BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028I09

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                328   3e-104   Solanum lycopersicum
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           327   8e-104   Solanum tuberosum [potatoes]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                325   7e-103   Nicotiana sylvestris
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                322   1e-101   Nicotiana tomentosiformis
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                314   8e-99    Sesamum indicum [beniseed]
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                312   5e-98    Sesamum indicum [beniseed]
ref|XP_006381615.1|  subtilase family protein                           312   7e-98    
gb|ABK96588.1|  unknown                                                 295   9e-98    Populus trichocarpa x Populus deltoides
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             308   2e-96    Prunus persica
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       302   3e-96    Cucumis sativus [cucumbers]
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                307   4e-96    Populus euphratica
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         307   5e-96    Jatropha curcas
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                307   5e-96    Prunus mume [ume]
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                303   2e-94    Eucalyptus grandis [rose gum]
ref|XP_010090170.1|  Subtilisin-like protease                           301   5e-94    Morus notabilis
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           301   7e-94    
dbj|BAD94244.1|  serine protease like protein                           288   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                300   1e-93    
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      300   3e-93    Ricinus communis
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                299   6e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                298   2e-92    Cucumis melo [Oriental melon]
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     297   3e-92    Tarenaya hassleriana [spider flower]
gb|KHN12283.1|  Subtilisin-like protease                                287   9e-92    Glycine soja [wild soybean]
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                295   2e-91    
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                294   6e-91    
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                293   6e-91    Nelumbo nucifera [Indian lotus]
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                293   1e-90    Vitis vinifera
emb|CDY18042.1|  BnaC07g04280D                                          291   2e-90    Brassica napus [oilseed rape]
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    292   3e-90    Arabis alpina [alpine rockcress]
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             291   5e-90    Eutrema salsugineum [saltwater cress]
emb|CDY33400.1|  BnaA07g04390D                                          291   6e-90    Brassica napus [oilseed rape]
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                291   7e-90    Camelina sativa [gold-of-pleasure]
ref|NP_565330.1|  Subtilase-like protein                                291   7e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                290   1e-89    Brassica rapa
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                290   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                290   3e-89    
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                289   4e-89    Camelina sativa [gold-of-pleasure]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                288   6e-89    Malus domestica [apple tree]
ref|XP_002885806.1|  predicted protein                                  288   6e-89    Arabidopsis lyrata subsp. lyrata
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                288   7e-89    Fragaria vesca subsp. vesca
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                288   7e-89    Camelina sativa [gold-of-pleasure]
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg                272   8e-89    Erythranthe guttata [common monkey flower]
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                288   1e-88    Eucalyptus grandis [rose gum]
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     289   1e-88    Eucalyptus grandis [rose gum]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                288   1e-88    Eucalyptus grandis [rose gum]
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                287   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             285   7e-88    Capsella rubella
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                285   9e-88    Erythranthe guttata [common monkey flower]
gb|KJB82990.1|  hypothetical protein B456_013G223900                    285   1e-87    Gossypium raimondii
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             285   1e-87    Phaseolus vulgaris [French bean]
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           285   2e-87    Cicer arietinum [garbanzo]
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           284   4e-87    Glycine max [soybeans]
gb|KHN06066.1|  Subtilisin-like protease                                278   1e-86    Glycine soja [wild soybean]
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                282   2e-86    Phoenix dactylifera
gb|KHG16003.1|  Subtilisin-like protease                                281   2e-86    Gossypium arboreum [tree cotton]
ref|XP_003595292.1|  Subtilisin-like protease                           281   5e-86    Medicago truncatula
gb|KJB27210.1|  hypothetical protein B456_004G284900                    280   9e-86    Gossypium raimondii
ref|XP_007012625.1|  Subtilase family protein                           280   1e-85    
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                278   7e-85    Tarenaya hassleriana [spider flower]
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    276   4e-84    
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   275   8e-84    Citrus sinensis [apfelsine]
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    275   1e-83    Citrus sinensis [apfelsine]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             275   1e-83    
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    273   3e-83    
gb|KHN07895.1|  Subtilisin-like protease                                266   6e-83    Glycine soja [wild soybean]
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                273   7e-83    Nicotiana tomentosiformis
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                272   7e-83    Nicotiana sylvestris
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                272   9e-83    
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    271   3e-82    Elaeis guineensis
gb|EPS65938.1|  hypothetical protein M569_08836                         270   5e-82    Genlisea aurea
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                268   3e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           267   6e-81    Glycine max [soybeans]
gb|KHN17728.1|  Subtilisin-like protease                                252   8e-81    Glycine soja [wild soybean]
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           266   2e-80    Solanum tuberosum [potatoes]
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                261   8e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           259   4e-78    Cicer arietinum [garbanzo]
gb|AES92191.2|  subtilisin-like serine protease                         259   9e-78    Medicago truncatula
ref|XP_003609994.1|  Subtilisin-like protease                           258   1e-77    
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                254   4e-76    Eucalyptus grandis [rose gum]
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             253   1e-75    Phaseolus vulgaris [French bean]
gb|ACL52505.1|  unknown                                                 243   7e-75    Zea mays [maize]
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           246   8e-75    
ref|NP_001064523.2|  Os10g0394200                                       236   9e-75    
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           247   2e-74    
ref|XP_002519362.1|  conserved hypothetical protein                     234   3e-74    
gb|EMS60034.1|  Subtilisin-like protease                                243   3e-74    Triticum urartu
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           247   2e-73    Setaria italica
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1     246   4e-73    Brachypodium distachyon [annual false brome]
gb|EEE50901.1|  hypothetical protein OsJ_31407                          246   4e-73    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA61658.1|  TPA: putative subtilase family protein                 241   6e-73    
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      246   8e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EAY78354.1|  hypothetical protein OsI_33442                          246   8e-73    Oryza sativa Indica Group [Indian rice]
dbj|BAJ89916.1|  predicted protein                                      245   1e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          244   2e-72    Sorghum bicolor [broomcorn]
dbj|BAK06243.1|  predicted protein                                      244   3e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT17100.1|  serine protease                                         243   4e-72    Saccharum hybrid cultivar R570
dbj|BAD36156.1|  putative serine protease                               243   8e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190          241   3e-71    Sorghum bicolor [broomcorn]
tpg|DAA50071.1|  TPA: putative subtilase family protein                 241   3e-71    
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     241   4e-71    Zea mays [maize]
gb|ACF79126.1|  unknown                                                 240   8e-71    Zea mays [maize]
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           240   1e-70    Setaria italica
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         241   3e-70    Jatropha curcas
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     239   3e-70    Zea mays [maize]
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          237   1e-69    Amborella trichopoda
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease                227   1e-65    Brachypodium distachyon [annual false brome]
emb|CAN71376.1|  hypothetical protein VITISV_001491                     217   2e-62    Vitis vinifera
gb|AHA84190.1|  subtilisin-like protease                                215   1e-61    Phaseolus vulgaris [French bean]
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    214   3e-61    Cucumis melo [Oriental melon]
gb|EPS61652.1|  hypothetical protein M569_13143                         214   3e-61    Genlisea aurea
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                     210   7e-60    Eucalyptus grandis [rose gum]
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           210   1e-59    Cucumis sativus [cucumbers]
gb|KJB70156.1|  hypothetical protein B456_011G061400                    210   1e-59    Gossypium raimondii
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                210   1e-59    Erythranthe guttata [common monkey flower]
emb|CDP20511.1|  unnamed protein product                                208   6e-59    Coffea canephora [robusta coffee]
dbj|BAJ90522.1|  predicted protein                                      199   2e-58    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           206   2e-58    Cicer arietinum [garbanzo]
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   204   4e-58    Citrus sinensis [apfelsine]
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           205   8e-58    Glycine max [soybeans]
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                204   1e-57    Sesamum indicum [beniseed]
gb|EYU31528.1|  hypothetical protein MIMGU_mgv1a0212142mg               198   2e-57    Erythranthe guttata [common monkey flower]
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    203   2e-57    Medicago truncatula
ref|XP_010109072.1|  Subtilisin-like protease                           202   6e-57    Morus notabilis
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           202   7e-57    Citrus sinensis [apfelsine]
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                202   8e-57    Phoenix dactylifera
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             201   2e-56    Citrus clementina [clementine]
gb|KHN13888.1|  Subtilisin-like protease                                200   2e-56    Glycine soja [wild soybean]
ref|XP_007051971.1|  Subtilase family protein                           200   2e-56    
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             200   3e-56    Phaseolus vulgaris [French bean]
ref|XP_004308418.2|  PREDICTED: subtilisin-like protease                200   3e-56    Fragaria vesca subsp. vesca
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                200   4e-56    Populus euphratica
gb|KHN01461.1|  Subtilisin-like protease                                192   5e-56    Glycine soja [wild soybean]
gb|KJB57037.1|  hypothetical protein B456_009G146000                    199   6e-56    Gossypium raimondii
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           199   7e-56    Glycine max [soybeans]
dbj|BAJ88858.1|  predicted protein                                      199   7e-56    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease                199   7e-56    Fragaria vesca subsp. vesca
gb|KHN04600.1|  Subtilisin-like protease                                199   7e-56    Glycine soja [wild soybean]
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    199   8e-56    
gb|KHN15704.1|  Subtilisin-like protease                                199   8e-56    Glycine soja [wild soybean]
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    199   8e-56    Glycine max [soybeans]
ref|XP_010917391.1|  PREDICTED: subtilisin-like protease                199   9e-56    
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    198   1e-55    Arabis alpina [alpine rockcress]
gb|KHN01421.1|  Subtilisin-like protease                                192   1e-55    Glycine soja [wild soybean]
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    198   2e-55    Glycine max [soybeans]
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             198   2e-55    
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                198   2e-55    Prunus mume [ume]
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease                198   2e-55    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN27220.1|  Subtilisin-like protease                                197   2e-55    Glycine soja [wild soybean]
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                197   2e-55    Cucumis melo [Oriental melon]
gb|ADE77855.1|  unknown                                                 192   2e-55    Picea sitchensis
ref|XP_009411443.1|  PREDICTED: subtilisin-like protease                197   3e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like           197   3e-55    Cucumis sativus [cucumbers]
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    197   3e-55    Elaeis guineensis
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                197   4e-55    Camelina sativa [gold-of-pleasure]
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    197   4e-55    
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    197   4e-55    
gb|ACN28035.1|  unknown                                                 191   4e-55    Zea mays [maize]
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    197   4e-55    Glycine max [soybeans]
gb|ADE76648.1|  unknown                                                 191   6e-55    Picea sitchensis
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                196   6e-55    Cucumis melo [Oriental melon]
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             196   6e-55    Phaseolus vulgaris [French bean]
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     196   7e-55    
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          196   7e-55    
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             196   7e-55    Musa acuminata [banana]
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                196   8e-55    
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     196   9e-55    Eucalyptus grandis [rose gum]
gb|KHN39620.1|  Subtilisin-like protease                                194   9e-55    Glycine soja [wild soybean]
emb|CAN81091.1|  hypothetical protein VITISV_040911                     191   9e-55    Vitis vinifera
gb|EYU29555.1|  hypothetical protein MIMGU_mgv1a022042mg                195   1e-54    Erythranthe guttata [common monkey flower]
ref|XP_002864127.1|  subtilase family protein                           195   1e-54    
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                196   1e-54    Eucalyptus grandis [rose gum]
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                195   2e-54    Nicotiana tomentosiformis
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           195   2e-54    Citrus sinensis [apfelsine]
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             195   2e-54    
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease                198   2e-54    
ref|XP_002320086.2|  subtilase family protein                           195   2e-54    Populus trichocarpa [western balsam poplar]
emb|CDX75757.1|  BnaC03g38400D                                          189   2e-54    
ref|XP_008797372.1|  PREDICTED: subtilisin-like protease                195   2e-54    
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                195   2e-54    Brachypodium distachyon [annual false brome]
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                195   3e-54    Eucalyptus grandis [rose gum]
gb|EYU28634.1|  hypothetical protein MIMGU_mgv1a024623mg                194   3e-54    Erythranthe guttata [common monkey flower]
gb|KHN13887.1|  Subtilisin-like protease                                194   3e-54    Glycine soja [wild soybean]
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           194   3e-54    Glycine max [soybeans]
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                195   3e-54    Vitis vinifera
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                194   3e-54    Populus euphratica
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     194   3e-54    Nicotiana sylvestris
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          194   3e-54    Amborella trichopoda
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     194   3e-54    Nicotiana sylvestris
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           194   3e-54    
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             194   3e-54    Capsella rubella
ref|XP_002321861.2|  subtilase family protein                           194   4e-54    Populus trichocarpa [western balsam poplar]
ref|XP_007051969.1|  Subtilase family protein isoform 1                 194   4e-54    
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                194   4e-54    Prunus mume [ume]
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             194   4e-54    Phaseolus vulgaris [French bean]
gb|ABR17987.1|  unknown                                                 194   4e-54    Picea sitchensis
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     194   4e-54    
emb|CDX97539.1|  BnaA05g25400D                                          190   4e-54    
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg             194   5e-54    Eutrema salsugineum [saltwater cress]
gb|EMT32146.1|  Subtilisin-like protease                                183   5e-54    
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     194   5e-54    
gb|EEC83669.1|  hypothetical protein OsI_29445                          194   5e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    194   5e-54    Elaeis guineensis
gb|EYU29564.1|  hypothetical protein MIMGU_mgv1a023796mg                194   5e-54    Erythranthe guttata [common monkey flower]
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                194   6e-54    Populus euphratica
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                194   6e-54    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease                194   6e-54    Fragaria vesca subsp. vesca
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                194   6e-54    Nicotiana tomentosiformis
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           194   6e-54    
ref|NP_001061952.1|  Os08g0452100                                       194   7e-54    
gb|EAY95232.1|  hypothetical protein OsI_17050                          189   7e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                194   7e-54    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    193   7e-54    
ref|XP_004973598.1|  PREDICTED: subtilisin-like protease-like           194   8e-54    Setaria italica
ref|XP_002510884.1|  Cucumisin precursor, putative                      193   8e-54    Ricinus communis
emb|CDY00497.1|  BnaA10g07760D                                          193   9e-54    
emb|CDY33251.1|  BnaC01g37240D                                          193   9e-54    Brassica napus [oilseed rape]
ref|XP_007024651.1|  Subtilase family protein                           193   9e-54    
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     194   1e-53    Eucalyptus grandis [rose gum]
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                193   1e-53    Brassica rapa
emb|CAN75239.1|  hypothetical protein VITISV_014205                     193   1e-53    Vitis vinifera
gb|EMT22975.1|  Subtilisin-like protease                                188   1e-53    
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             193   1e-53    Phaseolus vulgaris [French bean]
emb|CDX99895.1|  BnaC09g28100D                                          193   1e-53    
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                193   1e-53    Sesamum indicum [beniseed]
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            193   1e-53    Prunus persica
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     193   1e-53    Camelina sativa [gold-of-pleasure]
gb|ADW11233.1|  subtilisin-like protease 2                              193   1e-53    Phaseolus vulgaris [French bean]
ref|XP_006369129.1|  subtilase family protein                           193   1e-53    
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     193   1e-53    Camelina sativa [gold-of-pleasure]
ref|XP_010059916.1|  PREDICTED: subtilisin-like protease                192   1e-53    Eucalyptus grandis [rose gum]
gb|EYU29364.1|  hypothetical protein MIMGU_mgv1a022867mg                192   1e-53    Erythranthe guttata [common monkey flower]
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                193   2e-53    Prunus mume [ume]
