   1e-64   
gb|ELR03817.1|  ubiquitin-40S ribosomal protein S27a                    208   1e-64   
sp|P29504.2|RS27A_MANSE  RecName: Full=Ubiquitin-40S ribosomal pr...    208   1e-64   
ref|XP_003707148.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    208   1e-64   
sp|P68203.2|RS27A_SPOFR  RecName: Full=Ubiquitin-40S ribosomal pr...    207   1e-64   
gb|EHJ77179.1|  Ubiquitin-40S ribosomal protein S27a                    207   1e-64   
ref|XP_007795786.1|  putative ubiquitin-40s ribosomal protein s31...    207   1e-64   
ref|XP_007875027.1|  hypothetical protein PNEG_02980                    207   2e-64   
dbj|GAK66487.1|  ubiquitin/40S ribosomal protein S27a fusion            207   2e-64   
gb|KDN53338.1|  ubiquitin/40s ribosomal protein S27a fusion             207   2e-64   
gb|ACB70325.1|  ubiquitin/40S ribosomal protein S27a                    207   2e-64   
emb|CCF45248.1|  ubiquitin-40S ribosomal protein S27a                   207   2e-64   
ref|XP_011142713.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    207   2e-64   
ref|XP_011159939.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    207   2e-64   
ref|XP_009257448.1|  hypothetical protein FPSE_06055                    207   2e-64   
gb|KIW05468.1|  ubiquitin-40S ribosomal protein S27a                    207   2e-64   
gb|KFH46012.1|  Ubiquitin-40S ribosomal protein-like protein            207   3e-64   
gb|ADU04750.1|  ubiquitin extension protein                             206   3e-64   
gb|ABX44800.1|  ubiquinated putative 40S ribosomal protein RPS27A       207   3e-64   
ref|XP_001729434.1|  hypothetical protein MGL_3469                      207   3e-64   
dbj|BAC56381.1|  similar to ubiquitin-S27a fusion protein               206   3e-64   
ref|XP_008365153.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    207   3e-64   
ref|XP_004891890.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    207   3e-64   
ref|XP_006968883.1|  ubiquitin/small ribosomal subunit protein 31...    206   4e-64   
dbj|BAD05031.1|  ubiquitin                                              206   4e-64   
emb|CAH04128.1|  ubiquitin/ribosomal protein S27Ae fusion protein       206   4e-64   
dbj|BAK02751.1|  predicted protein                                      206   4e-64   
ref|NP_001091826.1|  ubiquitin and ribosomal protein S27a               206   4e-64   
ref|XP_005959116.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    209   5e-64   
ref|XP_001941819.1|  ubiquitin-40S ribosomal protein S31 fusion p...    206   5e-64   
ref|XP_005486911.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    207   5e-64   
emb|CAJ01880.1|  ubiquitin/ribosomal protein S27Ae fusion protein       206   5e-64   
ref|XP_004654621.1|  PREDICTED: uncharacterized protein LOC101599255    213   5e-64   
ref|XP_009667383.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    207   6e-64   
ref|XP_005238671.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    206   6e-64   
emb|CAJ01881.1|  ubiquitin/ribosomal protein S27Ae fusion protein       206   6e-64   
emb|CCT71659.1|  probable ubiquitin/ribosomal protein S27a fusion...    206   6e-64   
ref|XP_008076828.1|  Ubiquitin-like protein                             206   7e-64   
gb|EMS21244.1|  small subunit ribosomal protein S27Ae                   206   7e-64   
gb|KDN42452.1|  hypothetical protein RSAG8_06769                        206   7e-64   
ref|XP_574121.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a...    206   7e-64   
ref|XP_007166707.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    206   8e-64   
ref|XP_397323.2|  PREDICTED: ribosome biogenesis protein NSA2 hom...    206   1e-63   
gb|KFP24383.1|  Ubiquitin-40S ribosomal protein S27a                    205   1e-63   
ref|XP_010283844.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    205   1e-63   
gb|KFV78322.1|  Ubiquitin-40S ribosomal protein S27a                    204   1e-63   
ref|XP_010194368.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    205   1e-63   
ref|XP_003799950.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    205   2e-63   
ref|XP_009945702.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    205   2e-63   
ref|XP_006866205.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    205   2e-63   
ref|XP_006122235.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    204   2e-63   
ref|XP_009286758.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    204   2e-63   
ref|XP_008640291.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    205   2e-63   
ref|XP_009070695.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    204   2e-63   
gb|KIL69292.1|  hypothetical protein M378DRAFT_775165                   204   3e-63   
gb|AGN29644.1|  40S ribosomal protein S27a                              204   3e-63   
ref|XP_004330561.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    204   3e-63   
ref|XP_010704696.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    206   3e-63   
ref|XP_007453416.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    204   4e-63   
gb|ABG46422.1|  ubiquitin/ribosomal protein S27 fusion protein          204   4e-63   
ref|XP_010401401.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    204   5e-63   
gb|EOB01801.1|  Ubiquitin                                               203   5e-63   
ref|XP_007115679.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    204   5e-63   
gb|AGH68503.1|  ubiquitin extension protein                             203   5e-63   
ref|XP_011062194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    204   5e-63   
gb|ESA15414.1|  hypothetical protein GLOINDRAFT_346052                  203   6e-63   
gb|ABN54483.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    203   6e-63   
ref|XP_009480940.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    203   7e-63   
ref|XP_010146975.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    203   7e-63   
ref|XP_008923123.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    204   9e-63   
ref|XP_009929631.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    202   9e-63   
ref|XP_005018946.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    203   1e-62   
ref|XP_003851546.1|  ubiquitin-40S ribosomal protein S31                203   1e-62   
ref|XP_009884369.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    203   1e-62   
ref|XP_010003219.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    206   1e-62   
ref|XP_006901413.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    203   1e-62   
ref|XP_010595590.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    202   2e-62   
ref|XP_009317915.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    202   2e-62   
gb|KFP93009.1|  Ubiquitin-40S ribosomal protein S27a                    201   2e-62   
gb|KFW64033.1|  Ubiquitin-40S ribosomal protein S27a                    201   2e-62   
ref|XP_007295337.1|  putative ubiquitin / ribosomal protein S27a        207   2e-62   
ref|XP_004269939.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    202   3e-62   
ref|XP_006833816.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    202   3e-62   
ref|XP_009926111.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    201   3e-62   
ref|XP_007928008.1|  hypothetical protein MYCFIDRAFT_54296              202   3e-62   
ref|XP_011352403.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    202   3e-62   
ref|NP_001155610.1|  ribosomal protein S27A-like                        201   3e-62   
gb|EEH04179.1|  ubiquitin                                               201   4e-62   
gb|AAX48904.1|  S27a-ubiquitin                                          201   6e-62   
emb|CAA76578.1|  ubiquitin                                              201   6e-62   
gb|KFP78128.1|  Ubiquitin-40S ribosomal protein S27a                    200   6e-62   
ref|XP_008875293.1|  ubiquitin-40S ribosomal protein S27a               201   6e-62   
ref|XP_001746700.1|  hypothetical protein                               201   6e-62   
emb|CAG12343.1|  unnamed protein product                                200   7e-62   
ref|XP_006675175.1|  hypothetical protein BATDEDRAFT_18421              202   7e-62   
ref|XP_001418619.1|  Ribosomal protein S27a, component of cytosol...    200   9e-62   
ref|XP_006747376.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    200   1e-61   
ref|XP_009639081.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    201   1e-61   
gb|AGN29645.1|  40S ribosomal protein S27a                              200   1e-61   
ref|XP_002173465.1|  ribomal-ubiquitin fusion protein Ubi5              200   1e-61   
ref|XP_006731505.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    200   1e-61   
ref|XP_004637391.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    200   1e-61   
ref|XP_008480202.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    200   2e-61   
ref|XP_001904865.1|  hypothetical protein                               199   2e-61   
ref|NP_001119694.1|  ribosomal protein S27A                             199   3e-61   
ref|XP_002172480.1|  ribomal-ubiquitin fusion protein Ubi5              199   3e-61   
ref|XP_009266087.1|  Ubiquitin-40S ribosomal protein S27a               199   4e-61   
ref|XP_009531416.1|  hypothetical protein PHYSODRAFT_355036             199   4e-61   
gb|ABZ04273.1|  ribosomal protein rps27a                                198   4e-61   
ref|XP_004318058.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    201   8e-61   
ref|XP_006960084.1|  ubiquitin/40s ribosomal protein S27a fusion        198   9e-61   
ref|XP_002902716.1|  ubiquitin, putative                                198   1e-60   
pdb|3U5G|FF  Chain f, The Structure Of The Eukaryotic Ribosome At...    197   2e-60   
ref|XP_004348414.1|  ubiquitin/ribosomal protein S27a fusion protein    197   2e-60   
gb|AIY34646.1|  ribosomal protein                                       197   2e-60   
ref|XP_003349378.1|  ubiquitin-40S ribosomal protein S31 fusion p...    197   2e-60   
ref|XP_008608418.1|  ubiquitin-40S ribosomal protein S27a               197   2e-60   
emb|CAA33390.1|  UBI 3 fusion protein (149 AA)                          196   3e-60   
gb|ADK34019.1|  ubiquitin-Like family 1                                 197   3e-60   
gb|AEA86332.1|  ubiquitin extension protein                             196   3e-60   
gb|AAA56880.1|  ubiquitin/S27a fusion protein                           196   4e-60   
gb|ABV58643.1|  ubquitin                                                195   5e-60   
ref|XP_007685506.1|  hypothetical protein COCMIDRAFT_88724              196   5e-60   
gb|AEI29168.1|  ubiquitin-like protein                                  195   5e-60   
ref|XP_002143991.1|  ubiquitin-40S ribosomal protein S31 fusion p...    196   8e-60   
ref|XP_008712206.1|  ubiquitin-40S ribosomal protein S27a               196   8e-60   
ref|XP_005109406.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    196   9e-60   



>ref|XP_011003162.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=202

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  52   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  111

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  112  TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  171

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  172  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  200



>ref|XP_006488031.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
Length=164

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  14   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  73

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  74   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  133

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  134  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  162



>gb|AAZ83341.1| ubiquitin extension protein [Gossypium hirsutum]
 gb|KJB41754.1| hypothetical protein B456_007G119500 [Gossypium raimondii]
 gb|KJB69904.1| hypothetical protein B456_011G049100 [Gossypium raimondii]
Length=156

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  82   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  141

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  142  TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNAE  201

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAGTFMANHFDRHYCGKCGLTYVYQK GD
Sbjct  202  CGAGTFMANHFDRHYCGKCGLTYVYQKAGD  231


 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGG  213
            TLHLVLRLRGG
Sbjct  66   TLHLVLRLRGG  76



>gb|KJB49764.1| hypothetical protein B456_008G136200, partial [Gossypium raimondii]
Length=210

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  60   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  119

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKV RLRKECPNAE
Sbjct  120  TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAE  179

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  180  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  208



>gb|KJB06862.1| hypothetical protein B456_001G146500 [Gossypium raimondii]
Length=183

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  33   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  92

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKV RLRKECPNAE
Sbjct  93   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAE  152

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  153  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  181



>ref|XP_006424488.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
 gb|ESR37728.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
Length=156