ref|NP_568765.1|  subtilase 1.3                                         192   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease                192   2e-53    Pyrus x bretschneideri [bai li]
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          192   2e-53    Amborella trichopoda
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             192   2e-53    Phaseolus vulgaris [French bean]
gb|EPS74243.1|  subtilase family protein                                192   2e-53    Genlisea aurea
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease                191   2e-53    Pyrus x bretschneideri [bai li]
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                192   2e-53    Eucalyptus grandis [rose gum]
gb|KDP22364.1|  hypothetical protein JCGZ_26195                         192   3e-53    Jatropha curcas
gb|AAL32016.1|AF436834_1  AT3g14240/MLN21_2                             190   3e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010089708.1|  Subtilisin-like protease                           192   3e-53    Morus notabilis
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                192   3e-53    Nelumbo nucifera [Indian lotus]
ref|XP_002885009.1|  subtilase family protein                           192   3e-53    
gb|EMT16255.1|  Subtilisin-like protease                                192   3e-53    
gb|EYU29554.1|  hypothetical protein MIMGU_mgv1a0256351mg               187   3e-53    Erythranthe guttata [common monkey flower]
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease                187   3e-53    
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like      192   3e-53    Glycine max [soybeans]
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           191   3e-53    Citrus sinensis [apfelsine]
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           192   3e-53    Glycine max [soybeans]
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                192   3e-53    Cucumis melo [Oriental melon]
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                192   4e-53    Nelumbo nucifera [Indian lotus]
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                191   4e-53    Vitis vinifera
ref|XP_010111996.1|  Subtilisin-like protease                           192   4e-53    
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                191   4e-53    Nicotiana sylvestris
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           191   4e-53    Solanum tuberosum [potatoes]
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease                191   4e-53    
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease                191   5e-53    Fragaria vesca subsp. vesca
ref|XP_007038510.1|  Subtilase 1.3                                      191   5e-53    
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             191   5e-53    Populus trichocarpa [western balsam poplar]
gb|KCW62487.1|  hypothetical protein EUGRSUZ_H05125                     191   5e-53    Eucalyptus grandis [rose gum]
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             191   5e-53    Eutrema salsugineum [saltwater cress]
gb|KJB43875.1|  hypothetical protein B456_007G221100                    191   5e-53    Gossypium raimondii
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                191   5e-53    Brassica rapa
ref|XP_010025755.1|  PREDICTED: subtilisin-like protease                191   5e-53    
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                191   5e-53    Phoenix dactylifera
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             191   5e-53    Prunus persica
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                191   6e-53    Nicotiana sylvestris
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like           191   6e-53    Glycine max [soybeans]
ref|NP_001234288.1|  SBT2 protein precursor                             191   6e-53    Solanum lycopersicum
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             191   6e-53    Capsella rubella
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           191   6e-53    Solanum tuberosum [potatoes]
gb|KHN10783.1|  Subtilisin-like protease SDD1                           191   6e-53    Glycine soja [wild soybean]
ref|XP_009357900.1|  PREDICTED: subtilisin-like protease isoform X2     191   6e-53    Pyrus x bretschneideri [bai li]
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                191   7e-53    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY39093.1|  BnaA01g29630D                                          191   7e-53    Brassica napus [oilseed rape]
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease                191   8e-53    
gb|ACN27710.1|  unknown                                                 190   9e-53    Zea mays [maize]
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           191   9e-53    Cucumis sativus [cucumbers]
ref|XP_009357899.1|  PREDICTED: subtilisin-like protease isoform X1     191   9e-53    
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like      190   9e-53    
tpg|DAA50265.1|  TPA: putative subtilase family protein                 190   1e-52    
emb|CDP03080.1|  unnamed protein product                                189   1e-52    
gb|KCW72879.1|  hypothetical protein EUGRSUZ_E01327                     190   1e-52    
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg             190   1e-52    
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                190   1e-52    
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    190   1e-52    
gb|AFW61874.1|  putative subtilase family protein                       190   1e-52    
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    190   1e-52    
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like           190   1e-52    
ref|NP_001151549.1|  subtilisin-like protease precursor                 190   1e-52    
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                190   1e-52    
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                190   1e-52    
ref|XP_007047459.1|  Subtilase family protein                           190   1e-52    
emb|CDP05276.1|  unnamed protein product                                190   1e-52    
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             190   1e-52    
gb|EPS74284.1|  hypothetical protein M569_00464                         190   2e-52    
emb|CDY52259.1|  BnaC05g52030D                                          189   2e-52    
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease                190   2e-52    
dbj|BAH20348.1|  AT3G14067                                              188   2e-52    
ref|XP_002444456.1|  hypothetical protein SORBIDRAFT_07g022170          190   2e-52    
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                189   2e-52    
gb|AAM60964.1|  subtilisin-like serine protease                         189   2e-52    
ref|NP_566483.1|  Subtilase family protein                              189   2e-52    
emb|CAH66960.1|  OSIGBa0147H17.8                                        189   2e-52    
ref|NP_001053614.1|  Os04g0573300                                       189   2e-52    
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease           189   2e-52    
ref|XP_010105482.1|  Subtilisin-like protease                           189   2e-52    
gb|KJB49367.1|  hypothetical protein B456_008G115500                    189   3e-52    
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                189   4e-52    
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                189   4e-52    
emb|CDX82491.1|  BnaA03g33300D                                          189   4e-52    
ref|XP_010661611.1|  PREDICTED: subtilisin-like protease                189   4e-52    
gb|KJB49368.1|  hypothetical protein B456_008G115600                    188   4e-52    
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                189   4e-52    
dbj|BAJ87780.1|  predicted protein                                      188   4e-52    
gb|KHN04108.1|  Subtilisin-like protease                                188   4e-52    
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                188   4e-52    
gb|EYU28960.1|  hypothetical protein MIMGU_mgv1a018215mg                188   5e-52    
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                188   5e-52    
gb|EAY90937.1|  hypothetical protein OsI_12551                          184   6e-52    
emb|CDX98438.1|  BnaC05g39370D                                          188   6e-52    
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                188   6e-52    
emb|CDP09846.1|  unnamed protein product                                188   6e-52    
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           188   6e-52    
gb|KHN44005.1|  Subtilisin-like protease                                184   6e-52    
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                188   7e-52    
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                188   7e-52    
gb|EMT07781.1|  Subtilisin-like protease                                187   7e-52    
ref|XP_006445191.1|  hypothetical protein CICLE_v10018512mg             191   7e-52    
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like           188   7e-52    
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                188   7e-52    
ref|XP_003627424.1|  Subtilisin-like serine protease                    188   7e-52    
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             188   8e-52    
gb|KJB34438.1|  hypothetical protein B456_006G065800                    186   8e-52    
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                187   8e-52    
gb|EYU29357.1|  hypothetical protein MIMGU_mgv1a021077mg                187   9e-52    
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             187   9e-52    
ref|NP_566473.2|  Subtilase family protein                              187   1e-51    
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    187   1e-51    
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                187   1e-51    
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    187   1e-51    
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           187   1e-51    
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                187   1e-51    
ref|XP_007024750.1|  Subtilase family protein isoform 1                 187   1e-51    
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                187   1e-51    
dbj|BAK08126.1|  predicted protein                                      187   1e-51    
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease                187   1e-51    
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                187   1e-51    
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                187   1e-51    
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             190   2e-51    
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease                187   2e-51    
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           187   2e-51    
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             187   2e-51    
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                187   2e-51    
gb|EMS49460.1|  Subtilisin-like protease SDD1                           187   2e-51    
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like           187   2e-51    
gb|EMS67510.1|  Subtilisin-like protease                                185   2e-51    
emb|CDX97560.1|  BnaA05g25190D                                          187   2e-51    
emb|CBI35805.3|  unnamed protein product                                186   2e-51    
gb|KJB34439.1|  hypothetical protein B456_006G065800                    186   2e-51    
gb|EYU29561.1|  hypothetical protein MIMGU_mgv1a018614mg                186   2e-51    
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                187   2e-51    
ref|XP_010091819.1|  Subtilisin-like protease SDD1                      187   2e-51    
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                186   2e-51    
ref|XP_002534008.1|  Xylem serine proteinase 1 precursor, putative      186   2e-51    
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             186   2e-51    
gb|EYU44465.1|  hypothetical protein MIMGU_mgv1a0020562mg               182   2e-51    
gb|KDP26457.1|  hypothetical protein JCGZ_17615                         186   2e-51    
ref|XP_010931682.1|  PREDICTED: subtilisin-like protease                186   2e-51    
gb|EAY87749.1|  hypothetical protein OsI_09164                          184   2e-51    
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                186   2e-51    
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                186   2e-51    
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                186   3e-51    
gb|EYU28633.1|  hypothetical protein MIMGU_mgv1a023843mg                186   3e-51    
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease                186   3e-51    
ref|XP_008378050.1|  PREDICTED: subtilisin-like protease                186   3e-51    
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           186   3e-51    
gb|KCW66398.1|  hypothetical protein EUGRSUZ_F00212                     186   3e-51    
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             186   3e-51    
emb|CBI34800.3|  unnamed protein product                                181   3e-51    
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      186   3e-51    
gb|ACN34516.1|  unknown                                                 181   3e-51    
gb|KJB34440.1|  hypothetical protein B456_006G065800                    186   3e-51    
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                186   3e-51    
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                186   4e-51    
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease                186   4e-51    
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                186   4e-51    
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                186   4e-51    
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like           186   4e-51    
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                186   4e-51    
gb|KJB57083.1|  hypothetical protein B456_009G147400                    186   4e-51    
ref|XP_003608462.1|  Subtilisin-like protease                           186   4e-51    
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     186   4e-51    
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     186   4e-51    
gb|KJB57084.1|  hypothetical protein B456_009G147400                    186   4e-51    
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                186   4e-51    
ref|XP_010059917.1|  PREDICTED: subtilisin-like protease                186   5e-51    
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                186   5e-51    
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease                186   5e-51    
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like           186   5e-51    
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                186   5e-51    
ref|XP_007051967.1|  Subtilase family protein                           185   5e-51    
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    186   5e-51    
gb|EMT24443.1|  Subtilisin-like protease                                186   5e-51    
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           186   5e-51    
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g             188   6e-51    
ref|XP_006369092.1|  subtilase family protein                           185   6e-51    
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease                185   7e-51    
emb|CDP11276.1|  unnamed protein product                                185   8e-51    
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      185   8e-51    
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                185   9e-51    
emb|CAN82763.1|  hypothetical protein VITISV_030628                     184   9e-51    
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1           185   9e-51    
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                185   9e-51    
emb|CAN75240.1|  hypothetical protein VITISV_014207                     183   1e-50    
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     185   1e-50    
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           184   1e-50    
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             184   1e-50    
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    184   1e-50    
emb|CDP01315.1|  unnamed protein product                                184   1e-50    
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                185   1e-50    
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           184   1e-50    
emb|CDO97802.1|  unnamed protein product                                184   1e-50    
gb|ACB87529.1|  subtilisin protease                                     183   1e-50    
ref|XP_006465816.1|  PREDICTED: subtilisin-like protease-like           184   1e-50    
ref|XP_006426785.1|  hypothetical protein CICLE_v10024934mg             184   1e-50    
ref|XP_006426784.1|  hypothetical protein CICLE_v10024934mg             184   1e-50    
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                184   1e-50    
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease                184   1e-50    
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                184   2e-50    
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease                184   2e-50    
ref|XP_002304250.2|  hypothetical protein POPTR_0003s06940g             182   2e-50    
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             184   2e-50    
ref|NP_001050634.1|  Os03g0605300                                       184   2e-50    
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                184   2e-50    
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980          184   2e-50    
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg                184   2e-50    
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574             184   2e-50    
gb|KJB70050.1|  hypothetical protein B456_011G056000                    184   2e-50    
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like           184   2e-50    
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                184   2e-50    
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                184   2e-50    
gb|EYU25438.1|  hypothetical protein MIMGU_mgv1a001996mg                183   2e-50    
gb|KGN57311.1|  hypothetical protein Csa_3G178520                       184   3e-50    
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           183   3e-50    
gb|KHN31561.1|  Subtilisin-like protease                                182   3e-50    
emb|CBI38831.3|  unnamed protein product                                182   3e-50    
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                183   3e-50    
ref|XP_002886065.1|  predicted protein                                  183   3e-50    
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           183   3e-50    
gb|EMT11314.1|  hypothetical protein F775_42966                         181   3e-50    
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1           183   4e-50    
gb|ADY38794.1|  serine protease                                         183   4e-50    
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                183   4e-50    
gb|KJB49366.1|  hypothetical protein B456_008G115400                    183   4e-50    
gb|AES62637.2|  subtilisin-like serine protease                         183   4e-50    
ref|NP_001146035.1|  uncharacterized protein LOC100279566               180   4e-50    
ref|XP_010661613.1|  PREDICTED: subtilisin-like protease                183   4e-50    
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1     183   4e-50    
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           183   5e-50    
ref|XP_003592386.1|  Subtilisin-like protease                           183   5e-50    
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                182   5e-50    
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           182   5e-50    
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   182   5e-50    
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                182   5e-50    
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             182   5e-50    
ref|XP_002980084.1|  hypothetical protein SELMODRAFT_419590             182   6e-50    
ref|XP_003623810.1|  Subtilisin-like protease                           182   6e-50    
gb|AES80028.2|  subtilisin-like serine protease                         182   6e-50    
ref|XP_002987482.1|  hypothetical protein SELMODRAFT_426261             182   7e-50    
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease                182   7e-50    
ref|XP_002987481.1|  hypothetical protein SELMODRAFT_426260             182   7e-50    
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                182   7e-50    
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like           182   8e-50    
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                182   8e-50    
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                182   8e-50    
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           182   8e-50    
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                182   9e-50    
emb|CDY18651.1|  BnaA09g07440D                                          182   9e-50    
ref|XP_003566210.2|  PREDICTED: subtilisin-like protease                182   9e-50    
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg             182   9e-50    
ref|XP_007139067.1|  hypothetical protein PHAVU_009G262100g             182   9e-50    
gb|KDP25551.1|  hypothetical protein JCGZ_20707                         182   9e-50    
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             182   9e-50    
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                182   1e-49    
ref|XP_006358407.1|  PREDICTED: subtilisin-like protease-like           182   1e-49    
gb|ACN28204.1|  unknown                                                 182   1e-49    
ref|XP_010087293.1|  Subtilisin-like protease                           181   1e-49    
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease                181   1e-49    
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1           182   1e-49    
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                182   1e-49    
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                181   1e-49    
emb|CBI35855.3|  unnamed protein product                                185   1e-49    
ref|XP_009760563.1|  PREDICTED: subtilisin-like protease                181   1e-49    
gb|ABZ89187.1|  putative protein                                        181   1e-49    
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           181   1e-49    
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease                181   1e-49    
ref|XP_002982832.1|  hypothetical protein SELMODRAFT_234125             181   1e-49    
gb|KHG02130.1|  Subtilisin-like protease                                181   1e-49    