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_008389677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008389867.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008343199.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008350959.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008353873.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008360710.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_009363083.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009367168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009376181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
Length=156

 Score =   249 bits (636),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|NP_001275598.1| ubiquitin-40S ribosomal protein S27a-like [Solanum tuberosum]
 ref|XP_002297752.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_002301539.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 ref|XP_002515213.1| ubiquitin, putative [Ricinus communis]
 ref|XP_004252948.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252949.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252950.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_006376957.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_006438329.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 ref|XP_006483898.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 ref|XP_007044700.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 ref|XP_007221513.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 ref|XP_007223652.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 ref|XP_008227802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Prunus mume]
 ref|XP_009609224.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609225.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609226.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009775091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_009775093.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_010044607.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eucalyptus grandis]
 ref|XP_010999619.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Populus euphratica]
 emb|CAA71132.1| ubiquitin extension protein [Solanum tuberosum]
 gb|ABA46785.1| ubiquitin extension protein-like protein [Solanum tuberosum]
 gb|ABK92566.1| unknown [Populus trichocarpa]
 gb|ABK93901.1| unknown [Populus trichocarpa]
 gb|ABK94236.1| unknown [Populus trichocarpa]
 gb|ABK94239.1| unknown [Populus trichocarpa]
 gb|ABK94284.1| unknown [Populus trichocarpa]
 gb|ACG70965.1| ubiquitin extensive-like protein [Ziziphus jujuba]
 gb|EEE80812.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 gb|EEE82557.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|EEF47197.1| ubiquitin, putative [Ricinus communis]
 gb|EMJ22712.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 gb|EMJ24851.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 gb|EOY00532.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|ERP54754.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ESR51569.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 gb|KCW86699.1| hypothetical protein EUGRSUZ_B03309 [Eucalyptus grandis]
 gb|KDO60231.1| hypothetical protein CISIN_1g031613mg [Citrus sinensis]
 emb|CDO98715.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   249 bits (636),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_002279878.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN71283.1| hypothetical protein VITISV_027093 [Vitis vinifera]
 emb|CAN70884.1| hypothetical protein VITISV_029192 [Vitis vinifera]
 gb|KDP28317.1| hypothetical protein JCGZ_14088 [Jatropha curcas]
Length=156

 Score =   249 bits (636),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_007157375.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 ref|XP_007157378.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
 gb|ESW29369.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 gb|ESW29372.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
Length=155

 Score =   249 bits (636),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAILQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_006374591.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ERP52388.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|ABN72579.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLA+LQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAILQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_008781194.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_008810072.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_010921349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Elaeis guineensis]
Length=156

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|ACJ83917.1| unknown [Medicago truncatula]
 gb|ACJ86209.1| unknown [Medicago truncatula]
 gb|AET04371.2| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  82   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  141

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  142  TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  201

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  202  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  230


 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGG  213
            TLHLVLRLRGG
Sbjct  66   TLHLVLRLRGG  76



>ref|XP_004504241.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_008358198.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=156

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQ+ G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQRAG  154



>gb|AAZ53360.1| ubiquitin extension protein [Nicotiana tabacum]
Length=156

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAG+FMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGSFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_003613203.1| Ubiquitin [Medicago truncatula]
 gb|AES96161.1| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_003629895.1| Ubiquitin [Medicago truncatula]
Length=232

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  83   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  142

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  143  TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAE  202

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  203  CGAGTFMANHFDRHYCGKCGLTYVYQKA  230



>ref|XP_011040332.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=156

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_003634320.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN75420.1| hypothetical protein VITISV_037877 [Vitis vinifera]
Length=156

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPN+E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNSE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_008793306.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Phoenix dactylifera]
Length=156

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD++GKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDTGKVTRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_004489824.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAGTFMANHFDRHYCGKCGLTYVYQK
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQK  152



>ref|XP_004288657.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 ref|XP_004297391.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 gb|AEQ75492.1| ubiquitin extension protein [Rosa multiflora]
Length=156

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV +LRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQKLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|AFK49579.1| unknown [Lotus japonicus]
Length=155

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAGTFMANHFDRHYCGKCGLTYVYQK
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQK  152



>ref|XP_002525394.1| ubiquitin, putative [Ricinus communis]
 ref|XP_009617530.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009629268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009761349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 ref|XP_009773069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 emb|CAA11268.1| ubiquitin extension protein [Nicotiana tabacum]
 gb|AAX07419.1| ubiquitin/s27a 40S ribosomal protein [Nicotiana benthamiana]
 gb|EEF37032.1| ubiquitin, putative [Ricinus communis]
Length=156

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>gb|ABK42077.1| ubiquitin extension protein [Capsicum annuum]
Length=179

 Score =   248 bits (634),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  29   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  88

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  89   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  148

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  149  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  177



>gb|KGN51791.1| hypothetical protein Csa_5G600925 [Cucumis sativus]
Length=188

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  38   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  97

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  98   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  157

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  158  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  186



>gb|ABI84265.1| ubiquitin/ribosomal protein S27a [Arachis hypogaea]
Length=155

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLA+LQFYK+D+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAILQFYKIDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK  
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAA  154



>ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
Length=156

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|AIX10775.1| ubiquitin, partial [Panax notoginseng]
Length=155

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  5    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  64

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKV++SGKV RLRKECPNAE
Sbjct  65   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVEDSGKVQRLRKECPNAE  124

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  125  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  153



>ref|XP_002320950.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_011040582.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
 gb|ABK92725.1| unknown [Populus trichocarpa]
 gb|EEE99265.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQ  G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQTAG  154



>ref|XP_006492389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 gb|KDO86853.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=156

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKAG  154



>gb|ADF36485.1| ubiquitin extension protein [Ageratina adenophora]
 gb|AID52926.1| ubiquitin [Carthamus tinctorius]
Length=153

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>gb|KDP26615.1| hypothetical protein JCGZ_17773 [Jatropha curcas]
Length=156

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY KPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYPKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>ref|XP_011082406.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
 gb|AFJ42574.1| ubiquitin extension protein 5 [Sesamum indicum]
 gb|KDP45613.1| hypothetical protein JCGZ_17220 [Jatropha curcas]
Length=156

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>ref|NP_001269170.1| ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus]
 ref|XP_008446192.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cucumis melo]
 gb|AAQ76040.1| ubiquitin extension protein [Cucumis sativus]
 gb|ADN33826.1| ubiquitin extension protein [Cucumis melo subsp. melo]
Length=156

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>ref|XP_004142977.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 ref|XP_004172998.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 gb|KGN62301.1| Ubiquitin extension protein [Cucumis sativus]
Length=156

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/151 (97%), Positives = 148/151 (98%), Gaps = 1/151 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL+VLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLSVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK-GGD  450
            CGAGTFMANHFDRHYCGKCGLTYVYQK GGD
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKPGGD  156



>emb|CAN80663.1| hypothetical protein VITISV_036195 [Vitis vinifera]
Length=156

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNXKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_010941490.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=156

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_010040181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
 gb|KCW45422.1| hypothetical protein EUGRSUZ_L00891 [Eucalyptus grandis]
Length=156

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNGE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|AAL66206.1|AF386524_1 ubiquitin extension protein [Pyrus communis]
Length=154

 Score =   247 bits (630),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+S KV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSRKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|ACJ84122.1| unknown [Medicago truncatula]
Length=155

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SG V RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGTVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_008776477.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Phoenix 
dactylifera]
Length=162

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNVE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>sp|P62980.2|RS27A_SOLLC RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum lycopersicum]
 sp|P62981.2|RS27A_SOLTU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum tuberosum]
 emb|CAA41207.1| ubiquitin [Solanum lycopersicum]
 emb|CAA77735.1| ubiquitin monomer/ribosomal protein [Solanum tuberosum]
 gb|AAA19247.1| ubiquitin/ribosomal fusion protein [Solanum tuberosum]
Length=156

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD++GKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDTGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>ref|XP_011079491.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
Length=156

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLR+ECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLREECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>emb|CAA80334.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCG TYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGQTYVYQKA  153



>ref|XP_001774978.1| predicted protein [Physcomitrella patens]
 gb|EDQ60244.1| predicted protein [Physcomitrella patens]
Length=156

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/149 (95%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKV RLRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_003535084.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
Length=155

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/147 (97%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGK+ RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLALLQFYKVDDSGKLQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAGTFMANHFDRHYCGKCGLTYVYQK
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQK  152



>gb|AFK43562.1| unknown [Medicago truncatula]
Length=155

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCG TYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGPTYVYQKA  153



>ref|XP_010248517.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nelumbo nucifera]
Length=156

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLA+LQFYKVD+SGKV RLRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLALLQFYKVDDSGKVQRLRKECPNQE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_010270924.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL VLQFYKVD+SGKV RLRKECPNA+
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLPVLQFYKVDDSGKVQRLRKECPNAD  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|AHA83529.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKV++SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVEDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>ref|NP_001238181.1| uncharacterized protein LOC100527579 [Glycine max]
 ref|XP_003517689.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
 gb|ACU16690.1| unknown [Glycine max]
 gb|KHN00366.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
 gb|KHN14565.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=155

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKL +LQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLGILQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus domestica]
Length=156

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSD+IDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDSIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SG+V RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGQVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|AAG13985.1|AF298826_1 ubiquitin/ribosomal protein 27a [Prunus avium]
Length=156

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYK D+SGKV +LRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKGDDSGKVQKLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|ABH08969.1| ubiquitin extension protein [Morus bombycis]
Length=156

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/149 (95%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLA LQFYK+D+SGKV RLRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAALQFYKIDDSGKVSRLRKECPNDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_010270921.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   244 bits (623),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL VLQFYKVD+SGKV RLRKECPNA+
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLPVLQFYKVDDSGKVQRLRKECPNAD  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_004229050.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Solanum lycopersicum]
Length=156

 Score =   244 bits (623),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 142/149 (95%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL VLQFYKVD++GKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLTVLQFYKVDDTGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>gb|EYU38434.1| hypothetical protein MIMGU_mgv1a015486mg [Erythranthe guttata]
Length=156

 Score =   244 bits (623),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKL+VLQ+YK+D+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLSVLQYYKIDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYAKAG  154



>ref|NP_001238483.1| uncharacterized protein LOC100527854 [Glycine max]
 gb|ACU17047.1| unknown [Glycine max]
Length=155

 Score =   244 bits (623),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLALLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFD HYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDPHYCGKCGLTYVYQKA  153



>sp|P47905.2|RS27A_LUPAL RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Lupinus albus]
 emb|CAA80333.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   244 bits (622),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNTE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCG TYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGKTYVYQKA  153



>gb|ABR16172.1| unknown [Picea sitchensis]
 gb|ABR16495.1| unknown [Picea sitchensis]
 gb|ABR16621.1| unknown [Picea sitchensis]
Length=156

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKLAVLQ+YKVD+SGKV RLRKECPN +
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLAVLQYYKVDDSGKVQRLRKECPNQD  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK  
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAA  154