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 173/198 (87%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY  D TNSP
Sbjct  525  GLEKDTRRTKFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNRDTTNSP  584

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA GD+LS PWAHG+GHVDPHKALSPGLVYDI P +Y  FLCSLDY  + IQAIVK P
Sbjct  585  LRDAEGDQLSTPWAHGAGHVDPHKALSPGLVYDIRPKEYIKFLCSLDYEMEHIQAIVKRP  644

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TCAKK S+P Q+NYPSF+VLFGKSR+VR TR LTNVGAAG+ YEV I+APPSVTVTVK
Sbjct  645  NVTCAKKFSDPGQINYPSFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVIDAPPSVTVTVK  704

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVFK VG+RLRYTVT
Sbjct  705  PSKLVFKKVGERLRYTVT  722



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   327 bits (839),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 172/198 (87%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY  D TNSP
Sbjct  530  GLEKDTRRTKFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNRDTTNSP  589

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA GD+LS PWAHG+GHVDPHKALSPGLVYDI P +Y  FLCSLDY    IQAIVK P
Sbjct  590  LRDAEGDQLSTPWAHGAGHVDPHKALSPGLVYDIRPEEYIKFLCSLDYEMDHIQAIVKRP  649

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TCAKK S+P Q+NYPSF+VLFGKSR+VR TR LTNVGAAG+ YEV I+APPSVTVTVK
Sbjct  650  NVTCAKKFSDPGQINYPSFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVIDAPPSVTVTVK  709

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVFK VG+RLRYTVT
Sbjct  710  PSKLVFKRVGERLRYTVT  727



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   325 bits (833),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 171/198 (86%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY  D TNSP
Sbjct  527  GLEKDTRRTKFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVRDTTNSP  586

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G +LS PWAHGSGHVDPHKALSPGL+YDI P DY  FLCSLDY    IQAIVK P
Sbjct  587  LRDAEGGQLSTPWAHGSGHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQAIVKRP  646

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC KK ++P Q+NYPSFSVLFGKSR+VR TR +TNVGAAG++YEV ++APPSVTVTVK
Sbjct  647  NVTCTKKFADPGQINYPSFSVLFGKSRVVRYTRAVTNVGAAGSVYEVTVDAPPSVTVTVK  706

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVFK VG+RLRYTVT
Sbjct  707  PSKLVFKRVGERLRYTVT  724



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 171/198 (86%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY HD TNSP
Sbjct  527  GLEKDTRRTKFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVHDTTNSP  586

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G +LS P+AHGSGHVDPHKALSPGL+YDI P DY  FLCSLDY    IQAIVK P
Sbjct  587  LRDAEGGQLSTPFAHGSGHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQAIVKRP  646

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TCAKK ++P Q+NYPSFSVLFGKSR+VR TR +TNV AAG++YEV ++APPSV VTVK
Sbjct  647  NVTCAKKFADPGQINYPSFSVLFGKSRVVRYTRAVTNVAAAGSVYEVVVDAPPSVLVTVK  706

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVFK VG+RLRYTVT
Sbjct  707  PSKLVFKRVGERLRYTVT  724



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   314 bits (804),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 168/198 (85%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAYT DNTNSP
Sbjct  509  GLEKDTRKTQFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYTLDNTNSP  568

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            ++DA    +S PWAHG+GHVDP KALSPGLVYD  P DY  FLCSLDYT + IQAIVK P
Sbjct  569  LKDAADYSISTPWAHGAGHVDPQKALSPGLVYDAKPEDYIAFLCSLDYTMEMIQAIVKHP  628

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TCA K  +P QLNYPSFSV+FGKSR+VR TR LTNVGAAG++Y V++EAPP+V V+VK
Sbjct  629  NVTCAAKFRDPGQLNYPSFSVVFGKSRVVRYTRRLTNVGAAGSVYRVSVEAPPNVVVSVK  688

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ LVF+NVGDR RYTVT
Sbjct  689  PSNLVFRNVGDRQRYTVT  706



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 167/198 (84%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYT DN NSP
Sbjct  524  GLDKDTRKTQFNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTLDNANSP  583

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LS PWAHG+GHV+PHKALSPGLVYD  P DY  FLCSL YT + IQAI K P
Sbjct  584  LRDAADYSLSTPWAHGAGHVNPHKALSPGLVYDATPEDYVAFLCSLRYTVEMIQAIAKRP  643

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITCA+K  +P QLNYPSFSVLFGKSRIV+ +RELTNVGAAG++Y V++EAPP+V V+VK
Sbjct  644  NITCARKFRDPGQLNYPSFSVLFGKSRIVKYSRELTNVGAAGSVYLVSVEAPPTVAVSVK  703

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVFKNVGD+ RYTVT
Sbjct  704  PSKLVFKNVGDKQRYTVT  721



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   312 bits (799),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 168/198 (85%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    FNIMSGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAY  DNTNSP
Sbjct  533  GLETDTRKTQFNIMSGTSMSCPHISGVAALLKAAHPTWSPSAIKSALMTTAYVSDNTNSP  592

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            ++DA G  LSNPWAHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT + +QAIVK P
Sbjct  593  LQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISADEYVAFLCSLDYTIEHVQAIVKRP  652

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++K +NP  LNYPSFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +V VTVK
Sbjct  653  NITCSRKFNNPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQAVQVTVK  712

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVFKNVGD+LRYTVT
Sbjct  713  PSKLVFKNVGDKLRYTVT  730



>gb|ABK96588.1| unknown [Populus trichocarpa x Populus deltoides]
Length=218

 Score =   295 bits (755),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +1

Query  64   MSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELSNPWAHGSG  243
            MSCPHISG+AALLKAAHP WSP AIKSALMTTAY  DNTNSP++DA G  LSNPWAHGSG
Sbjct  1    MSCPHISGVAALLKAAHPTWSPSAIKSALMTTAYVSDNTNSPLQDAAGGALSNPWAHGSG  60

Query  244  HVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPS  423
            HVDP KALSPGLVYDI+  +Y  FLCSLDYT + +QAIVK PNITC++K +NP  LNYPS
Sbjct  61   HVDPQKALSPGLVYDISADEYVAFLCSLDYTIEHVQAIVKRPNITCSRKFNNPGNLNYPS  120

Query  424  FSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  603
            FSV+F  +R+VR TRELTNVGAAG++YEVA+  P +V VTVKP+KLVFKNVGD+LRYTVT
Sbjct  121  FSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTVT  180



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 165/198 (83%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GLQED+    FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT DNT SP
Sbjct  526  GLQEDTRKSQFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTQDNTKSP  585

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA     SNPWAHGSGHV+P KALSPGLVYDI+  DY  FLCSLDYT + +QAIVK P
Sbjct  586  LRDAADGSFSNPWAHGSGHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKP  645

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC++K S+P QLNYPSFSV+FG  R+VR +RELTNVGAAG++Y VA+  P  V + VK
Sbjct  646  NVTCSRKYSDPGQLNYPSFSVVFGNKRVVRYSRELTNVGAAGSIYRVAVTGPQMVRIAVK  705