>ref|XP_001762629.1| predicted protein [Physcomitrella patens]
 gb|EDQ72428.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKV RLRKECPN +
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPD  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_009104378.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3 [Brassica rapa]
 emb|CDY66301.1| BnaA04g27270D [Brassica napus]
 emb|CDY25100.1| BnaC06g18420D [Brassica napus]
 emb|CDY11410.1| BnaA09g39760D [Brassica napus]
 emb|CDX93983.1| BnaC04g21420D [Brassica napus]
 emb|CDX76623.1| BnaC08g32090D [Brassica napus]
 emb|CDX67885.1| BnaA07g19250D [Brassica napus]
Length=157

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|NP_566095.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|NP_001189768.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|XP_002880283.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006296217.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
 sp|P59232.2|R27AB_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK53000.1|AF375416_1 At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAA32907.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAC34235.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM65909.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM98297.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAN28749.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|EFH56542.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10801.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|AEC10802.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|EOA29115.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
Length=157

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|XP_006402395.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
 gb|ESQ43848.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
Length=157

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|XP_010506742.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>gb|AFX96040.1| ubiquitin extension protein [Grimmia pilifera]
Length=156

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKV RLRKECPN +
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPD  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK  
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAA  154



>ref|XP_001754264.1| predicted protein [Physcomitrella patens]
 ref|XP_001762712.1| predicted protein [Physcomitrella patens]
 gb|EDQ72511.1| predicted protein [Physcomitrella patens]
 gb|EDQ80714.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKV RLRKECPN +
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPD  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>gb|EPS73110.1| hypothetical protein M569_01646, partial [Genlisea aurea]
Length=157

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  7    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  66

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLA+L FYKVD+SGKV RLRKECPNAE
Sbjct  67   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAILHFYKVDDSGKVQRLRKECPNAE  126

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKC LTYVY K G
Sbjct  127  CGAGTFMANHFDRHYCGKCNLTYVYNKAG  155



>ref|XP_010507927.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010518402.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAGTFMA+HFDRHYCGKCGLTYVYQK
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQK  152



>ref|XP_009133797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
 emb|CDY50916.1| BnaC03g72450D [Brassica napus]
 emb|CDX83344.1| BnaA03g21620D [Brassica napus]
Length=157

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|XP_010675161.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Beta vulgaris 
subsp. vulgaris]
Length=156

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL VLQFYKV +S K+ RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLPVLQFYKVSDSAKIQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|NP_191784.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
 sp|P59233.2|R27AC_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-3; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32906.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 emb|CAB71885.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 gb|AAK97689.1| AT3g62250/T17J13_210 [Arabidopsis thaliana]
 gb|AAM61537.1| ubiquitin extension protein UBQ5 [Arabidopsis thaliana]
 gb|AAM98116.1| At3g62250/T17J13_210 [Arabidopsis thaliana]
 dbj|BAE98979.1| ubiquitin extension protein [Arabidopsis thaliana]
 gb|AEE80327.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
Length=157

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYK+D SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKIDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|XP_006397903.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
 gb|ESQ39356.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
Length=157

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|XP_010413295.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
Length=157

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 147/151 (97%), Gaps = 1/151 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KVKLAVLQFYK+D SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKVKLAVLQFYKIDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK-GGD  450
            CGAGTFMA+HFDRHYCGKCGLTYVYQK GGD
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEGGD  156



>ref|XP_002876668.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006293091.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
 ref|XP_010512610.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010468976.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 gb|EFH52927.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA25989.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
Length=157

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/151 (96%), Positives = 147/151 (97%), Gaps = 1/151 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYK+D SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKIDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK-GGD  450
            CGAGTFMA+HFDRHYCGKCGLTYVYQK GGD
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEGGD  156



>gb|EYU46866.1| hypothetical protein MIMGU_mgv1a015483mg [Erythranthe guttata]
Length=156

 Score =   242 bits (618),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKL+VLQ+YK+D+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLSVLQYYKIDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAGTFMANHFDRHYCGKCGLTYVY K
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYAK  152



>ref|XP_006832935.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
 gb|ERM98213.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
Length=156

 Score =   242 bits (618),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/149 (93%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL +LQFYKVD+SGKV ++RKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLPILQFYKVDDSGKVQKIRKECPNQE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|XP_009416508.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391524.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414159.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   241 bits (616),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            ECGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYQKA  154



>ref|XP_010251196.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   241 bits (616),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL++LQFYKVD+SGKV +LRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLSLLQFYKVDDSGKVQKLRKECPNQE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|KFK35409.1| hypothetical protein AALP_AA5G280900 [Arabis alpina]
 gb|KFK37468.1| hypothetical protein AALP_AA4G260800 [Arabis alpina]
Length=157

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHKHKKVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|XP_009414918.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=167

 Score =   241 bits (615),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVYQK
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYQK  153



>ref|XP_009772672.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
Length=156

 Score =   240 bits (613),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYN+QKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDDRTLADYNLQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHY GKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYYGKCGLTYVYNKAG  154



>ref|XP_009383724.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   240 bits (613),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/149 (95%), Positives = 144/149 (97%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVSRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            ECGAGTFMANHFDRHYCGKCGLTYVY K 
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYTKA  154



>gb|AIH15195.1| ubiquitin-40S ribosomal protein S27a-like protein [Hedychium 
coronarium]
Length=157

 Score =   240 bits (613),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 145/150 (97%), Gaps = 1/150 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQ+YKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQYYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            ECGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYNKAG  155



>ref|XP_009116899.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
Length=157

 Score =   239 bits (610),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 139/149 (93%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN QKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNTQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVL LRGGAKKRKKKTYTKPKK + KHKKVKLAVLQFYKVD SGKV RLRKECPNA 
Sbjct  66   TLHLVLPLRGGAKKRKKKTYTKPKKNERKHKKVKLAVLQFYKVDGSGKVQRLRKECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMASHFDRHYCGKCGLTYVYQKEG  154



>ref|NP_001042915.1| Os01g0328400 [Oryza sativa Japonica Group]
 ref|XP_006644130.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Oryza 
brachyantha]
 sp|Q9ARZ9.1|R27AA_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB39294.1| ubiquitin / ribosomal protein S27a.1 [Oryza sativa Japonica Group]
 dbj|BAF04829.1| Os01g0328400 [Oryza sativa Japonica Group]
 gb|EAY73811.1| hypothetical protein OsI_01687 [Oryza sativa Indica Group]
 gb|EAY73815.1| hypothetical protein OsI_01691 [Oryza sativa Indica Group]
 gb|EAZ11698.1| hypothetical protein OsJ_01558 [Oryza sativa Japonica Group]
 dbj|BAG88191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=155

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_004968668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Setaria 
italica]
Length=155

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 145/148 (98%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_003568865.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Brachypodium 
distachyon]
 dbj|BAJ88878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_003567648.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Brachypodium 
distachyon]
 sp|P0CG87.1|RS272_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62699.1| ubiquitin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92072.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDES-GKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+S GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDSTGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            +CGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  DCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_006846976.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
 gb|ERN08557.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
Length=156

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKVKL VLQFYKVD+SGKV +LRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKVKLPVLQFYKVDDSGKVQKLRKECPNQE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVYQK G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>ref|NP_001275323.1| putative ubiquitin extension protein [Solanum tuberosum]
 gb|ABY21245.1| putative ubiquitin extension protein [Solanum tuberosum]
Length=156

 Score =   237 bits (605),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY KPKKIK K KKVKLAVLQFYKVD++GKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYAKPKKIKPKKKKVKLAVLQFYKVDDTGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMANHFDRHYCGKCGLTYVY K G
Sbjct  126  CGAGTFMANHFDRHYCGKCGLTYVYNKAG  154



>gb|AEE98366.1| ubiquitin [Deschampsia antarctica]
Length=155

 Score =   237 bits (605),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>sp|P0CG86.1|RS271_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62698.1| ubiquitin [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            +CGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  DCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_004977103.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Setaria 
italica]
Length=155

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            +CGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  DCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>gb|AFI60245.1| ubiquitin, partial [Panicum virgatum]
Length=153

 Score =   236 bits (603),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  4    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  63

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  64   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNA  123

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            +CGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  124  DCGAGTFMANHFDRHYCGKCGLTYVYNQ  151



>ref|XP_002457768.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 ref|XP_008655871.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|EES02888.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 gb|AFW80667.1| polyubiquitin-like protein isoform 1 [Zea mays]
 gb|AFW80668.1| polyubiquitin-like protein isoform 2 [Zea mays]
Length=155

 Score =   237 bits (604),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAG FMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_009385375.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=158

 Score =   237 bits (604),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 143/149 (96%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSD IDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDAIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            ECGAGTFMANHFDRHYCGKCGLTYVYQK 
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYQKA  154



>gb|ACA24140.1| ubiquitin [Lolium temulentum]
Length=155

 Score =   236 bits (603),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDGTGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>gb|ABR29645.1| ubiquitin, partial [Lolium perenne]
Length=155

 Score =   236 bits (603),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNA
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDGTGKVTRLRKECPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_010914703.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X3 [Elaeis guineensis]
Length=207

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 143/150 (95%), Gaps = 1/150 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  40   KTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  99

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAE
Sbjct  100  TLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAE  159

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAGTFMAN+FDRHYCGKCGL  VYQK G+
Sbjct  160  CGAGTFMANYFDRHYCGKCGLN-VYQKAGE  188



>ref|NP_001131602.1| ubiquitin [Zea mays]
 ref|XP_002439338.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 sp|P27923.2|RS27A_MAIZE RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Zea mays]
 pir||JS0657 ubiquitin / ribosomal protein S27a - maize
 gb|AAA33519.1| ubiquitin fusion protein [Zea mays]
 gb|AAA70105.1| ubiquitin fusion protein [Zea mays]
 gb|ACF80088.1| unknown [Zea mays]
 gb|EES17768.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 gb|AFW84849.1| ubiquitin-40S ribosomal protein S27a Precursor [Zea mays]
 prf||2211240B ubiquitin fusion protein
Length=155

 Score =   235 bits (599),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 143/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNT  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAG FMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_010914702.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Elaeis guineensis]
Length=211

 Score =   236 bits (603),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 142/149 (95%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  40   KTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  99

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAE
Sbjct  100  TLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAE  159

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMAN+FDRHYCGKCGL  VYQK G
Sbjct  160  CGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>ref|XP_010914705.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X5 [Elaeis guineensis]
Length=188

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 142/149 (95%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  40   KTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  99

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAE
Sbjct  100  TLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAE  159

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMAN+FDRHYCGKCGL  VYQK G
Sbjct  160  CGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>ref|XP_006654079.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oryza brachyantha]
Length=155

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 143/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNN  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            +CGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  DCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|NP_001054720.2| Os05g0160200 [Oryza sativa Japonica Group]
 sp|P51431.3|R27AB_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Oryza sativa Japonica 
Group]
 pdb|3J60|FF Chain f, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAT93912.1| putative ubiquitin extension protein [Oryza sativa Japonica Group]
 gb|AAV43924.1| putative ubiquitin fusion protein [Oryza sativa Japonica Group]
 gb|ABR25414.1| 40S ribosomal protein S27a [Oryza sativa Indica Group]
 dbj|BAG99770.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62418.1| hypothetical protein OsJ_17209 [Oryza sativa Japonica Group]
 dbj|BAF16634.2| Os05g0160200 [Oryza sativa Japonica Group]
Length=155

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNN  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            +CGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  126  DCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_010914704.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X4 [Elaeis guineensis]
Length=193

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 142/149 (95%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  40   KTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  99

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAE
Sbjct  100  TLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAE  159

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMAN+FDRHYCGKCGL  VYQK G
Sbjct  160  CGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>ref|XP_010544941.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Tarenaya 
hassleriana]
 ref|XP_010523893.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Tarenaya hassleriana]
Length=155

 Score =   234 bits (597),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 145/151 (96%), Gaps = 3/151 (2%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD S KV RLRKECPN  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSNKVQRLRKECPN--  123

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK-GGD  450
            CGAGTFMA+HFDRHYCGKCGLTYVYQK GGD
Sbjct  124  CGAGTFMASHFDRHYCGKCGLTYVYQKDGGD  154



>ref|XP_008649366.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|ACG24702.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG24773.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG36278.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG38230.1| 40S ribosomal protein S27a [Zea mays]
 gb|AFW77223.1| polyubiquitin-like protein [Zea mays]
Length=155

 Score =   234 bits (596),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 143/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+ +GKV RLRKECPN 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDATGKVTRLRKECPNT  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAG FMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_010519353.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2, partial [Tarenaya 
hassleriana]
Length=150

 Score =   233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 2/147 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD S KV RLRKECPN  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSNKVQRLRKECPN--  123

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAGTFMA+HFDRHYCGKCGLTYVYQK
Sbjct  124  CGAGTFMASHFDRHYCGKCGLTYVYQK  150



>ref|XP_006306408.1| hypothetical protein CARUB_v10012327mg [Capsella rubella]
 gb|EOA39306.1| hypothetical protein CARUB_v10012327mg [Capsella rubella]
Length=156

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECP+A 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSAS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CG GTFMA+HFDRHYCGKCG TYV++K
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFKK  152



>gb|AEO11783.1| ubiquitin [Lolium perenne]
Length=147

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 142/146 (97%), Gaps = 1/146 (1%)
 Frame = +1

Query  7    LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  186
            LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  1    LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  60

Query  187  HLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNAEC  363
            HLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNAEC
Sbjct  61   HLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDGTGKVTRLRKECPNAEC  120

Query  364  GAGTFMANHFDRHYCGKCGLTYVYQK  441
            GAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  121  GAGTFMANHFDRHYCGKCGLTYVYNQ  146



>gb|ACG31121.1| 40S ribosomal protein S27a [Zea mays]
Length=155

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 143/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+ + KV RLRKECPN+
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDTTSKVTRLRKECPNS  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAG FMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>gb|AAA70104.1| ubiquitin fusion protein [Zea mays]
 prf||2211240A ubiquitin fusion protein
Length=155

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 142/148 (96%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKVKL+VLQFYKVD+ + KV RLRKECPN+
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKTKHKHKKVKLSVLQFYKVDDTTSKVTRLRKECPNS  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAG FMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_010914701.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Elaeis guineensis]
Length=225

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 142/149 (95%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  40   KTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  99

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAE
Sbjct  100  TLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAE  159

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGTFMAN+FDRHYCGKCGL  VYQK G
Sbjct  160  CGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>ref|NP_001150700.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG40048.1| 40S ribosomal protein S27a [Zea mays]
 tpg|DAA48105.1| TPA: polyubiquitin-like protein [Zea mays]
Length=155

 Score =   232 bits (591),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 142/148 (96%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+ + KV RLRKECPN 
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDTTSKVTRLRKECPNT  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAG FMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_009103181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 ref|XP_009115529.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 emb|CDY44146.1| BnaA09g31060D [Brassica napus]
 emb|CDY25783.1| BnaA07g09990D [Brassica napus]
 emb|CDY12472.1| BnaC07g13120D [Brassica napus]
Length=156

 Score =   232 bits (591),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CG GTFMA+HFDRHYCGKCG TYV++K
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFKK  152



>gb|AFX60090.1| ribosomal protein S27a, partial [Brassica oleracea]
Length=152

 Score =   232 bits (591),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  2    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  61

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECP+  
Sbjct  62   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVS  121

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CG GTFMA+HFDRHYCGKCG TYV++K
Sbjct  122  CGPGTFMASHFDRHYCGKCGTTYVFKK  148



>ref|XP_002890580.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66839.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CG GTFMA+HFDRHYCGKCG TYV++K 
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFKKA  153



>ref|NP_001105472.1| ubiquitin-40S ribosomal protein S27a [Zea mays]
 emb|CAA63150.1| ORF [Zea mays]
Length=155

 Score =   231 bits (590),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 142/148 (96%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLHLV+RLRGGAKK KKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRK+CPNA
Sbjct  66   TLHLVVRLRGGAKKPKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKDCPNA  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            EC AG FMANHFDRHYCGKCGLTYVY +
Sbjct  126  ECHAGVFMANHFDRHYCGKCGLTYVYNQ  153



>gb|ADE58112.1| ubiquitin/ribosomal fusion protein [Citrus trifoliata]
Length=156

 Score =   231 bits (589),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVES DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLA+YNIQKES
Sbjct  6    KTLTGKTITLEVESRDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLAEYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLH VLR RGGAKK KKKTYTKPKKIKHK KKVKLA LQF KVD+SGKV RLRKECPNAE
Sbjct  66   TLHFVLRFRGGAKKSKKKTYTKPKKIKHKKKKVKLAFLQFSKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAG FMANHFDR YCGKCGLTYVYQK G
Sbjct  126  CGAGPFMANHFDRQYCGKCGLTYVYQKAG  154



>gb|KHN22999.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=151

 Score =   231 bits (589),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 4/147 (3%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLALLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAGTFMANHFDR    KCGLTYVYQK
Sbjct  126  CGAGTFMANHFDR----KCGLTYVYQK  148



>ref|NP_173755.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
 sp|P59271.2|R27AA_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF79581.1|AC007945_1 F28C11.5 [Arabidopsis thaliana]
 gb|AAF87001.1|AC005292_10 F26F24.28 [Arabidopsis thaliana]
 gb|AAM62617.1| ubiquitin extension protein, putative [Arabidopsis thaliana]
 gb|ABD59101.1| At1g23410 [Arabidopsis thaliana]
 gb|AEE30384.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
Length=156

 Score =   231 bits (588),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKVKLAVLQFYKVD SGKV RL+KECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHTHKKVKLAVLQFYKVDGSGKVQRLKKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CG GTFMA+HFDRHYCGKCG TYV++K 
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFKKA  153



>ref|XP_006416085.1| hypothetical protein EUTSA_v10008988mg [Eutrema salsugineum]
 gb|ESQ34438.1| hypothetical protein EUTSA_v10008988mg [Eutrema salsugineum]
Length=156

 Score =   231 bits (588),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD +GKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGTGKVQRLRKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CG GTFMA+HFDRHYCGKCG TYV++K
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFKK  152



>ref|XP_010498849.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Camelina sativa]
Length=156

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKVKLAVLQFYKVD SGKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHVHKKVKLAVLQFYKVDGSGKVQRLRKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQ  438
            CG GTFMA+HFDRHYCGKCG TYV++
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFK  151



>emb|CDY04715.1| BnaC05g18740D [Brassica napus]
Length=156

 Score =   230 bits (586),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CG GTFMA+HFDRH+CGKCG TYV++K
Sbjct  126  CGPGTFMASHFDRHHCGKCGTTYVFKK  152



>ref|XP_010460127.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Camelina 
sativa]
Length=156

 Score =   229 bits (584),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKVKLAVLQFY+VD SGKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHVHKKVKLAVLQFYRVDGSGKVQRLRKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQ  438
            CG GTFMA+HFDRHYCGKCG TYV++
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFK  151



>ref|XP_010477636.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Camelina 
sativa]
Length=156

 Score =   229 bits (583),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKVKLAVLQFYKVD SGKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHVHKKVKLAVLQFYKVDGSGKVQRLRKECPSVG  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQ  438
            CG GTFMA+HFDRHYCGKCG TYV++
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFK  151



>gb|AAW56553.1| ubiquitin/s27a 40s ribosomal protein [Nicotiana benthamiana]
Length=156

 Score =   228 bits (582),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITL+VESSDTIDNVKAKI+DKEGIPP QQRLIFAGKQ+EDG TLADYNIQKES
Sbjct  6    KTLTGKTITLKVESSDTIDNVKAKIEDKEGIPPYQQRLIFAGKQVEDGCTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRL GGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNA+
Sbjct  66   TLHLVLRLHGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAK  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAGT+MANHFDR+YCGKCGLTYVY K G
Sbjct  126  CGAGTYMANHFDRYYCGKCGLTYVYNKAG  154



>ref|XP_006349858.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
tuberosum]
Length=181

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/138 (98%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYCGK  414
            CGAGTFMANHFDRHYCGK
Sbjct  126  CGAGTFMANHFDRHYCGK  143



>gb|KFK44432.1| hypothetical protein AALP_AA1G255700 [Arabis alpina]
Length=156

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY+IQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYSIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKK+KHKHKKVKLAVLQFYKVD SGKV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKLKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVS  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CG GTFMA+HFDRHYCGKCG TYV++K
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYVFKK  152



>ref|XP_007514688.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14928.1| predicted protein [Bathycoccus prasinos]
Length=169

 Score =   227 bits (578),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  22   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  81

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGG KKRKKKTYTKPKKIKH HKK KL  L+ YKVD++GKV RLRKECP  E
Sbjct  82   TLHLVLRLRGGGKKRKKKTYTKPKKIKHVHKKNKLGFLKLYKVDDAGKVTRLRKECPAPE  141

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQ  438
            CGAG FMANHFDRHYCGKCGLTYVY+
Sbjct  142  CGAGVFMANHFDRHYCGKCGLTYVYE  167



>ref|XP_007051235.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|EOX95392.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
Length=172

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYC  408
            CGAGTFMANHFDRHYC
Sbjct  126  CGAGTFMANHFDRHYC  141



>gb|KCW58175.1| hypothetical protein EUGRSUZ_H00892 [Eucalyptus grandis]
Length=145

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYC  408
            CGAGTFMANHFDRHYC
Sbjct  126  CGAGTFMANHFDRHYC  141



>ref|XP_006001599.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Latimeria chalumnae]
Length=156

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPSEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA+HFDRHYCGKC LTY + K
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNK  152



>gb|AGC65581.1| UBQ5, partial [Agrostis stolonifera]
Length=156

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 143/148 (97%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  7    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  66

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TL+LVLRLRGGAKKRKKK YTKPKK +HKHKKVKLA+LQFYKVD+ +GKV RLRKECPNA
Sbjct  67   TLYLVLRLRGGAKKRKKKAYTKPKKQRHKHKKVKLALLQFYKVDDATGKVTRLRKECPNA  126

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            ECGAGTFMANHFDRHYCGKCGLTYVY +
Sbjct  127  ECGAGTFMANHFDRHYCGKCGLTYVYNQ  154



>ref|XP_010552656.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Tarenaya hassleriana]
Length=156

 Score =   225 bits (573),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKH  KKVKLAVLQFYKVD S KV RLRKECP+  
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHTKKKVKLAVLQFYKVDGSCKVQRLRKECPSVG  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CG GTFMA+HFDRHYCGKCG TY ++   D
Sbjct  126  CGPGTFMASHFDRHYCGKCGTTYAFKAPAD  155