Query  550  PTKLVFKNVGDRLRYTVT  603
            PT+LVFKNVG++ +YTVT
Sbjct  706  PTRLVFKNVGEKQKYTVT  723



>gb|KGN66306.1| hypothetical protein Csa_1G597040 [Cucumis sativus]
Length=566

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D     FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  331  GLENDKRKTQFNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQDNTNSS  390

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   SNPWAHG+GHVDPHKALSPGL+YDI+  DY  FLCSLDY    +QAIVK  
Sbjct  391  LRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRS  450

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++K ++P QLNYPSFSV+FG  R+VR TR +TNVGAAG++Y+VA  APP V VTVK
Sbjct  451  NITCSRKFADPGQLNYPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPPVVKVTVK  510

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVF  VG+R RYTVT
Sbjct  511  PSKLVFTKVGERKRYTVT  528



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 167/198 (84%), Gaps = 5/198 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    FNIMSGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAY  DNTNSP
Sbjct  533  GLESDTRKTQFNIMSGTSMSCPHISGVAALLKAAHPTWSPSAIKSALMTTAYFSDNTNSP  592

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            ++DA G  LSNPWAHGSGHVDP KALSPGLVYDI+  DY  FLCSLDYT + +QAIVK P
Sbjct  593  LQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISTDDYVAFLCSLDYTIEHVQAIVKRP  652

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++K  NP  LNYPSFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +V VTVK
Sbjct  653  NITCSRKF-NPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQAVQVTVK  711

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVFKN+GD+LRYTVT
Sbjct  712  PSKLVFKNIGDKLRYTVT  729



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 166/201 (83%), Gaps = 7/201 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAY  DNTNSP
Sbjct  526  GLEKDTRKTQFNIMSGTSMSCPHISGVAALLKAAHPSWSPSAIKSALMTTAYVVDNTNSP  585

Query  190  IRDAGGD---ELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV  360
            +RDAG D     SNPWAHGSGHVDPHKAL+PGLVYDI+  +Y  FLCSL YT   +QAIV
Sbjct  586  LRDAGSDVAGAFSNPWAHGSGHVDPHKALTPGLVYDISTQEYEAFLCSLGYTIDHVQAIV  645

Query  361  KAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTV  540
            K PN+TC+KK  +P +LNYPSFSV+F   R+VR TRELTNVG AG++YEVA+  P +V V
Sbjct  646  KRPNVTCSKKFRDPGELNYPSFSVVFASKRVVRYTRELTNVGEAGSIYEVAVNGPSTVGV  705

Query  541  TVKPTKLVFKNVGDRLRYTVT  603
            TVKPTKLVFKNVGD+LRYTVT
Sbjct  706  TVKPTKLVFKNVGDKLRYTVT  726



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 166/198 (84%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ED+    FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT DNT +P
Sbjct  526  GLEEDTRKSQFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTQDNTKAP  585

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSNPWAHGSGHV+P KALSPGLVYDI+  DY  FLCSLDYT + +QAIVK P
Sbjct  586  LRDAADGSLSNPWAHGSGHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKP  645

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC++K S+P QLNYPSFSV+FGK R+VR +RE TNVGAAG++Y VA+  P  V + VK
Sbjct  646  NVTCSRKYSDPGQLNYPSFSVVFGKKRVVRYSREFTNVGAAGSIYRVAVTGPQMVRIAVK  705

Query  550  PTKLVFKNVGDRLRYTVT  603
            PT+LVFKNVG++ +YTVT
Sbjct  706  PTRLVFKNVGEKQKYTVT  723



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTT+YTHDNTNS 
Sbjct  532  GLEKDTRKTQFNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTSYTHDNTNSS  591

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   S PWAHGSGHVDP KALSPGLVYDI+  DY  FLCSLDYT  Q++A+ K P
Sbjct  592  LRDAAGGTYSTPWAHGSGHVDPEKALSPGLVYDISTDDYVAFLCSLDYTIDQVRAVAKRP  651

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC++K ++P QLNYPSFSVLFG  RIVR TR+LTNVGAAG++Y V +  PP+V VTVK
Sbjct  652  NVTCSRKFADPGQLNYPSFSVLFGSKRIVRYTRQLTNVGAAGSVYAVTVMGPPAVEVTVK  711

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KLVF  VGDR  YTVT
Sbjct  712  PPKLVFAKVGDRRSYTVT  729



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   301 bits (772),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 163/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAY  DNT SP
Sbjct  526  GLEKDTRKTKFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYVTDNTKSP  585

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA GD++S PWAHG+GHVDP KALSPGLVYDI+  +Y  FLCSLDYTT  IQ IVK  
Sbjct  586  LRDAEGDQVSTPWAHGAGHVDPQKALSPGLVYDISVDEYINFLCSLDYTTDHIQTIVKHR  645

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N TC+KK S+P  LNYPSFSVLF   R+VR TR LTNVGAA ++Y VA+ APP+V VTVK
Sbjct  646  NFTCSKKFSDPGALNYPSFSVLFANKRVVRYTRRLTNVGAAASVYTVAVNAPPTVKVTVK  705

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL FK+VG+RLRYTVT
Sbjct  706  PAKLAFKSVGERLRYTVT  723



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   301 bits (771),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D     FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  528  GLENDKRKTQFNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQDNTNSS  587

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   SNPWAHG+GHVDPHKALSPGL+YDI+  DY  FLCSLDY    +QAIVK  
Sbjct  588  LRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRS  647

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++K ++P QLNYPSFSV+FG  R+VR TR +TNVGAAG++Y+VA  APP V VTVK
Sbjct  648  NITCSRKFADPGQLNYPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPPVVKVTVK  707

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVF  VG+R RYTVT
Sbjct  708  PSKLVFTKVGERKRYTVT  725



>dbj|BAD94244.1| serine protease like protein [Arabidopsis thaliana]
Length=334

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 161/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTN+P
Sbjct  99   GLDKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNAP  158

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA  + LSNP+AHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  159  LHDAADNSLSNPYAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRP  218

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK S+P QLNYPSFSVLFG  R+VR TR++TNVGAA ++Y+V +   PSV ++VK
Sbjct  219  SVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTRKVTNVGAASSVYKVTVNGAPSVGISVK  278

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL FK+VG++ RYTVT
Sbjct  279  PSKLSFKSVGEKKRYTVT  296



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 164/200 (82%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ED     FNIMSGTSMSCPHISGLAALLKAAHPEWSP A+KSALMTTAYTHDNTNSP
Sbjct  525  GLEEDKRKSQFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTHDNTNSP  584

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSNPWAHGSGHVDP KALSPGLVYD    DY  FLCSL+YT + +QAIVK P
Sbjct  585  LRDAADGTLSNPWAHGSGHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKRP  644

Query  370  NITCAKKLSNPAQLNYPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N+TCA+K S+P QLNYPSFS++FG    R+VR TRELTNVGAAG++Y  ++ +P +V   
Sbjct  645  NVTCARKYSDPGQLNYPSFSIVFGSKNKRVVRYTRELTNVGAAGSVYRASVTSPSTVRTI  704

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            VKPT+LVF NVG++ +YTVT
Sbjct  705  VKPTRLVFNNVGEKQKYTVT  724



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 166/202 (82%), Gaps = 8/202 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISG+AALLKAA P WSP AIKSALMTTAY  DNT++P
Sbjct  528  GLEKDTRKTQFNIMSGTSMSCPHISGVAALLKAARPGWSPSAIKSALMTTAYVVDNTHAP  587

Query  190  IRDAGG----DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAI  357
            +RDAG       LSNPWAHGSGHVDPHKA+SPGLVYD++  DY  FLCSL YT   +Q I
Sbjct  588  LRDAGSTTIPGTLSNPWAHGSGHVDPHKAMSPGLVYDVSTEDYVAFLCSLGYTIDHVQLI  647

Query  358  VKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVT  537
            VK PN+TCA+K S+P +LNYPSFSV+FG  R+VR TRELTNVG AG++YEV + AP +V 
Sbjct  648  VKRPNVTCARKFSDPGELNYPSFSVVFGNKRVVRYTRELTNVGEAGSIYEVEVTAPSTVG  707

Query  538  VTVKPTKLVFKNVGDRLRYTVT  603
            V+VKPTKLVF+NVGD+LRYTVT
Sbjct  708  VSVKPTKLVFRNVGDKLRYTVT  729



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY HDN  +P
Sbjct  538  GLEKDTRKTKFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNHDNMQNP  597

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSNPW HG+GHVDPHKA+SPGLVYDI+  DY  FLCSLDYT    Q I K P
Sbjct  598  LRDAADGSLSNPWVHGAGHVDPHKAISPGLVYDISVDDYIAFLCSLDYTPLHRQIIAKRP  657

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++KLS+P QLNYPSFS+ FGKSRIVR TRELTNVGAA TLY+V ++AP SV V V+
Sbjct  658  NITCSRKLSDPGQLNYPSFSIQFGKSRIVRYTRELTNVGAARTLYQVQVDAPRSVGVKVR  717

Query  550  PTKLVFKNVGDRLRYTVT  603
            P++L+F+++G++ +YTVT
Sbjct  718  PSRLLFRSIGEKKKYTVT  735



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 161/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D     FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  530  GLENDKRKTQFNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQDNTNSS  589

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   SNPWAHG+GHVDPHKALSPGL+YDI+  DY  FLCSLDY    +QAIVK  
Sbjct  590  LRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYIAFLCSLDYGIDHVQAIVKRS  649

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++K ++P QLNYPSFSV+FG  R+VR TR +TNVGAAG++Y+VA  AP  V VTVK
Sbjct  650  NITCSRKFADPGQLNYPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPSVVKVTVK  709

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KLVF  VG+R RYTVT
Sbjct  710  PSKLVFTKVGERKRYTVT  727



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 161/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D     FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY  DNTN P
Sbjct  537  GLEKDPRRTQFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNVDNTNLP  596

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA  + LSNPW HGSGHVDP KA+SPGLVYDI+  +Y  FLCSLDYT   IQAIVK P
Sbjct  597  LRDAADNSLSNPWTHGSGHVDPQKAMSPGLVYDISTEEYIRFLCSLDYTVDHIQAIVKRP  656

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C++K S+P QLNYPSFSVLFG  R+ R TRELTNVG  G++Y+VA++ P SV VTVK
Sbjct  657  SVNCSRKFSDPGQLNYPSFSVLFGDKRVARYTRELTNVGTPGSIYKVAVDGPASVAVTVK  716

Query  550  PTKLVFKNVGDRLRYTVT  603
            PT+LVF  VG++ RYTVT
Sbjct  717  PTRLVFGAVGEKKRYTVT  734



>gb|KHN12283.1| Subtilisin-like protease, partial [Glycine soja]
Length=438

 Score =   287 bits (734),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 156/198 (79%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTA  HDNT S 
Sbjct  203  GLSDDTRKTQFNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTADVHDNTKSQ  262

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   SNPWAHG+GHV+PHKALSPGLVYD  P+DY  FLCSL+YT ++IQ I K  
Sbjct  263  LRDAAGGAFSNPWAHGAGHVNPHKALSPGLVYDATPSDYIKFLCSLEYTPERIQLITKRS  322

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
             + C K+ S+P QLNYPSFSVLFG  R+VR TR LTNVG AG++Y V ++AP +VTVTVK
Sbjct  323  GVNCTKRFSDPGQLNYPSFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVDAPSTVTVTVK  382

Query  550  PTKLVFKNVGDRLRYTVT  603
            P  LVF  VG+R RYT T
Sbjct  383  PVALVFGKVGERQRYTAT  400



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 163/200 (82%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ED     FNI+SGTSMSCPHISGLAALLKAAHPEWSP A+KSALMTTAYTHDNT +P
Sbjct  525  GLEEDKRKSQFNIISGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTHDNTKAP  584

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    +SNPWAHGSGHVDP KALSPGLVYDIA  DY  FLCSL+YT + +QAIVK P
Sbjct  585  LRDAADGTISNPWAHGSGHVDPSKALSPGLVYDIATEDYIAFLCSLEYTNEHVQAIVKRP  644

Query  370  NITCAKKLSNPAQLNYPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N+TCA+K S+P QLNYPSFSV+F   K R+V  TRELTNVG AG++Y VA+ +P  V   
Sbjct  645  NVTCARKYSDPGQLNYPSFSVMFWNKKKRVVSYTRELTNVGPAGSVYRVAVTSPSMVRTI  704

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            VKPT+LVF NVG++ +YTVT
Sbjct  705  VKPTRLVFNNVGEKQKYTVT  724