>ref|XP_010216499.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tinamus guttatus]
Length=156

 Score =   225 bits (573),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_004644620.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
Length=156

 Score =   225 bits (573),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K GD
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPGD  155



>ref|XP_011482499.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryzias latipes]
 ref|XP_011482500.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryzias latipes]
Length=156

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCTLTYCFNKPED  155



>gb|ACH71005.1| ribosomal protein S27-3 [Salmo salar]
 gb|ACI66719.1| Ubiquitin [Salmo salar]
 gb|ACN09871.1| Ubiquitin [Salmo salar]
 gb|ACN12218.1| Ubiquitin [Salmo salar]
 gb|ADD37999.1| Ubiquitin [Lepeophtheirus salmonis]
 gb|ADM16009.1| Ubiquitin [Salmo salar]
 emb|CDQ70304.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPAEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|EHH55578.1| hypothetical protein EGM_04813 [Macaca fascicularis]
Length=156

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGA+KRKKK+Y+ PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAQKRKKKSYSTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|KGL79724.1| Ubiquitin-40S ribosomal protein S27a, partial [Tinamus guttatus]
Length=158

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  8    KTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  67

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  68   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEE  127

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  128  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  157



>gb|AER12038.1| ubiquitin extension protein, partial [Paeonia suffruticosa]
Length=140

 Score =   224 bits (571),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  34   VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  213
            VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  1    VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  60

Query  214  AkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAECGAGTFMANHF  393
            AKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKV RLRKECPN +CGAGTFMANHF
Sbjct  61   AKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNGDCGAGTFMANHF  120

Query  394  DRHYCGKCGLTYVYQKGGD  450
            DRHYCGKCGLTYVY+K  D
Sbjct  121  DRHYCGKCGLTYVYKKAAD  139



>ref|NP_956796.1| ubiquitin-40S ribosomal protein S27a [Danio rerio]
 ref|NP_001187222.1| ubiquitin-40S ribosomal protein S27a [Ictalurus punctatus]
 ref|XP_003455526.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oreochromis 
niloticus]
 ref|XP_003963790.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Takifugu 
rubripes]
 ref|XP_004575832.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Maylandia 
zebra]
 ref|XP_005743613.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Pundamilia 
nyererei]
 ref|XP_005812668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Xiphophorus 
maculatus]
 ref|XP_005945885.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Haplochromis 
burtoni]
 ref|XP_006638483.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Lepisosteus 
oculatus]
 ref|XP_006806933.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Neolamprologus brichardi]
 ref|XP_006806934.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Neolamprologus brichardi]
 ref|XP_007230176.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Astyanax mexicanus]
 ref|XP_007577064.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia formosa]
 ref|XP_008286554.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Stegastes partitus]
 ref|XP_008319624.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cynoglossus 
semilaevis]
 ref|XP_008428691.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia reticulata]
 ref|XP_010748172.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Larimichthys 
crocea]
 ref|XP_010790874.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Notothenia coriiceps]
 ref|XP_010868135.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Esox lucius]
 sp|P68200.2|RS27A_ICTPU RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Ictalurus punctatus]
 gb|AAK95212.1|AF402838_1 40S ribosomal protein S27a [Ictalurus punctatus]
 gb|AAH55524.1| Zgc:66168 [Danio rerio]
 dbj|BAF45917.1| ribosomal protein S27a [Solea senegalensis]
 gb|ACA05172.1| ribosomal protein S27a [Oncorhynchus masou formosanus]
 gb|AAI64449.1| Zgc:66168 protein [Danio rerio]
 gb|ACM08345.1| Ubiquitin [Salmo salar]
 gb|ACO09845.1| Ubiquitin [Osmerus mordax]
 gb|ACQ58277.1| Ubiquitin [Anoplopoma fimbria]
 gb|ADM64585.1| ribosomal protein S27a [Hypophthalmichthys nobilis]
 emb|CDQ88274.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score =   224 bits (571),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|AAM27203.1|AF502248_1 40s ribosomal protein S27a [Epinephelus coioides]
Length=156

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|KDO86852.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=145

 Score =   223 bits (569),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAE  125

Query  361  CGAGTFMANHFDRHYC  408
            CGAGTFMA+HFDRHYC
Sbjct  126  CGAGTFMASHFDRHYC  141



>ref|XP_003216177.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Anolis carolinensis]
Length=156

 Score =   223 bits (569),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKV LAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVTLAVLKYYKVDENGKISRLRRECPSEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|NP_990284.1| ubiquitin-40S ribosomal protein S27a [Gallus gallus]
 ref|NP_001274134.1| ubiquitin-40S ribosomal protein S27a [Gallus gallus]
 ref|XP_002199635.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Taeniopygia 
guttata]
 ref|XP_005042727.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Ficedula 
albicollis]
 ref|XP_005144071.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Melopsittacus 
undulatus]
 ref|XP_005299091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chrysemys picta 
bellii]
 ref|XP_005422655.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Geospiza fortis]
 ref|XP_005525525.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pseudopodoces 
humilis]
 ref|XP_006021641.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Alligator sinensis]
 ref|XP_006274498.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Alligator mississippiensis]
 ref|XP_007070121.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chelonia mydas]
 ref|XP_007432077.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Python 
bivittatus]
 ref|XP_007432078.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Python 
bivittatus]
 ref|XP_008491469.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Calypte anna]
 ref|XP_009091973.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Serinus canaria]
 ref|XP_009474412.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nipponia nippon]
 ref|XP_009900360.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Picoides pubescens]
 sp|P79781.3|RS27A_CHICK RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Gallus gallus]
 gb|AAC60279.1| ubiquitin/ribosomal protein [Gallus gallus]
 gb|ADK26674.1| ribosomal protein S27a [Zonotrichia albicollis]
 gb|ADK26767.1| ribosomal protein S27a [Zonotrichia albicollis]
Length=156

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|KFV68543.1| Ubiquitin-40S ribosomal protein S27a, partial [Picoides pubescens]
Length=157

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  7    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  66

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  67   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEE  126

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  127  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  156



>gb|AAH49478.1| Zgc:66168 protein, partial [Danio rerio]
Length=172

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  22   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  81

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  82   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADE  141

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  142  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  171



>gb|KFP00438.1| Ubiquitin-40S ribosomal protein S27a, partial [Calypte anna]
 gb|KFQ92324.1| Ubiquitin-40S ribosomal protein S27a, partial [Nipponia nippon]
Length=160

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  10   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  69

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  70   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEE  129

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  130  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  159



>ref|NP_002945.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_777203.1| ubiquitin-40S ribosomal protein S27a [Bos taurus]
 ref|NP_001016172.1| ribosomal protein S27a [Xenopus (Silurana) tropicalis]
 ref|NP_001086065.1| ribosomal protein S27a [Xenopus laevis]
 ref|NP_001129064.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_001166537.1| ubiquitin-40S ribosomal protein S27a [Cavia porcellus]
 ref|NP_001170884.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_001180515.1| 40S ribosomal protein S27a [Macaca mulatta]
 ref|NP_001239157.1| 40S ribosomal protein S27a [Canis lupus familiaris]
 ref|NP_001239528.1| 40S ribosomal protein S27a [Pan troglodytes]
 ref|NP_001271613.1| uncharacterized protein LOC101864869 [Macaca fascicularis]
 ref|XP_001375230.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Monodelphis 
domestica]
 ref|XP_001509244.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ornithorhynchus 
anatinus]
 ref|XP_001496841.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Equus caballus]
 ref|XP_002724420.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryctolagus 
cuniculus]
 ref|XP_002748274.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_002753065.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_002757792.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_003787974.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Otolemur garnettii]
 ref|XP_003830888.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan paniscus]
 ref|XP_003830889.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan paniscus]
 ref|XP_003908711.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Papio anubis]
 ref|XP_003908796.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Papio anubis]
 ref|XP_003949844.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan troglodytes]
 ref|XP_003949845.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan troglodytes]
 ref|XP_003984057.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Felis catus]
 ref|XP_004005993.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ovis aries]
 ref|XP_004029299.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004029300.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004029301.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_004029302.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004284424.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Orcinus orca]
 ref|XP_004322708.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tursiops truncatus]
 ref|XP_004369513.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Trichechus manatus 
latirostris]
 ref|XP_004403712.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Odobenus rosmarus 
divergens]
 ref|XP_004435735.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ceratotherium 
simum simum]
 ref|XP_004462050.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Dasypus novemcinctus]
 ref|XP_004580187.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ochotona princeps]
 ref|XP_004609268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sorex araneus]
 ref|XP_004669012.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Jaculus jaculus]
 ref|XP_004632487.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
 ref|XP_004691463.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Condylura 
cristata]
 ref|XP_004691464.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Condylura 
cristata]
 ref|XP_004775726.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mustela putorius 
furo]
 ref|XP_004806951.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mustela putorius 
furo]
 ref|XP_004889095.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Heterocephalus 
glaber]
 ref|XP_004867330.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Heterocephalus 
glaber]
 ref|XP_005002694.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Cavia 
porcellus]
 ref|XP_005070404.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mesocricetus 
auratus]
 ref|XP_005212615.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Bos 
taurus]
 ref|XP_005322068.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005322069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Ictidomys 
tridecemlineatus]
 ref|XP_005385845.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chinchilla lanigera]
 ref|XP_005575917.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Macaca 
fascicularis]
 ref|XP_005686669.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Capra hircus]
 ref|XP_005884671.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis brandtii]
 ref|XP_005889537.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Bos 
mutus]
 ref|XP_005889538.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Bos 
mutus]
 ref|XP_005968746.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pantholops hodgsonii]
 ref|XP_006108994.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Myotis 
lucifugus]
 ref|XP_006174513.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus ferus]
 ref|XP_006217782.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vicugna pacos]
 ref|XP_006159100.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tupaia chinensis]
 ref|XP_006778654.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis davidii]
 ref|XP_006738706.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006738707.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Leptonychotes weddellii]
 ref|XP_006752156.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Leptonychotes 
weddellii]
 ref|XP_006868070.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Chrysochloris 
asiatica]
 ref|XP_006909658.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pteropus alecto]
 ref|XP_006993251.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Peromyscus maniculatus 
bairdii]
 ref|XP_007075460.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Panthera tigris 
altaica]
 ref|XP_007107112.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Physeter catodon]
 ref|XP_006043311.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
 ref|XP_006071325.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
 ref|XP_007190066.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007465731.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Lipotes vexillifer]
 ref|XP_007532217.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Erinaceus europaeus]
 ref|XP_007532218.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Erinaceus europaeus]
 ref|XP_007636802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cricetulus griseus]
 ref|XP_007936193.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Orycteropus 
afer afer]
 ref|XP_007968797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chlorocebus 
sabaeus]
 ref|XP_008160344.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eptesicus fuscus]
 ref|XP_008577062.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Galeopterus 
variegatus]
 ref|XP_008698096.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ursus maritimus]
 ref|XP_008821230.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nannospalax 
galili]
 ref|XP_008821231.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nannospalax 
galili]
 ref|XP_010331896.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Saimiri boliviensis 
boliviensis]
 ref|XP_010614144.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fukomys damarensis]
 ref|XP_010839969.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Bison bison 
bison]
 ref|XP_010950168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus bactrianus]
 ref|XP_010988045.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus dromedarius]
 ref|XP_011236127.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ailuropoda melanoleuca]
 ref|XP_011362262.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pteropus vampyrus]
 sp|P62979.2|RS27A_HUMAN RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Homo sapiens]
 sp|P62992.2|RS27A_BOVIN RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Bos taurus]
 sp|P62978.2|RS27A_CAVPO RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Cavia porcellus]
 pir||UQHUR7 ubiquitin / ribosomal protein S27a, cytosolic [validated] - human
 pdb|4KZX|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|FF Chain f, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|FF Chain f, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|FF Chain f, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4W23|FF Chain f, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|FF Chain f, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 pdb|4D5L|FF Chain f, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 pdb|4D61|FF Chain f, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 emb|CAA44911.1| ubiquitin [Homo sapiens]
 gb|AAB21188.1| ubiquitin carboxyl extension protein [Homo sapiens]
 dbj|BAA11843.1| ubiquitin extention protein [Cavia porcellus]
 gb|AAC77907.1| ubiquitin-S27a fusion protein [Bos taurus]
 gb|AAH01392.1| Ribosomal protein S27a [Homo sapiens]
 gb|AAH66293.1| Ribosomal protein S27a [Homo sapiens]
 gb|AAH74147.1| MGC81889 protein [Xenopus laevis]
 dbj|BAE01745.1| unnamed protein product [Macaca fascicularis]
 emb|CAJ83451.1| ribosomal protein S27a [Xenopus (Silurana) tropicalis]
 gb|EAX00108.1| ribosomal protein S27a, isoform CRA_c [Homo sapiens]
 gb|EAX00110.1| ribosomal protein S27a, isoform CRA_c [Homo sapiens]
 gb|AAI35494.1| hypothetical protein LOC548926 [Xenopus (Silurana) tropicalis]
 gb|AAI02492.2| Ribosomal protein S27a [Bos taurus]
 dbj|BAG38058.1| unnamed protein product [Homo sapiens]
 gb|ACJ13725.1| epididymis luminal protein 112 [Homo sapiens]
 dbj|BAI47114.1| ribosomal protein S27a [synthetic construct]
 tpg|DAA24675.1| TPA: 40S ribosomal protein S27a [Bos taurus]
 gb|ADQ33198.1| ribosomal protein S27a [synthetic construct]
 gb|EHB05725.1| 40S ribosomal protein S27a [Heterocephalus glaber]
 gb|EHH22128.1| hypothetical protein EGK_05333 [Macaca mulatta]
 gb|AIC49655.1| RPS27A, partial [synthetic construct]
 gb|KFO18488.1| Ubiquitin-40S ribosomal protein S27a [Fukomys damarensis]
Length=156

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|AAA57047.1| ubiquitin, partial [synthetic construct]
Length=157

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|AAA36788.1| pro-ubiquitin, partial [Homo sapiens]
Length=152

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  2    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  61

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  62   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  121

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  122  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  151



>gb|AAH53371.1| Ribosomal protein S27a [Homo sapiens]
Length=156

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+ T PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_007400913.1| hypothetical protein PHACADRAFT_264025 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM50644.1| hypothetical protein PHACADRAFT_264025 [Phanerochaete carnosa 
HHB-10118-sp]
Length=159

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKK+KHK KKVK+A+L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKQYSTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>gb|EGN96831.1| hypothetical protein SERLA73DRAFT_185014 [Serpula lacrymans var. 
lacrymans S7.3]
Length=159

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHNDRQYCGKCGLTYTFQPG  153



>ref|XP_002733357.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Saccoglossus 
kowalevskii]
Length=157

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKT+T PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECPN +
Sbjct  66   TLHLVLRLRGGAKKRKKKTFTTPKKTKHKKKKVKLAVLKYYKVDENGKITRLRRECPNED  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD*A  456
            CGAG FMA+HFDR YCGKC LTYV+ K  D A
Sbjct  126  CGAGVFMASHFDRQYCGKCCLTYVFNKPEDKA  157



>ref|XP_005575916.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Macaca 
fascicularis]
Length=187

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  37   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  96

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  97   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  156

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  157  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  186



>gb|KIO10764.1| hypothetical protein M404DRAFT_20998 [Pisolithus tinctorius Marx 
270]
Length=159

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>ref|XP_007343921.1| ubiquitin-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD47990.1| ubiquitin-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=159

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY+ PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYSTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGVFMAFHKDRQYCGKCGLTYQFQPG  153



>ref|XP_008065389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tarsius syrichta]
Length=156

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA+HFDRHYCGKC LTY + K
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNK  152



>gb|AGO97083.1| ubiquitin, partial [Cymbidium faberi]
Length=140

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGK+ RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKMARLRKECPNAE  125

Query  361  CGAGTFMANHFDRHY  405
            CGAGTFMANHFDRHY
Sbjct  126  CGAGTFMANHFDRHY  140



>ref|XP_010573169.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Haliaeetus leucocephalus]
Length=156

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_005513215.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Columba livia]
Length=156

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  183
            TLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKEST
Sbjct  7    TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST  66

Query  184  LHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAEC  363
            LHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ EC
Sbjct  67   LHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEEC  126

Query  364  GAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            GAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  127  GAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_003758323.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sarcophilus 
harrisii]
Length=228

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  78   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  137

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  138  TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  197

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  198  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  227



>gb|ACO51599.1| Ubiquitin [Rana catesbeiana]
Length=156

 Score =   221 bits (564),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKPYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|EMC80037.1| 40S ribosomal protein S27a, partial [Columba livia]
Length=160

 Score =   221 bits (564),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  183
            TLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKEST
Sbjct  11   TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST  70

Query  184  LHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAEC  363
            LHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ EC
Sbjct  71   LHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEEC  130

Query  364  GAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            GAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  131  GAGVFMASHFDRHYCGKCCLTYCFNKPED  159



>gb|ACO08409.1| Ubiquitin [Oncorhynchus mykiss]
Length=156

 Score =   221 bits (563),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKV E+GK+HRLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVVENGKIHRLRRECPADE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|AEA51100.1| ubiquitin, partial [Oryzias melastigma]
Length=169

 Score =   221 bits (564),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  27   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  86

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  87   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADE  146

Query  361  CGAGTFMANHFDRHYCGKCGLTY  429
            CGAG FMA+HFDRHYCGKC LTY
Sbjct  147  CGAGVFMASHFDRHYCGKCTLTY  169



>gb|KIP07142.1| hypothetical protein PHLGIDRAFT_106094 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=159

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK K VK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKQYSTPKKIKHKRKPVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYQFQPG  153



>emb|CCO31835.1| Ubiquitin-40S ribosomal protein S27a AltName: Full=Ubiquitin 
carboxyl extension protein 80 [Rhizoctonia solani AG-1 IB]
 emb|CEL63024.1| Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A 
PE=2 SV=3 [Rhizoctonia solani AG-1 IB]
Length=159

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECPN+E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPNSE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHSDRQYCGKCGLTYTFAPG  153



>ref|XP_009549036.1| hypothetical protein HETIRDRAFT_441019 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW78722.1| hypothetical protein HETIRDRAFT_441019 [Heterobasidion irregulare 
TC 32-1]
Length=159

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKV+  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVESDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAG FMA H DR YCGKCGLTY +Q G 
Sbjct  126  CGAGVFMAFHHDRQYCGKCGLTYTFQPGA  154



>gb|KDQ26602.1| hypothetical protein PLEOSDRAFT_1113129 [Pleurotus ostreatus 
PC15]
Length=159

 Score =   221 bits (563),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHNDRQYCGKCGLTYTFQPG  153



>gb|KIM90371.1| hypothetical protein PILCRDRAFT_812107 [Piloderma croceum F 1598]
Length=159

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPTAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGVFMAFHNDRQYCGKCGLTYTFQPG  153



>ref|XP_007865027.1| ubiquitin-domain-containing protein [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ56264.1| ubiquitin-domain-containing protein [Gloeophyllum trabeum ATCC 
11539]
Length=159

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECP AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPAAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>gb|KIY49962.1| ubiquitin/40s ribosomal protein S27a fusion [Fistulina hepatica 
ATCC 64428]
Length=159

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKK+KHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKVKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFQPG  153



>ref|XP_010376465.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Rhinopithecus 
roxellana]
Length=156

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY   K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCLNKPED  155



>gb|KIY63590.1| ubiquitin-domain-containing protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=159

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>ref|XP_007304445.1| ubiquitin/40s ribosomal protein S27a fusion [Stereum hirsutum 
FP-91666 SS1]
 gb|EIM86820.1| ubiquitin/40s ribosomal protein S27a fusion [Stereum hirsutum 
FP-91666 SS1]
Length=159

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKV+  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVESDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGVFMAFHHDRQYCGKCGLTYTFQPG  153



>ref|XP_003032858.1| ubiquitin-40S ribosomal protein S31 fusion protein [Schizophyllum 
commune H4-8]
 gb|EFI97955.1| hypothetical protein SCHCODRAFT_67514 [Schizophyllum commune 
H4-8]
Length=159

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFQPG  153



>ref|XP_003504023.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cricetulus griseus]
Length=156

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC L Y +Q   D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLPYCFQNPED  155



>ref|XP_007771051.1| ubiquitin-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW79409.1| ubiquitin-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
Length=158

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>gb|KDQ61543.1| hypothetical protein JAAARDRAFT_30995 [Jaapia argillacea MUCL 
33604]
Length=159

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>ref|XP_001104764.1| PREDICTED: hypothetical protein LOC709143 [Macaca mulatta]
 ref|XP_005561572.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Macaca fascicularis]
Length=156

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SD I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDMIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|KDR80707.1| hypothetical protein GALMADRAFT_241118 [Galerina marginata CBS 
339.88]
 gb|KIM44697.1| hypothetical protein M413DRAFT_442652 [Hebeloma cylindrosporum 
h7]
Length=159

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>gb|KII87325.1| hypothetical protein PLICRDRAFT_42950 [Plicaturopsis crispa FD-325 
SS-3]
Length=159

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KK K+A+L++YKVD  GK+ RLR+ECP AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKTKMAILKYYKVDSDGKIKRLRRECPTAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGVFMAFHQDRQYCGKCGLTYQFQPG  153



>gb|KIM66010.1| hypothetical protein SCLCIDRAFT_1211653 [Scleroderma citrinum 
Foug A]
Length=159

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKK+KHK KKVK+++L++YKVD  GK+ RLR+ECP AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKVKHKRKKVKMSILKYYKVDSDGKIKRLRRECPTAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFQPG  153



>ref|XP_006083528.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis lucifugus]
Length=237

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  87   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  146

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  147  TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  206

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  207  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  236



>gb|EMD39293.1| hypothetical protein CERSUDRAFT_112941 [Ceriporiopsis subvermispora 
B]
Length=159

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKV+  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVESDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAG FMA H DR YCGKCGLTY +Q G 
Sbjct  126  CGAGIFMAFHEDRQYCGKCGLTYTFQPGA  154