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 160/200 (80%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GLQ+D     FNIMSGTSMSCPHISGLAALLKAAHPEWSP A+KSALMTTAYTHDNT SP
Sbjct  525  GLQDDKRKSQFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTHDNTKSP  584

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSNPW HGSGHVDP KALSPGLVYD    DY  FLCSL+YT + +QAIVK P
Sbjct  585  LRDAADGTLSNPWGHGSGHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKRP  644

Query  370  NITCAKKLSNPAQLNYPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N+TC +K S+P QLNYPSFS+ FG    R+VR TRELTNVGAAG++Y  ++ +P +V   
Sbjct  645  NVTCERKYSDPGQLNYPSFSIAFGSKNKRVVRYTRELTNVGAAGSVYRASVTSPSTVRTV  704

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            VKPT+LVF NVG++ +YTVT
Sbjct  705  VKPTRLVFNNVGEKQKYTVT  724



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 163/199 (82%), Gaps = 5/199 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    FNIMSGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT DNT SP
Sbjct  524  GLKNDTRKAQFNIMSGTSMSCPHISGVAALLKAAHPKWSPSAIKSALMTTAYTSDNTKSP  583

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G ++S PWAHGSGHVDPHKAL+PGLVYD  P DY  FLCSLDY+  Q++AI K  
Sbjct  584  LRDAAGGDISTPWAHGSGHVDPHKALNPGLVYDATPDDYITFLCSLDYSIDQVKAITKRQ  643

Query  370  NITCAKKLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTV  546
            NITC+++ ++P +LNYPSFSVLFG K R+VR TRELTNVG  G++Y VAI  P SV VTV
Sbjct  644  NITCSRRFADPGELNYPSFSVLFGTKKRVVRYTRELTNVGPTGSVYNVAIGGPSSVGVTV  703

Query  547  KPTKLVFKNVGDRLRYTVT  603
            KPTKLVFK VG+  +YTVT
Sbjct  704  KPTKLVFKEVGEMKKYTVT  722



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++D+    FNIMSGTSMSCPHISG+AAL+KAAHPEWSP A+KSALMTTAYT DNT SP
Sbjct  523  GLEKDTRKTQFNIMSGTSMSCPHISGVAALIKAAHPEWSPSAVKSALMTTAYTRDNTKSP  582

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LS P AHGSGHVDP KALSPGLVYDI+  DY  FLCSLDYT + ++AIVK  
Sbjct  583  LRDAADGGLSTPLAHGSGHVDPQKALSPGLVYDISTQDYVAFLCSLDYTIEHVRAIVKRQ  642

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++K S+P +LNYPSFSVLFG    VR TRELTNVGAA ++Y+VA+  PPSV V V+
Sbjct  643  NITCSRKFSDPGELNYPSFSVLFGSKGFVRYTRELTNVGAADSVYQVAVTGPPSVGVVVR  702

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ LVFKNVG++ RYTVT
Sbjct  703  PSTLVFKNVGEKKRYTVT  720



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  502  GLDKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYNLDNTNSP  561

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  562  LRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRP  621

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+ K SNP QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VK
Sbjct  622  SVNCSNKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANSVYKVVVNGAPSVGISVK  681

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL F++VG++ RYTVT
Sbjct  682  PSKLAFRSVGEKKRYTVT  699



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  519  GLEKDSRRTHFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYILDNTNSP  578

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA  + LSNPWAHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  579  LRDAADNSLSNPWAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRP  638

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK ++P QLNYPSFSV+FG  R+VR TRE+TNVGAA ++Y+V +    SV ++VK
Sbjct  639  SVNCSKKFADPGQLNYPSFSVVFGGKRVVRYTREVTNVGAASSVYKVTVNGAASVGISVK  698

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL F+ VG++ RYTVT
Sbjct  699  PAKLAFRRVGEKKRYTVT  716



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   291 bits (745),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAYT DNTNSP
Sbjct  527  GLEKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYTLDNTNSP  586

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA  + LSNP  HGSGHVDP KAL+PGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  587  LRDAADNSLSNPHVHGSGHVDPLKALTPGLVYDISTEEYIKFLCSLDYTVDHIVAIVKRP  646

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C KK SNP QLNYPSFSVLFG  R+VR TRE+TNVGAA  +Y+V +   PSV ++VK
Sbjct  647  SVNCLKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANAVYKVVVSGAPSVGISVK  706

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL F+ VG++ RYTVT
Sbjct  707  PSKLAFRKVGEKKRYTVT  724



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  516  GLDKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYNLDNTNSP  575

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  576  LRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRP  635

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK SNP QLNYPSFSVLFG  R+VR TRE+TNVGA  ++Y+V +   PSV ++VK
Sbjct  636  SVNCSKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVNGAPSVGISVK  695

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL F++VG++ RYTVT
Sbjct  696  PSKLSFRSVGEKKRYTVT  713



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   291 bits (744),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  519  GLEKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSP  578

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK P
Sbjct  579  LHDAADNRLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRP  638

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VK
Sbjct  639  SVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAPSVGISVK  698

Query  550  PTKLVFKNVGDRLRYTVT  603
            PTKL FK VG++ RYTVT
Sbjct  699  PTKLAFKRVGEKKRYTVT  716



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   291 bits (744),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 161/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTN+P
Sbjct  519  GLDKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNAP  578

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA  + LSNP+AHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  579  LHDAADNSLSNPYAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRP  638

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VK
Sbjct  639  SVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVTVNGAPSVGISVK  698

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL FK+VG++ RYTVT
Sbjct  699  PSKLSFKSVGEKKRYTVT  716



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  528  GLDKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYNLDNTNSP  587

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  588  LRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRP  647

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK SNP QLNYPSFSVLFG  R+VR TRE+TNVGA  ++Y+V +   PSV ++VK
Sbjct  648  SVNCSKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVNGAPSVGISVK  707

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL F++VG++ RYTVT
Sbjct  708  PSKLSFRSVGEKKRYTVT  725



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL  D+    FNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYTHDN NSP
Sbjct  530  GLDTDTRKTQFNIISGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTHDNANSP  589

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LS PWAHG+GHVDPHKALSPGLVYD  P DY  FLCSL YT + +Q + K P
Sbjct  590  LRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPEDYVSFLCSLGYTKEMVQIVAKHP  649

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC+K+  +P QLNYPSFSV+F K+ +VR +RELTNVG AG  Y V+++APP+V V+V 
Sbjct  650  NITCSKRFHDPGQLNYPSFSVMFRKTGVVRYSRELTNVGPAGLTYRVSVDAPPNVEVSVS  709

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ LVFKNVGD+ R+ VT
Sbjct  710  PSTLVFKNVGDKRRFRVT  727



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    FNI+SGTSMSCPHISG+AALLK+AHP WSP AIKSALMTTAY  DNT SP
Sbjct  540  GLESDTRKTLFNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYNLDNTGSP  599

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   S PWAHGSGHVDP KALSPGLVYD+   DY  FLCSLDYT   ++AIVK P
Sbjct  600  LRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHVKAIVKRP  659

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVK
Sbjct  660  NVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVK  719

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL+F  VGD++RYTVT
Sbjct  720  PMKLIFPKVGDKMRYTVT  737



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  521  GLEKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSP  580

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK P
Sbjct  581  LHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRP  640

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VK
Sbjct  641  SVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAPSVGISVK  700

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL FK+VG++ RYTVT
Sbjct  701  PLKLAFKSVGEKKRYTVT  718



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 161/200 (81%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ED     FNI+SGTSMSCPHI GLAALLKAAHPEWSP A+KSALMTTAYTHDNT +P
Sbjct  525  GLEEDKRKSQFNIISGTSMSCPHIIGLAALLKAAHPEWSPSAVKSALMTTAYTHDNTKAP  584

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    +SNPWAHGSGH+DP KALSPGLVYDIA  DY  FLCSL+YT + +QAIVK P
Sbjct  585  LRDAADGTISNPWAHGSGHIDPSKALSPGLVYDIATEDYIAFLCSLEYTKEHVQAIVKRP  644

Query  370  NITCAKKLSNPAQLNYPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N+TCA+K S+P QLNYPSFSV+F   K R+V  TRELTNVG AG++Y VA+ +P  V   
Sbjct  645  NVTCARKYSDPGQLNYPSFSVVFWNKKKRVVSYTRELTNVGPAGSVYRVAVTSPSMVRTI  704

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            VKPT+LVF NVG++ +Y VT
Sbjct  705  VKPTRLVFNNVGEKQKYRVT  724



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTN+P
Sbjct  517  GLEKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNAP  576

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   I AIVK P
Sbjct  577  LHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRP  636

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGA  ++Y+V +   PSV ++VK
Sbjct  637  SVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAENSVYKVTVNGAPSVAISVK  696

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL F++VG++ RYTVT
Sbjct  697  PSKLAFRSVGEKKRYTVT  714



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ED+    FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYTHDNT +P
Sbjct  531  GLEEDTRKSQFNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTHDNTKAP  590

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA G + SNPWAHGSGHVDP +A+SPGLVYDI+  +Y  FLCSL YT QQ+Q+I K+ 
Sbjct  591  LSDAAGGQFSNPWAHGSGHVDPSRAVSPGLVYDISSVEYVAFLCSLGYTIQQVQSIAKS-  649

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TCA+K S+P QLNYPSFSV+FG  R+VR TRELTNVG A +LY+V +  PP V   VK
Sbjct  650  NVTCARKYSDPGQLNYPSFSVVFGNKRVVRYTRELTNVGTARSLYKVIVSGPPGVRTIVK  709

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ L F  VG++ +YTVT
Sbjct  710  PSSLFFATVGEKKKYTVT  727



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   288 bits (737),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  520  GLEKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSP  579

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK P
Sbjct  580  LHDAADNSLSNPHAHGSGHVDPLKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRP  639

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV V+VK
Sbjct  640  SVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAPSVGVSVK  699

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL FK+VG++ RYTVT
Sbjct  700  PLKLAFKSVGEKKRYTVT  717



>gb|EYU25845.1| hypothetical protein MIMGU_mgv1a013289mg [Erythranthe guttata]
Length=225

 Score =   272 bits (696),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 147/186 (79%), Gaps = 6/186 (3%)
 Frame = +1

Query  64   MSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELSNPWAHGSG  243
            MSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT DN NSP+RDA    LS PWAHG+G
Sbjct  1    MSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTVDNANSPLRDAADYSLSTPWAHGAG  60

Query  244  HVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQLNY  417
            HVDPHKALSPGLVYD  P DY  FLCSLDYT   +Q I + PN TC  +++  +P QLNY
Sbjct  61   HVDPHKALSPGLVYDATPDDYVSFLCSLDYTDDAVQLIARRPNATCSSSRRFRDPGQLNY  120

Query  418  PSFSVLFG----KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  585
            PSFSV+FG     SR+VR TRELTNVG AG+ Y   IEAPP+V  TVKP+KLVF NVGD+
Sbjct  121  PSFSVVFGGGKKNSRVVRYTRELTNVGPAGSAYVAEIEAPPTVVATVKPSKLVFGNVGDK  180

Query  586  LRYTVT  603
            LRYTVT
Sbjct  181  LRYTVT  186



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    FNI+SGTSMSCPHISG+AALLK+AHP WSP AIKSALMTTAY  DNT SP
Sbjct  541  GLESDTRKTLFNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYDLDNTRSP  600

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G  +S PWAHGSGHVDP KALSPGLVYD+   DY  FLCSLDYT   ++ IVK P
Sbjct  601  LRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKRP  660

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVK
Sbjct  661  NVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVK  720

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL+F  VGD++RYTVT
Sbjct  721  PMKLIFPKVGDKMRYTVT  738



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    FNI+SGTSMSCPHISG+AALLK+AHP WSP AIKSALMTTAY  DNT SP
Sbjct  540  GLESDTRKTLFNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYNLDNTGSP  599

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   S PWAHGSGHVDP KALSPGLVYD+   DY  FLCSLDYT   ++AIVK P
Sbjct  600  LRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHVKAIVKRP  659

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVK
Sbjct  660  NVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVK  719

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL+F  VGD++RYTVT
Sbjct  720  PMKLIFPKVGDKMRYTVT  737



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    FNI+SGTSMSCPHISG+AALLK+AHP WSP AIKSALMTTAY  DNT SP
Sbjct  544  GLESDTRKTLFNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYDLDNTRSP  603

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G  +S PWAHGSGHVDP KALSPGLVYD+   DY  FLCSLDYT   ++ IVK P
Sbjct  604  LRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKRP  663