>ref|NP_077239.1| ubiquitin-40S ribosomal protein S27a precursor [Mus musculus]
 ref|NP_112375.1| ubiquitin-40S ribosomal protein S27a [Rattus norvegicus]
 ref|NP_001029037.1| ubiquitin-40S ribosomal protein S27a precursor [Mus musculus]
 ref|XP_003751469.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Rattus 
norvegicus]
 ref|XP_006221941.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Rattus 
norvegicus]
 ref|XP_011236476.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a-like isoform X1 [Mus musculus]
 sp|P62983.2|RS27A_MOUSE RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Mus musculus]
 sp|P62982.2|RS27A_RAT RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Rattus norvegicus]
 emb|CAA57432.1| fusion protein: ubiquitin (bases 43_513); ribosomal protein S27a 
(bases 217_532) [Rattus norvegicus]
 gb|AAH02108.1| Ribosomal protein S27A [Mus musculus]
 dbj|BAB31357.1| unnamed protein product [Mus musculus]
 gb|AAH58139.1| Ribosomal protein S27a [Rattus norvegicus]
 gb|AAH81446.1| Ribosomal protein S27A [Mus musculus]
 gb|AAH96392.1| Ribosomal protein S27A [Mus musculus]
 gb|EDL23801.1| mCG13441 [Mus musculus]
 gb|EDL26463.1| mCG15222 [Mus musculus]
 gb|EDL98032.1| rCG23287, isoform CRA_a [Rattus norvegicus]
 gb|EDL98033.1| rCG23287, isoform CRA_a [Rattus norvegicus]
Length=156

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FM +HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMGSHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_006738708.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X3 [Leptonychotes weddellii]
Length=156

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+H DRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHLDRHYCGKCCLTYCFNKPED  155



>ref|XP_003125184.2| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sus scrofa]
Length=204

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  54   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  113

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  114  TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  173

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  174  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  203



>ref|XP_004643097.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
Length=156

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RL +ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLHRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_006068942.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
Length=156

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLT KTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTRKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|ACO08429.1| Ubiquitin [Oncorhynchus mykiss]
Length=156

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP QQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPGQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TL LVLRLRGGAKKRK+++YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  66   TLRLVLRLRGGAKKRKERSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPAEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|NP_476778.1| ribosomal protein S27A [Drosophila melanogaster]
 ref|XP_001963119.1| GF15783 [Drosophila ananassae]
 ref|XP_001969479.1| GG10127 [Drosophila erecta]
 ref|XP_001992918.1| GH13542 [Drosophila grimshawi]
 ref|XP_002014414.1| GL18966 [Drosophila persimilis]
 ref|XP_002036509.1| GM18339 [Drosophila sechellia]
 ref|XP_002052410.1| GJ21841 [Drosophila virilis]
 ref|XP_002075583.1| GK18589 [Drosophila willistoni]
 ref|XP_002089110.1| GE18939 [Drosophila yakuba]
 ref|XP_002086031.1| RpS27A [Drosophila yakuba]
 ref|XP_002078951.1| GD23696 [Drosophila simulans]
 ref|XP_002136823.1| GA24218 [Drosophila pseudoobscura pseudoobscura]
 sp|P15357.2|RS27A_DROME RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Drosophila melanogaster]
 gb|AAA28998.1| ubiquitin-hybrid protein precursor [Drosophila melanogaster]
 gb|AAF52941.1| ribosomal protein S27A [Drosophila melanogaster]
 gb|AAN71408.1| RE44350p [Drosophila melanogaster]
 gb|AAR09663.1| similar to Drosophila melanogaster RpS27A, partial [Drosophila 
yakuba]
 gb|AAR10070.1| similar to Drosophila melanogaster RpS27A, partial [Drosophila 
yakuba]
 gb|EDV32340.1| GF15783 [Drosophila ananassae]
 gb|EDV58538.1| GG10127 [Drosophila erecta]
 gb|EDV98843.1| GH13542 [Drosophila grimshawi]
 gb|EDW28410.1| GL18966 [Drosophila persimilis]
 gb|EDW52432.1| GM18339 [Drosophila sechellia]
 gb|EDW64565.1| GJ21841 [Drosophila virilis]
 gb|EDW86569.1| GK18589 [Drosophila willistoni]
 gb|EDW88822.1| GE18939 [Drosophila yakuba]
 gb|EDW99501.1| RpS27A [Drosophila yakuba]
 gb|EDX04536.1| GD23696 [Drosophila simulans]
 gb|EDY71852.1| GA24218 [Drosophila pseudoobscura pseudoobscura]
 gb|ACL87774.1| RpS27A-PA, partial [synthetic construct]
 gb|ACL92242.1| RpS27A-PA [synthetic construct]
 gb|ACU32638.1| SD13292p [Drosophila melanogaster]
Length=156

 Score =   219 bits (559),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVKLAVL++YKVDE+GK+HRLR+ECP   
Sbjct  66   TLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGEN  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA H DRHYCGKC LT+V+ K
Sbjct  126  CGAGVFMAAHEDRHYCGKCNLTFVFSK  152



>ref|XP_007400915.1| hypothetical protein PHACADRAFT_213544 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM50647.1| hypothetical protein PHACADRAFT_213544 [Phanerochaete carnosa 
HHB-10118-sp]
Length=157

 Score =   219 bits (559),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +1

Query  4    TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  183
            +LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKEST
Sbjct  5    SLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST  64

Query  184  LHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAEC  363
            LHLVLRLRGGAKKRKKK Y+ PKK+KHK KKVK+A+L++YKVD  GK+ RLR+ECP+AEC
Sbjct  65   LHLVLRLRGGAKKRKKKQYSTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAEC  124

Query  364  GAGTFMANHFDRHYCGKCGLTYVYQKG  444
            GAG FMA H DR YCGKCGLTY +Q G
Sbjct  125  GAGIFMAFHKDRQYCGKCGLTYTFQPG  151



>gb|AAA74960.1| ribosomal protein-linked ubiquitin [Oryza sativa]
Length=155

 Score =   219 bits (559),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVES  TIDNVKAKIQDKEGIPPDQQR IFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESRHTIDNVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVHRLRKECPNA  357
            TLH VLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN 
Sbjct  66   TLHHVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNH  125

Query  358  ECGAGTFMANHFDRHYCGKCGLTYVYQK  441
            +CGAGTFMANHFDRHYC KC LTYVY +
Sbjct  126  DCGAGTFMANHFDRHYCRKCRLTYVYNQ  153



>gb|KIK48311.1| hypothetical protein CY34DRAFT_705963 [Suillus luteus UH-Slu-Lm8-n1]
Length=159

 Score =   219 bits (559),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGG  447
            CGAG FMA H DR YCGKC +TY +Q G 
Sbjct  126  CGAGVFMAFHKDRQYCGKCHMTYTFQPGA  154



>ref|XP_006888789.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=156

 Score =   219 bits (559),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HF RHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFHRHYCGKCCLTYCFNKPED  155



>ref|XP_005175708.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musca domestica]
 ref|XP_011293104.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musca domestica]
Length=156

 Score =   219 bits (559),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKK+KHK KKVKLAVL++YKVDE+GK+HRLR+ECP   
Sbjct  66   TLHLVLRLRGGAKKRKKKNYSTPKKMKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGEN  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA H DRHYCGKC LT+V+ K
Sbjct  126  CGAGVFMAAHEDRHYCGKCNLTFVFTK  152



>gb|KIO29915.1| hypothetical protein M407DRAFT_242430 [Tulasnella calospora MUT 
4182]
Length=158

 Score =   219 bits (559),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYT PK++KHK KKVK+A+L++YKV+  GK+ RLR+ECPNA+
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTTPKRVKHKRKKVKMAILKYYKVESDGKIKRLRRECPNAD  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGVFMAFHKDRQYCGKCGLTYKFQPG  153



>ref|XP_004092958.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a [Nomascus leucogenys]
Length=156

 Score =   219 bits (558),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHL +RLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLXVRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>emb|CCA70746.1| probable ubiquitin/ribosomal protein S27a fusion protein [Piriformospora 
indica DSM 11827]
Length=158

 Score =   219 bits (559),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  7    LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  186
            LTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTL
Sbjct  8    LTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL  67

Query  187  HLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAECG  366
            HLVLRLRGGAKKRKKKTY  PKK+KHK KKVK+A+L++YKVD  GK+ RLRKECPNAECG
Sbjct  68   HLVLRLRGGAKKRKKKTYNTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRKECPNAECG  127

Query  367  AGTFMANHFDRHYCGKCGLTYVYQKG  444
            AG FMA H DR YCGKCGLTY +Q G
Sbjct  128  AGVFMAFHHDRQYCGKCGLTYQFQPG  153



>ref|XP_004411170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Odobenus 
rosmarus divergens]
Length=156

 Score =   219 bits (558),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGI PDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGISPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_002002882.1| GI10618 [Drosophila mojavensis]
 gb|EDW12324.1| GI10618 [Drosophila mojavensis]
Length=156

 Score =   219 bits (558),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVKLAVL++YKVDE+GK+HRLR+ECP   
Sbjct  66   TLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGDN  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA H DRHYCGKC LT+V+ K
Sbjct  126  CGAGVFMAAHEDRHYCGKCNLTFVFSK  152



>sp|P59272.2|RS27A_DAUCA RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor, partial [Daucus carota]
 gb|AAC26159.1| ubiquitin-carboxyl extension [Daucus carota]
Length=143

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/138 (96%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGG KKRKKKTYTKPKK KHKH+KVKLAVLQFYKVDESGKV RLRKECPN E
Sbjct  66   TLHLVLRLRGGGKKRKKKTYTKPKKTKHKHRKVKLAVLQFYKVDESGKVQRLRKECPNGE  125

Query  361  CGAGTFMANHFDRHYCGK  414
            CGAGTFMANHFDRHYCGK
Sbjct  126  CGAGTFMANHFDRHYCGK  143



>ref|XP_005365195.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Microtus 
ochrogaster]
Length=155

 Score =   219 bits (558),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGA K++KK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGA-KKRKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  124

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  125  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  154



>gb|AAV84206.1| unknown [Culicoides sonorensis]
Length=162

 Score =   219 bits (559),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  12   KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  71

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVKLAVL++YKVDE+GK+HRLR+ECP   
Sbjct  72   TLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPAES  131

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA H +RHYCGKC LTYV+ K
Sbjct  132  CGAGVFMAAHENRHYCGKCHLTYVFSK  158



>gb|KIK50599.1| hypothetical protein GYMLUDRAFT_51110 [Gymnopus luxurians FD-317 
M1]
Length=159

 Score =   219 bits (558),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKK+KHK KKVK+A+L++YKVD  GK+ RLR+ECP AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRRECPTAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFTPG  153



>ref|XP_002469300.1| ubiquitin/40s ribosomal protein S27a fusion [Postia placenta 
Mad-698-R]
 gb|EED85602.1| ubiquitin/40s ribosomal protein S27a fusion [Postia placenta 
Mad-698-R]
Length=159

 Score =   219 bits (558),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKV+  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVESDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFQPG  153



>gb|KIM34102.1| hypothetical protein M408DRAFT_19058 [Serendipita vermifera MAFF 
305830]
Length=163

 Score =   219 bits (558),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            ++LTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  10   RSLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  69

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKK+KHK KKVK+A+L++YKVD  GK+ RLRKECPNAE
Sbjct  70   TLHLVLRLRGGAKKRKKKTYNTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRKECPNAE  129

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  130  CGAGVFMAFHHDRQYCGKCGLTYQFAPG  157



>gb|EUC60885.1| ubiquitin/40S ribosomal protein S27a fusion protein [Rhizoctonia 
solani AG-3 Rhs1AP]
 gb|KEP52157.1| ubiquitin/40S ribosomal protein S27a fusion protein [Rhizoctonia 
solani 123E]
Length=159

 Score =   219 bits (558),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKC LTY +  G
Sbjct  126  CGAGVFMAFHPDRQYCGKCHLTYTFAPG  153



>gb|KIK23888.1| hypothetical protein PISMIDRAFT_678904 [Pisolithus microcarpus 
441]
Length=159

 Score =   219 bits (558),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFQPG  153



>ref|XP_004396839.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Odobenus 
rosmarus divergens]
Length=156

 Score =   219 bits (557),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITL VE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLAVERSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRG AKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGDAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_001831329.1| ubiquitin-40S ribosomal protein S31 fusion protein [Coprinopsis 
cinerea okayama7#130]
 gb|EAU90492.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=159

 Score =   219 bits (557),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKQYSTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFTPG  153



>ref|XP_007855532.1| ubiquitin [Moniliophthora roreri MCA 2997]
 gb|ESK85162.1| ubiquitin [Moniliophthora roreri MCA 2997]
Length=159

 Score =   219 bits (557),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFTPG  153



>ref|XP_001874554.1| ubiquitin-40S ribosomal protein S31 fusion protein [Laccaria 
bicolor S238N-H82]
 gb|EDR13995.1| predicted protein [Laccaria bicolor S238N-H82]
Length=159

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFTPG  153



>gb|EJU03816.1| ubiquitin [Dacryopinax sp. DJM-731 SS1]
Length=159

 Score =   218 bits (556),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECPNA 
Sbjct  66   TLHLVLRLRGGAKKRKKKQYSTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPNAT  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFAPG  153



>gb|KIJ65589.1| hypothetical protein HYDPIDRAFT_39518 [Hydnomerulius pinastri 
MD-312]
Length=159

 Score =   218 bits (556),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPTAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGVFMAFHKDRQYCGKCGLTYTFAPG  153



>gb|AGO97081.1| ubiquitin, partial [Cymbidium faberi]
Length=140

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL VLQFYKV +SGKV RLRKECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKMKKVKLVVLQFYKVGDSGKVARLRKECPNAE  125

Query  361  CGAGTFMANHFDRHY  405
            CGAGTFMANHFDRHY
Sbjct  126  CGAGTFMANHFDRHY  140



>ref|XP_011194777.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Bactrocera cucurbitae]
 ref|XP_011194778.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Bactrocera cucurbitae]
Length=156

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI++VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIEHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVKLAVL++YKVDE+GK+HRLR+ECP   
Sbjct  66   TLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGEN  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA H DRHYCGKC LT+V+ K  D
Sbjct  126  CGAGVFMAAHEDRHYCGKCQLTFVFSKPED  155



>gb|KIJ55337.1| hypothetical protein M422DRAFT_23939 [Sphaerobolus stellatus 
SS14]
Length=158

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDADGKIKRLRRECPTPE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGVFMAFHHDRQYCGKCGLTYTFASG  153



>ref|XP_007368145.1| ubiquitin/40s ribosomal protein S27a fusion [Dichomitus squalens 
LYAD-421 SS1]
 gb|EJF59025.1| ubiquitin/40s ribosomal protein S27a fusion [Dichomitus squalens 
LYAD-421 SS1]
 gb|AGW47789.1| polyubiquitin [Ganoderma lucidum]
 gb|AHC00633.1| polyubiquitin [Ganoderma lucidum]
 emb|CDO69758.1| hypothetical protein BN946_scf184766.g3 [Trametes cinnabarina]
Length=159

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKV+  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVESDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYQFQPG  153



>ref|XP_008038358.1| ubiquitin/40s ribosomal protein S27a fusion [Trametes versicolor 
FP-101664 SS1]
 gb|EIW58528.1| ubiquitin/40s ribosomal protein S27a fusion [Trametes versicolor 
FP-101664 SS1]
Length=159

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKV+  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKPKKVKMSILKYYKVESDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYQFQPG  153



>gb|ACQ59064.1| Ubiquitin [Anoplopoma fimbria]
Length=156

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKV  +GK+HRLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVGGNGKIHRLRRECPADE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>gb|KIK67659.1| hypothetical protein GYMLUDRAFT_215796 [Gymnopus luxurians FD-317 
M1]
Length=159

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLNDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECP AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPTAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFTPG  153



>ref|XP_004519374.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Ceratitis 
capitata]
Length=156

 Score =   218 bits (554),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI++VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIEHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVKLAVL++YKVDE+GK+HRLR+ECP   
Sbjct  66   TLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLRYYKVDENGKIHRLRRECPGEN  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA H DRHYCGKC LT+V+ K
Sbjct  126  CGAGVFMAAHEDRHYCGKCQLTFVFSK  152



>gb|EPT02993.1| hypothetical protein FOMPIDRAFT_1142989 [Fomitopsis pinicola 
FP-58527 SS1]
Length=159

 Score =   218 bits (554),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKV+  GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVESDGKIKRLRRECPSTE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +Q G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFQPG  153



>ref|XP_009235580.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Pongo 
abelii]
Length=210

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            + LTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  60   ENLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  119

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  120  TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  179

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  180  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  209



>gb|KDQ06872.1| hypothetical protein BOTBODRAFT_39300 [Botryobasidium botryosum 
FD-172 SS1]
Length=159

 Score =   218 bits (554),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSQE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFAPG  153



>ref|XP_007185405.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Balaenoptera 
acutorostrata scammoni]
Length=156

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKE 
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEF  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT P+K KHK K+VKLAVL++YK+DE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPRKNKHKRKQVKLAVLKYYKMDENGKISRLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDR YCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRQYCGKCCLTYCFNKPED  155



>ref|XP_006860476.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Chrysochloris 
asiatica]
Length=155

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEV+ SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVKPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGA K++K +Y  P+K KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLHLVLRLRGGA-KKRKTSYITPRKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  124

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  125  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  154



>ref|XP_011208987.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Bactrocera dorsalis]
Length=156

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI++VK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIEHVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVKLAVL++YKVDE+GK+HRLR+ECP   
Sbjct  66   TLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGEN  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA H DRHYCGKC LT+V+ K  D
Sbjct  126  CGAGVFMAAHEDRHYCGKCQLTFVFSKPED  155



>ref|XP_006461860.1| hypothetical protein AGABI2DRAFT_193235 [Agaricus bisporus var. 
bisporus H97]
 ref|XP_007327578.1| hypothetical protein AGABI1DRAFT_111993 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM81732.1| hypothetical protein AGABI1DRAFT_111993 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV46535.1| hypothetical protein AGABI2DRAFT_193235 [Agaricus bisporus var. 
bisporus H97]
Length=159

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYT PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+A+
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAQ  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFAPG  153



>gb|KIK08837.1| hypothetical protein K443DRAFT_671895, partial [Laccaria amethystina 
LaAM-08-1]
Length=159

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLNDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKVD  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHKDRQYCGKCGLTYTFTPG  153



>emb|CCM02543.1| predicted protein [Fibroporia radiculosa]
Length=159

 Score =   217 bits (552),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+++L++YKV+  GK+ RLR+ECP+AE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMSILKYYKVESDGKIKRLRRECPSAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKCGLTY +  G
Sbjct  126  CGAGIFMAFHQDRQYCGKCGLTYTFTPG  153



>gb|AGF25315.1| ubiquitin 2, partial [x Doritaenopsis hybrid cultivar]
Length=140

 Score =   216 bits (551),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKVKL VLQFYKVD+SGK+ RLRKECPN E
Sbjct  66   TLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLPVLQFYKVDDSGKMVRLRKECPNGE  125

Query  361  CGAGTFMANHFDRHY  405
            CGAGTFMANHFDRHY
Sbjct  126  CGAGTFMANHFDRHY  140



>ref|XP_002501200.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62458.1| predicted protein [Micromonas sp. RCC299]
Length=152

 Score =   217 bits (552),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGG KKRKKK YTKPKK+KH HKKVKLA L+ YKVD++GKV RLRKECP  E
Sbjct  66   TLHLVLRLRGGGKKRKKKVYTKPKKVKHVHKKVKLAFLKLYKVDDAGKVTRLRKECPAPE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMANHFDRHYCGKCGLTYVYQK
Sbjct  126  CGAGVFMANHFDRHYCGKCGLTYVYQK  152



>ref|XP_007261488.1| ubiquitin-domain-containing protein [Fomitiporia mediterranea 
MF3/22]
 gb|EJD07536.1| ubiquitin-domain-containing protein [Fomitiporia mediterranea 
MF3/22]
Length=160

 Score =   217 bits (552),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVESSDTID VK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVESSDTIDVVKNKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK+ RLR+ECPNAE
Sbjct  66   TLHLVLRLRGGAKKRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIQRLRRECPNAE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKG  444
            CGAG FMA H DR YCGKC LTY +Q G
Sbjct  126  CGAGVFMAFHKDRQYCGKCNLTYTFQPG  153



>gb|KFB48180.1| ubiquitin (ribosomal protein L40) [Anopheles sinensis]
Length=156

 Score =   216 bits (551),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKVKLAVL++YKVDE+GK+HRLR+EC +  
Sbjct  66   TLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECTSES  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQK  441
            CGAG FMA H DRHYCGKC LT VY K
Sbjct  126  CGAGVFMAAHEDRHYCGKCHLTLVYSK  152



>ref|XP_005345114.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Microtus 
ochrogaster]
Length=155

 Score =   216 bits (551),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TL LVLRLRGGA K++KK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ E
Sbjct  66   TLRLVLRLRGGA-KKRKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDE  124

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  125  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  154



>ref|NP_001133210.1| ribosomal protein S27-3 [Salmo salar]
 gb|ACI69454.1| Ubiquitin [Salmo salar]
Length=156

 Score =   216 bits (551),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGK ITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKES
Sbjct  6    KTLTGKAITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKK KKK+YT PKK KHK KKVKLAVL++YKVDE+GK+HRLR+ECP  E
Sbjct  66   TLHLVLRLRGGAKKGKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPAEE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



>ref|XP_004663256.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Jaculus 
jaculus]
Length=156

 Score =   216 bits (551),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  180
            KTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK+S
Sbjct  6    KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKKS  65

Query  181  TLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVHRLRKECPNAE  360
            TLHLVLRLRGGAKKRKKK+YT PKK KHK KKVKLAVL++YKVD++GK+  LR+ECP+ E
Sbjct  66   TLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDKNGKISHLRRECPSDE  125

Query  361  CGAGTFMANHFDRHYCGKCGLTYVYQKGGD  450
            CGAG FMA+HFDRHYCGKC LTY + K  D
Sbjct  126  CGAGVFMASHFDRHYCGKCCLTYCFNKPED  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220