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P +V VTVK
Sbjct  664  NVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPSTVGVTVK  723

Query  550  PTKLVFKNVGDRLRYTVT  603
            P KL+F  VGD++RYTVT
Sbjct  724  PMKLIFPKVGDKMRYTVT  741



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAYT DNT SP
Sbjct  534  GLVKDTRKTGFNIMSGTSMSCPHISGVAALLKAAHPNWSPSAIKSALMTTAYTRDNTKSP  593

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G  +SNPWAHGSGHVDP KALSPGLVYD  P DY  FLCSLDY+  QIQ I K P
Sbjct  594  LRDAAGGAISNPWAHGSGHVDPQKALSPGLVYDATPEDYIAFLCSLDYSIAQIQMITKRP  653

Query  370  NITCAKKLSNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTV  546
            NITC+++ ++P  LNYPSFSVLF  ++R+VR TRELTNVG AG++Y+V++  P SV +TV
Sbjct  654  NITCSRRFADPGHLNYPSFSVLFSAETRMVRYTRELTNVGPAGSVYDVSVSGPASVGITV  713

Query  547  KPTKLVFKNVGDRLRYTV  600
            KP +LVF+ VG++ +Y+V
Sbjct  714  KPRRLVFREVGEKQKYSV  731



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL++DS    FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY  DNTNSP
Sbjct  522  GLEKDSRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSP  581

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA  + LSNP AHGSGHVDP KALSPGLVYDI+  +Y  FLCSL+YT   I AIVK  
Sbjct  582  LHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRS  641

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   P+V ++VK
Sbjct  642  SVNCTKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANSVYKVMVNGAPTVEISVK  701

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+KL FK VG++ RYTVT
Sbjct  702  PSKLTFKRVGEKKRYTVT  719



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 159/204 (78%), Gaps = 10/204 (5%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT DN NSP
Sbjct  528  GLDKDARKTQFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTVDNANSP  587

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LS PWAHG+GHVDPHKALSPGLVYD  P DY  FLCSLDYT   +Q I + P
Sbjct  588  LRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPDDYVSFLCSLDYTDDAVQLIARRP  647

Query  370  NITC--AKKLSNPAQLNYPSFSVLFG----KSRIVRQTRELTNVGAAGTLYEVAIEAPPS  531
            N TC  +++  +P QLNYPSFSV+FG     SR+VR TRELTNVG AG+ Y   +E PP+
Sbjct  648  NATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSAYVAELEVPPT  707

Query  532  VTVTVKPTKLVFKNVGDRLRYTVT  603
            V  TVKP+KLVF NVG++LRYTVT
Sbjct  708  VGATVKPSKLVFGNVGEKLRYTVT  731



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNIMSGTSMSCPHISGLAAL+KAAHPEWSP AIKSALMTTAYT DNTNS 
Sbjct  525  GLAKDSRKTMFNIMSGTSMSCPHISGLAALIKAAHPEWSPSAIKSALMTTAYTQDNTNST  584

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSNPWAHG+GHVDP KALSPGLVYDI+  +Y  FLCSL YT   ++ IVK P
Sbjct  585  LRDAADGSLSNPWAHGAGHVDPQKALSPGLVYDISTEEYITFLCSLGYTVDHVKTIVKRP  644

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC+ K  +P +LNYPSFSVLFG  R+VR TRELTNVG A ++Y+V +  P +V ++V+
Sbjct  645  NITCSTKFKDPGELNYPSFSVLFGGKRVVRYTRELTNVGPARSIYKVTVNGPSTVGISVR  704

Query  550  PTKLVFKNVGDRLRYTVT  603
            P  L+F++VG++ RYTVT
Sbjct  705  PKTLIFRSVGEKKRYTVT  722



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNI+SGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY HDNT SP
Sbjct  526  GLPDDTRKTQFNIVSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVHDNTKSP  585

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   S PWAHG+GHV+PH+ALSPGLVYD + TDY  FLCSLDYT + IQ IVK  
Sbjct  586  LRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYDASITDYIKFLCSLDYTPEHIQLIVKRH  645

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
             + C +K S+P QLNYPSFS+ FG  R+VR TR LTNVG AG++Y+V ++AP +V VTV+
Sbjct  646  AVNCTRKFSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVGEAGSVYDVTVDAPSTVEVTVR  705

Query  550  PTKLVFKNVGDRLRYTVT  603
            P +LVF  +G+R RYTVT
Sbjct  706  PARLVFGKLGERKRYTVT  723



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYTHDN+ SP+RDA G
Sbjct  544  RKTQFNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTHDNSKSPLRDAAG  603

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
               S PWAHG+GHV+P KA SPGLVYD +  DY  FLCSL+Y  +QIQ IVK P++ C  
Sbjct  604  KSFSTPWAHGAGHVNPQKAFSPGLVYDASTKDYITFLCSLNYNPEQIQLIVKRPDVNCTN  663

Query  388  KLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            K +NP QLNYPSFS++F   R+VR TR LTNVG AG++Y V ++ P  V +TVKP++LVF
Sbjct  664  KFANPGQLNYPSFSIMFSSKRVVRYTRILTNVGEAGSVYNVVVDGPSWVDITVKPSRLVF  723

Query  568  KNVGDRLRYTVT  603
            + VGDR RYTVT
Sbjct  724  EKVGDRKRYTVT  735



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISGLAALLKAAHP+WS  AIKSALMTTA  HDNT S 
Sbjct  535  GLSDDTRKTQFNIMSGTSMSCPHISGLAALLKAAHPQWSSSAIKSALMTTADVHDNTKSQ  594

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   SNPWAHG+GHV+PHKALSPGLVYD  P+DY  FLCSL+YT ++IQ I K  
Sbjct  595  LRDAAGGAFSNPWAHGAGHVNPHKALSPGLVYDATPSDYIKFLCSLEYTPERIQLITKRS  654

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
             + C K+ S+P QLNYPSFSVLFG  R+VR TR LTNVG AG++Y V ++AP +VTVTVK
Sbjct  655  GVNCTKRFSDPGQLNYPSFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVDAPSTVTVTVK  714

Query  550  PTKLVFKNVGDRLRYTVT  603
            P  LVF  VG+R RYT T
Sbjct  715  PAALVFGKVGERQRYTAT  732



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAY HDNT  P
Sbjct  363  GLSDDTRKTQFNIMSGTSMSCPHISGLAALLKAAHPGWSPSAIKSALMTTAYVHDNTKFP  422

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   SNPWAHG+ H++PHKALSPGLVYD    DY  FLCSL+YT + IQ I K  
Sbjct  423  LRDAAGGAFSNPWAHGACHMNPHKALSPGLVYDAIAWDYVKFLCSLEYTPEHIQLITKRH  482

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
             + C KK S+P QLNYPSFS+LFG  R+VR TR L NVG  G++Y V ++AP ++T+ VK
Sbjct  483  GVNCTKKFSDPGQLNYPSFSILFGGKRVVRYTRVLINVGETGSIYNVTVDAPSTMTIKVK  542

Query  550  PTKLVFKNVGDRLRYTVT  603
            PT+LVF+ VG+R RYTVT
Sbjct  543  PTRLVFEKVGERQRYTVT  560



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 163/200 (82%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNIMSGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT DNT S 
Sbjct  531  GLVKDERRPEFNIMSGTSMSCPHISGVAALLKAAHPDWSPSAIKSALMTTAYTVDNTGSL  590

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   +NPW +GSG+VDP KALSPGLVYDIA  DYT FLCSLDY+T  I AI ++P
Sbjct  591  LRDAAGGSNANPWIYGSGYVDPQKALSPGLVYDIAAEDYTAFLCSLDYSTNHILAISQSP  650

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N TC+++LS+P  LNYPSFSV+FG+   RIVR +RELTNVG +G++Y +    PPSV+VT
Sbjct  651  NTTCSRRLSDPGNLNYPSFSVIFGRKSRRIVRYSRELTNVGLSGSVYNLTYSGPPSVSVT  710

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            V+PTKLVFK VG++L+YTVT
Sbjct  711  VRPTKLVFKQVGEKLKYTVT  730



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 157/198 (79%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNIMSGTSMSCPHISGLAAL+KAAHPEWSP AIKSALMTTAYT DNTNS 
Sbjct  525  GLAKDSRKTMFNIMSGTSMSCPHISGLAALIKAAHPEWSPSAIKSALMTTAYTQDNTNST  584

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSN WAHG+GHVDP KALSPGL+YDI+  +Y  FLCSL YT   ++ IVK P
Sbjct  585  LRDAADGSLSNRWAHGAGHVDPQKALSPGLIYDISTDEYITFLCSLGYTVDHVKTIVKRP  644

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC+KK  +P +LNYPSFSV+FG  R+VR TRELTNVG A ++Y+V +  P +V ++V+
Sbjct  645  NVTCSKKFKDPGELNYPSFSVMFGGKRVVRYTRELTNVGPARSMYKVTVNGPSTVGISVR  704

Query  550  PTKLVFKNVGDRLRYTVT  603
            P  L+F+ VG++ RYTVT
Sbjct  705  PKTLIFRTVGEKKRYTVT  722



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 156/198 (79%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL ED+    FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAY HDN+ SP
Sbjct  541  GLAEDTRKTKFNIMSGTSMSCPHISGLAALLKAAHPTWSPSAIKSALMTTAYNHDNSKSP  600

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA     S P AHG+GHV+P KALSPGLVYD +  DY  FLCSL+Y ++QIQ IVK P
Sbjct  601  LRDAADGSFSTPLAHGAGHVNPQKALSPGLVYDASTKDYITFLCSLNYNSEQIQLIVKRP  660

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++ C KK +NP QLNYPSFSV+F   R+VR TR +TNVG AG++Y V ++ P SV +TVK
Sbjct  661  SVNCTKKFANPGQLNYPSFSVVFSSKRVVRYTRIVTNVGEAGSVYNVVVDVPSSVGITVK  720

Query  550  PTKLVFKNVGDRLRYTVT  603
            P++LVF+ VG+R RYTVT
Sbjct  721  PSRLVFEKVGERKRYTVT  738



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score =   280 bits (716),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNI+SGTSMSCPHISGLAA LKAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  526  GLVKDTRKTKFNIVSGTSMSCPHISGLAAWLKAAHPDWSPSAIKSALMTTAYTRDNTNSS  585

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSNPW HG+GHVDP KALSPGL+YDI    Y  FLCSL YT  Q++ IVK P
Sbjct  586  LRDAADGSLSNPWVHGAGHVDPQKALSPGLIYDITTKQYISFLCSLGYTIDQVKTIVKRP  645

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC+K+  +P +LNYPSFSVLFG  R+VR TRELTNVG A ++Y+VA++ P SV ++V+
Sbjct  646  NITCSKRFKDPGELNYPSFSVLFGDKRVVRYTRELTNVGPARSIYKVAVDGPSSVGISVR  705

Query  550  PTKLVFKNVGDRLRYTVT  603
            P  LVF+++G++ RYTV+
Sbjct  706  PRTLVFRHIGEKKRYTVS  723



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 157/198 (79%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISGLAALLKAAHPEWS  AIKSALMTTAYT DNTNS 
Sbjct  524  GLAKDTRKTKFNIMSGTSMSCPHISGLAALLKAAHPEWSTSAIKSALMTTAYTEDNTNSS  583

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSNPWAHG+GHVDP KALSPGLVYDI+  +Y  FLCSL YT   ++ IVK P
Sbjct  584  LRDAADGSLSNPWAHGAGHVDPQKALSPGLVYDISTEEYISFLCSLGYTIDHVKTIVKRP  643

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            N+TC+ K  +P +LNYPSFSVLFG  R+VR TRELTNVG + ++Y+V +  P +V ++V+
Sbjct  644  NVTCSTKFKDPGELNYPSFSVLFGDKRVVRYTRELTNVGPSRSIYKVTVNGPSTVGISVR  703

Query  550  PTKLVFKNVGDRLRYTVT  603
            PT L+F++ G++ RYTVT
Sbjct  704  PTTLIFRSAGEKKRYTVT  721



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNIMSGTSMSCPHISGLAA LKAAHPEWSP AIKSALMTTAY  DNTNSP+RDA  
Sbjct  537  RRTQFNIMSGTSMSCPHISGLAAFLKAAHPEWSPSAIKSALMTTAYNLDNTNSPLRDAAD  596

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
            + LSNPWAHGSGHVDP KALSPGLVYDI+  +Y  FLCSLDYT   IQAI+K PN+ C++
Sbjct  597  NSLSNPWAHGSGHVDPKKALSPGLVYDISTEEYIRFLCSLDYTLNHIQAIIKRPNVNCSR  656

Query  388  KLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            K S+P QLNYPSFSVLF   R+VR TRELTNVGA G++Y+V ++   SV+VTV+P +LVF
Sbjct  657  KFSDPGQLNYPSFSVLFRDKRVVRYTRELTNVGAPGSVYKVTVDVSVSVSVTVRPKRLVF  716

Query  568  KNVGDRLRYTVT  603
            +  G++ RYTVT
Sbjct  717  RTAGEKKRYTVT  728



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 159/199 (80%), Gaps = 6/199 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D    +FNIMSGTSMSCPHISG+AALLKAAHP+WSP AIKSAL TTAY  DNTNSP
Sbjct  537  GLTKDDRRTAFNIMSGTSMSCPHISGVAALLKAAHPDWSPAAIKSALTTTAYNIDNTNSP  596

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RD+ G  L+ P+A G+GHVDP KALSPGLVYDI   DY  FLCSLDYT Q IQ IVK P
Sbjct  597  LRDSAGGSLATPFAFGAGHVDPRKALSPGLVYDITTDDYIAFLCSLDYTIQHIQVIVKRP  656

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N+TC+++ SNP  LNYPSFSV+F K   ++V+  RELTNVG+AG++Y V I  P +++VT
Sbjct  657  NVTCSRRFSNPGDLNYPSFSVIFEKKSRKVVKYRRELTNVGSAGSVYSVKITGPENISVT  716

Query  544  VKPTKLVFKNVGDRLRYTV  600
            VKP KL+FK+VG +L+Y+V
Sbjct  717  VKPAKLIFKHVGQKLKYSV  735



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   275 bits (703),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +1

Query  25   LQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPI  192
            L++D+    FNIMSGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY  DNT SP+
Sbjct  529  LEKDTRRTKFNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNTKSPL  588

Query  193  RDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  372
             DA    LS PWAHGSGHV+P KA+SPGLVYD +  DY  FLCSL YT + +QAIVK PN
Sbjct  589  HDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKRPN  648

Query  373  ITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            ITC +K + P +LNYPSFSVLFG  R+VR TRELTNVG A +LY V  + P +V ++V+P
Sbjct  649  ITCTRKFNTPGELNYPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTADGPSTVGISVRP  708

Query  553  TKLVFKNVGDRLRYTVT  603
             +L+F+ VG++ RYTVT
Sbjct  709  KRLLFRTVGEKKRYTVT  725



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 156/197 (79%), Gaps = 4/197 (2%)
 Frame = +1

Query  25   LQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPI  192
            L++D+    FNIMSGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY  DNT SP+
Sbjct  529  LEKDTRRTKFNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNTKSPL  588

Query  193  RDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  372
             DA    LS PWAHGSGHV+P KA+SPGLVYD +  DY  FLCSL YT + ++AIVK PN
Sbjct  589  HDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYIAFLCSLGYTIEHVKAIVKRPN  648

Query  373  ITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            ITC +K + P +LNYPSFSVLFG  R+VR TRELTNVG A +LY V ++ P +V ++V+P
Sbjct  649  ITCTRKFNTPGELNYPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTVDGPSTVGISVRP  708

Query  553  TKLVFKNVGDRLRYTVT  603
             +L+F+ VG++ RYTVT
Sbjct  709  KRLLFRTVGEKKRYTVT  725



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +1

Query  25   LQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPI  192
            L++D+    FNIMSGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY  DNT SP+
Sbjct  548  LEKDTRRTKFNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNTKSPL  607

Query  193  RDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  372
             DA    LS PWAHGSGHV+P KA+SPGLVYD +  DY  FLCSL YT + +QAIVK PN
Sbjct  608  HDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKRPN  667

Query  373  ITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            ITC +K + P +LNYPSFSVLFG  R+VR TRELTNVG A +LY V  + P +V ++V+P
Sbjct  668  ITCTRKFNTPGELNYPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTADGPSTVGISVRP  727

Query  553  TKLVFKNVGDRLRYTVT  603
             +L+F+ VG++ RYTVT
Sbjct  728  KRLLFRTVGEKKRYTVT  744



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 158/199 (79%), Gaps = 6/199 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNIMSGTSMSCPHISG+ ALLKAAHPEWSP AIKSALMT+AYT DNT SP
Sbjct  531  GLVKDERRPEFNIMSGTSMSCPHISGVVALLKAAHPEWSPSAIKSALMTSAYTVDNTGSP  590

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA G   +NPWA+GSG+V+P KALSPGLVYDIA  DY  FLCSLDY+   IQAI ++P
Sbjct  591  LLDAAGGSNANPWAYGSGYVNPQKALSPGLVYDIATEDYIGFLCSLDYSADHIQAISQSP  650

Query  370  NITCAKKLSNPAQLNYPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N TC++KLS+P  LNYPSFSV+FG    R VR +RELTNVG AG++Y +    PPSV+VT
Sbjct  651  NTTCSRKLSDPGNLNYPSFSVVFGGKSRRPVRYSRELTNVGLAGSVYNLTYSGPPSVSVT  710

Query  544  VKPTKLVFKNVGDRLRYTV  600
            V+P KLVFK VG++L+YTV
Sbjct  711  VRPKKLVFKQVGEKLKYTV  729



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 1/193 (1%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT+DNT SP+RDA G
Sbjct  289  RKTGFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTYDNTESPLRDATG  348

Query  208  DE-LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  384
            +E LS PWA+G+GHV+P KALSPGL+YD +  DY  FLCSL+YT   ++ +VK P+  C+
Sbjct  349  EESLSTPWAYGAGHVNPQKALSPGLLYDASTQDYIYFLCSLNYTLDHLRLLVKHPDANCS  408

Query  385  KKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
            KK ++P  LNYPSFSV+FG +++VR TR LTNVG  G+ Y VA+ AP +V +TV P KL 
Sbjct  409  KKFADPGDLNYPSFSVVFGSNKVVRYTRTLTNVGEPGSAYNVAVSAPSTVDITVNPNKLE  468

Query  565  FKNVGDRLRYTVT  603
            F  VG+R  YTVT
Sbjct  469  FGEVGERQTYTVT  481



>ref|XP_009590702.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=778

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 158/195 (81%), Gaps = 3/195 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++ SFNI+SGTSM+CPH++G+AAL+KA HPEWSP AIKSA+MTTAYT DNTNS  RD+  
Sbjct  546  RKTSFNIISGTSMACPHVTGVAALIKAVHPEWSPSAIKSAIMTTAYTQDNTNSSFRDSAE  605

Query  208  DEL-SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  384
            D + S+P AHGSGHV+P KALSPGL+YDI   D+  FLCSL Y   QIQAIVK  N TCA
Sbjct  606  DSIFSSPLAHGSGHVNPQKALSPGLIYDIRIQDHIKFLCSLHYPMDQIQAIVKRVNFTCA  665

Query  385  KKLSNPAQLNYPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             K ++  Q+NYPSFSVLFG   +R+VR TRE+TNVGAAG++YEVAI+ P SVTVTVKP K
Sbjct  666  NKFADAGQINYPSFSVLFGVNSTRVVRYTREVTNVGAAGSVYEVAIDGPSSVTVTVKPPK  725

Query  559  LVFKNVGDRLRYTVT  603
            LVFK VG++L YTVT
Sbjct  726  LVFKKVGEKLHYTVT  740



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score =   272 bits (696),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 157/195 (81%), Gaps = 3/195 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++ SFNI+SGTSM+CPH++G+AAL+KA HPEWSP AIKSA+MTTAY  DNTNS  RD+  
Sbjct  529  RKTSFNIISGTSMACPHVTGVAALIKAVHPEWSPSAIKSAIMTTAYNQDNTNSSFRDSAE  588

Query  208  DEL-SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  384
            D + SNP AHGSGHV+P KALSPGLVYDI   D+  FLCSLDY   QIQAIVK  N TCA
Sbjct  589  DGIFSNPLAHGSGHVNPQKALSPGLVYDIRIQDHIKFLCSLDYPMDQIQAIVKRVNFTCA  648

Query  385  KKLSNPAQLNYPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             K ++  Q+NYPSFSVLFG   +R+VR TRE+TNVGAA ++YEVAI+AP SVT TVKP K
Sbjct  649  NKFADAGQINYPSFSVLFGINSTRVVRYTREVTNVGAAESVYEVAIDAPSSVTATVKPPK  708

Query  559  LVFKNVGDRLRYTVT  603
            LVFK VG++L YTVT
Sbjct  709  LVFKKVGEKLHYTVT  723



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score =   272 bits (696),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 156/195 (80%), Gaps = 3/195 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG-  204
            +  SFNI+SGTSMSCPH+SG+AAL+KA HPEWSP A KSA+MTTAYT DNTNS   D+  
Sbjct  532  RRTSFNIVSGTSMSCPHVSGVAALVKAVHPEWSPSATKSAIMTTAYTQDNTNSSFHDSAL  591

Query  205  GDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  384
                SNP+AHGSGHV+P KA SPGLVYDI   D+  FLCSL+YT  QIQ+IV+  N TCA
Sbjct  592  YGTFSNPFAHGSGHVNPQKAFSPGLVYDIRIQDHIKFLCSLNYTIDQIQSIVRRLNFTCA  651

Query  385  KKLSNPAQLNYPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
            KK ++  Q+NYPSFSVLF     R+VR TRE+TNVGAA ++YEVAI+APPSVTVTVKPTK
Sbjct  652  KKFADVGQINYPSFSVLFEINSKRVVRYTREVTNVGAASSVYEVAIDAPPSVTVTVKPTK  711

Query  559  LVFKNVGDRLRYTVT  603
            LVFK VG++L YTVT
Sbjct  712  LVFKKVGEKLHYTVT  726



>ref|XP_010937330.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=772

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 157/199 (79%), Gaps = 6/199 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D    +FNIMSGTSMSCPHISG+AALLK  HPEWSP AI+SALMTTAY  D+TNSP
Sbjct  537  GLGKDGRRTAFNIMSGTSMSCPHISGVAALLKGKHPEWSPAAIRSALMTTAYNIDDTNSP  596

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RD+ G  ++ P+A G+GHVDP KALSPGL+YDI   DY  FLCSLDYT Q IQ IVK P
Sbjct  597  LRDSAGGSVATPFAFGAGHVDPRKALSPGLIYDITTEDYIAFLCSLDYTIQHIQVIVKRP  656

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N+TC++  SNP +LNYPSFSV+F K    +V+  RELTNVG+AG++Y V I  P +V+VT
Sbjct  657  NVTCSRSFSNPGELNYPSFSVVFKKKSRNVVKYIRELTNVGSAGSVYNVRIRGPENVSVT  716

Query  544  VKPTKLVFKNVGDRLRYTV  600
            VKP KL+FK+VG +L+Y++
Sbjct  717  VKPAKLIFKHVGQKLKYSI  735



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 157/201 (78%), Gaps = 9/201 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYT DNTN+P
Sbjct  501  GLAKDPRRTPFNIISGTSMSCPHISGLAALLKAAHPRWSPSAIKSALMTTAYTVDNTNAP  560

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    +S P+AHG+GHVDPH+ALSPGLVYD +P DY  FLCSLDY+ + +Q IV   
Sbjct  561  LRDASDYSISTPFAHGAGHVDPHRALSPGLVYDASPADYVAFLCSLDYSDEMLQMIVS--  618

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAG--TLYEVAIEAPPS-VTV  540
            N TC++K ++P QLNYPSFSV+FGKSR+VR TRELTNV   G   +Y  ++EAPP  V  
Sbjct  619  NATCSRKFADPGQLNYPSFSVVFGKSRVVRYTRELTNVDPRGGSVIYRASVEAPPELVAA  678

Query  541  TVKPTKLVFKNVGDRLRYTVT  603
            TVKP+ L F+N GD+ RYTVT
Sbjct  679  TVKPSILEFRNAGDKRRYTVT  699



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 152/200 (76%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D    +FNIMSGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT DNT SP
Sbjct  534  GLAKDERRSAFNIMSGTSMSCPHISGVAALLKAAHPDWSPSAIKSALMTTAYTDDNTGSP  593

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + D  G   + PWA+GSGHVDP KALSPGL+YDI   DY  FLCSL+Y+T  IQAI K+ 
Sbjct  594  LVDGAGGSPATPWAYGSGHVDPQKALSPGLIYDIGTGDYLAFLCSLEYSTDHIQAISKST  653

Query  370  NITCAKKLSNPAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N TC+++L NP  LNYPSFSV+FG+   R V+  R LTNVG  G++Y V +  PP V VT
Sbjct  654  NKTCSRRLPNPGNLNYPSFSVVFGRRSRRFVKYNRVLTNVGVPGSVYNVKVGGPPGVKVT  713

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            VKPTKL+F  VG +LRY VT
Sbjct  714  VKPTKLIFNQVGQKLRYKVT  733



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT+DNT SP+RDA G
Sbjct  521  RKTGFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTYDNTESPLRDATG  580

Query  208  DE-LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  384
            +E LS PWA+G+GHV+P KALSPGL+YD +  DY  FLCSL+YT   ++ +VK P+  C+
Sbjct  581  EESLSTPWAYGAGHVNPQKALSPGLLYDASTQDYIYFLCSLNYTLDHLRLLVKHPDANCS  640

Query  385  KKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
            KK ++P  LNYPSFSV+FG +++VR TR LTNVG  G+ Y+VA+ AP +V +TV P KL 
Sbjct  641  KKFADPGDLNYPSFSVVFGSNKVVRYTRTLTNVGEPGSAYDVAVSAPSTVDITVNPNKLE  700

Query  565  FKNVGDRLRYTVT  603
            F  VG+R  YTVT
Sbjct  701  FGEVGERQTYTVT  713



>gb|KHN17728.1| Subtilisin-like protease [Glycine soja]
Length=224

 Score =   252 bits (643),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +1

Query  49   MSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE-LSNP  225
            MSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT+DNT SPIRDA G+E +S P
Sbjct  1    MSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTNDNTESPIRDAKGEETISTP  60

Query  226  WAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPA  405
            WA+G+GHV+P KALSPGLVY+ +  DY  FLCSL+YT   ++ +VK P+  C+KK ++PA
Sbjct  61   WAYGAGHVNPQKALSPGLVYEASTQDYIAFLCSLNYTLDHLRLVVKDPDANCSKKFADPA  120

Query  406  QLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  585
            +LNYPSFS++FG ++++R TR LTNVG  G++Y++ +  P +V VTV P +L F+ +G+ 
Sbjct  121  ELNYPSFSLVFGSNKLLRYTRTLTNVGEPGSVYDLVLSVPSTVHVTVNPRRLQFRQLGES  180

Query  586  LRYTVT  603
              YTVT
Sbjct  181  QTYTVT  186



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 154/195 (79%), Gaps = 3/195 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG-  204
            +  SFNI+SGTSMSCPH+SG+AAL+KA HP+WSP AIKSA+MTTAYT DNTNS   D+  
Sbjct  532  RRTSFNIVSGTSMSCPHVSGVAALVKAVHPDWSPSAIKSAIMTTAYTQDNTNSSFHDSAL  591

Query  205  GDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  384
                SNP+ HGSGHV+P KA SPGLVY+I   D+  FLCSL+YT  QIQ+IVK  N TCA
Sbjct  592  YGTFSNPFVHGSGHVNPQKAFSPGLVYNIRIHDHIKFLCSLNYTIDQIQSIVKRLNFTCA  651

Query  385  KKLSNPAQLNYPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             K ++  Q+NYPSFSVLF     R+VR TRE+TNVGAA ++YEVA +APPSVTVTVKPTK
Sbjct  652  NKFADAGQINYPSFSVLFEINSKRVVRYTREVTNVGAASSVYEVATDAPPSVTVTVKPTK  711

Query  559  LVFKNVGDRLRYTVT  603
            LVFK VG++L YTVT
Sbjct  712  LVFKKVGEKLHYTVT  726



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 153/200 (77%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNIMSGTSMSCPHISG+AALLK AHP WSP AIKSALMTT+Y  DNTNSP
Sbjct  532  GLLKDGRRTQFNIMSGTSMSCPHISGVAALLKGAHPNWSPAAIKSALMTTSYVLDNTNSP  591

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   + P+A+G+GHVDP +ALSPGLVYDI   DY  FLCSL+YT   IQAI K P
Sbjct  592  LRDAAGGSYATPFAYGAGHVDPQRALSPGLVYDITADDYIAFLCSLNYTIPHIQAITKRP  651

Query  370  NI-TCAKKLSNPAQLNYPSFSVLFGKS-RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N+ TC+++ S+P  LNYPSFSV+FGK  R+V+  RELTNVG+A + YE  +  P  V VT
Sbjct  652  NVTTCSRRFSDPGNLNYPSFSVVFGKKWRVVKYRRELTNVGSASSTYEAKVSGPGGVAVT  711

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            VKP KL+FK+V  +L+Y+VT
Sbjct  712  VKPAKLMFKHVNQKLKYSVT  731



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNIMSGTSMSCPHISGLAALLK+ HP+WSP AIKSALMTTAYT DNT SP+RDA G
Sbjct  522  RKTQFNIMSGTSMSCPHISGLAALLKSVHPDWSPSAIKSALMTTAYTRDNTESPLRDATG  581

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
            + LS PWA+GSGHV P KALSPGL+YD    DY  FLCSL+YT   +Q IVK  ++ C+K
Sbjct  582  EALSIPWAYGSGHVSPQKALSPGLLYDTDTQDYIAFLCSLNYTLDHVQLIVKRHDVNCSK  641

Query  388  -KLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
               ++P  LNYPSFSV+FG + +V+ TR LTNVG A ++Y+V +  P +V +TVKPT+LV
Sbjct  642  YYFADPGDLNYPSFSVVFGNNSVVQYTRRLTNVGEAKSVYDVVVSGPSTVGITVKPTRLV  701

Query  565  FKNVGDRLRYTVT  603
            F+ VG+R  YTVT
Sbjct  702  FEQVGERQTYTVT  714



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   259 bits (661),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNIMSGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT DNT SP+RDA G
Sbjct  525  RKAQFNIMSGTSMSCPHISGVAALLKAAHPEWSPSAIKSALMTTAYTLDNTESPLRDAMG  584

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
            + LS PWA+GSGHV+P KALSPGLVYD    DY  FLCSL+Y+   ++ IVK PN+ C+ 
Sbjct  585  EALSTPWAYGSGHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDHVKLIVKRPNVNCST  644

Query  388  KLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
             LS P  LNYPSFSV+FG  S +V+  R LTNVG A ++Y+VA+  P +V + V PTKLV
Sbjct  645  YLSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAVSGPSTVGIIVNPTKLV  704

Query  565  FKNVGDRLRYTV  600
            F+ VG+R  Y V
Sbjct  705  FEQVGERQTYMV  716



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNIMSGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT DNT SP+RDA G
Sbjct  525  RKAQFNIMSGTSMSCPHISGVAALLKAAHPEWSPSAIKSALMTTAYTLDNTESPLRDAMG  584

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
            + LS PWA+GSGHV+P KALSPGLVYD    DY  FLCSL+Y+   ++ IVK PN+ C+ 
Sbjct  585  EALSTPWAYGSGHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDHVKLIVKRPNVNCST  644

Query  388  KLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
             LS P  LNYPSFSV+FG  S +V+  R LTNVG A ++Y+VA+  P +V + V PTKLV
Sbjct  645  YLSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAVSGPSTVGIIVNPTKLV  704

Query  565  FKNVGDRLRYTV  600
            F+ VG+R  Y V
Sbjct  705  FEQVGERQTYMV  716



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL KAA P WS  AIKSALMTTAY HDNT  PI DA     +
Sbjct  533  FNIISGTSMSCPHVSGVAALFKAARPTWSTSAIKSALMTTAYVHDNTRKPITDAADGTPT  592

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            +PW  G+GH+DP KALSPGLVYD+   DY  F+CSL+YT +Q+Q+ V+  N+TC+ KLS+
Sbjct  593  SPWDLGAGHIDPRKALSPGLVYDLTADDYIAFVCSLNYTIKQVQSTVRRTNVTCSTKLSD  652

Query  400  PAQLNYPSFSVLFGKSR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNV  576
            P QLNYPSFSVLF  +R +VR +RELTNVG AG++Y+VA++AP +V V VKP +LVF  V
Sbjct  653  PGQLNYPSFSVLFRPNRKVVRYSRELTNVGDAGSVYKVAVQAPSTVAVRVKPRRLVFGKV  712

Query  577  GDRLRYTVT  603
            G++ RYTVT
Sbjct  713  GEKQRYTVT  721



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE-L  216
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYTHDNT SP+RDA G+E L
Sbjct  535  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTHDNTESPLRDATGEEAL  594

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS  396
            S PWA+G+GHV+P KALSPGLVYD +  DY  FLCSL+YT   ++ +VK  +  C+ K +
Sbjct  595  STPWAYGAGHVNPQKALSPGLVYDASTQDYIAFLCSLNYTLDHLRLVVKHSDANCSTKFA  654

Query  397  NPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNV  576
            +P  LNYPSFSV+FG +++V+ TR LTNVG A ++Y+V +  P +V +TV P ++ F  V
Sbjct  655  DPGDLNYPSFSVVFGSNKVVQYTRTLTNVGKAASVYDVVVSTPSTVEITVNPNRVSFAEV  714

Query  577  GDRLRYTVT  603
            G+   Y VT
Sbjct  715  GECQTYKVT  723



>gb|ACL52505.1| unknown [Zea mays]
Length=421

 Score =   243 bits (620),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 149/205 (73%), Gaps = 11/205 (5%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AAL+KAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  181  GLAKDGRRTRFNIISGTSMSCPHISGVAALMKAAHPDWSPSAIKSALMTTAYTVDNTNSS  240

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    ++N +A+G+GHVDP +ALSPGLVYDI+  DY  FLCSL+Y+   +Q I KA 
Sbjct  241  LRDAADGSVANAFAYGAGHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKAS  300

Query  370  NITC-AKKLSNPAQLNYPSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPP  528
            N++C A   S P  LNYPSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P 
Sbjct  301  NVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPE  360

Query  529  SVTVTVKPTKLVFKNVGDRLRYTVT  603
            SV VTV P +L F+  G +LRY VT
Sbjct  361  SVAVTVTPARLTFRQAGQKLRYYVT  385



>ref|XP_006662325.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=535

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 148/194 (76%), Gaps = 3/194 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +  +FNI+SGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAYT DNTNS +RDA G
Sbjct  306  RRTNFNIISGTSMSCPHISGVAALLKAAHPGWSPAAIKSALMTTAYTVDNTNSSLRDAAG  365

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
              L+NP+A G+GHVDP KALSPGLVYDI+  DY  FLCSL+Y+T  IQ I K  NITC +
Sbjct  366  GLLANPFAFGAGHVDPQKALSPGLVYDISTKDYVSFLCSLNYSTPHIQVITKMSNITCPR  425

Query  388  KLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            K   P  LNYPSFSV+F K+   ++R  RE+TNVG A ++Y V + +P SV+V V P+++
Sbjct  426  KF-RPGDLNYPSFSVVFKKNSRHVMRFRREVTNVGPAMSVYNVKVTSPASVSVKVTPSRI  484

Query  562  VFKNVGDRLRYTVT  603
            VF  VG + RY VT
Sbjct  485  VFNRVGQKQRYYVT  498



>ref|NP_001064523.2| Os10g0394200 [Oryza sativa Japonica Group]
 dbj|BAF26437.2| Os10g0394200, partial [Oryza sativa Japonica Group]
Length=230

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 138/190 (73%), Gaps = 3/190 (2%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            S+     TSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT DNTNS +RDA G  L
Sbjct  5    SYGYEISTSMSCPHISGVAALLKAAHPEWSPAAIKSALMTTAYTVDNTNSSLRDAAGGLL  64

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS  396
            + P+A G+GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  NITC +K  
Sbjct  65   ATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMSNITCPRKF-  123

Query  397  NPAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
             P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V V P KLVF 
Sbjct  124  RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVKVTPAKLVFN  183

Query  571  NVGDRLRYTV  600
             VG + RY V
Sbjct  184  KVGQKQRYYV  193



>ref|XP_006661279.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=635

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 148/193 (77%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDA-GGDEL  216
            FNI+SGTSMSCPHISGLAA +KAA+P+WSP AIKSALMTTAYT DNT SPI DA GG+  
Sbjct  406  FNILSGTSMSCPHISGLAAFVKAANPDWSPSAIKSALMTTAYTVDNTGSPILDAAGGNST  465

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS  396
            + PW+ G+GHVDP KALSPGLVYD +  DY  FLCS+  + QQ+QAI  APN+TC +KLS
Sbjct  466  ATPWSIGAGHVDPVKALSPGLVYDASVDDYVAFLCSVGTSPQQVQAITAAPNVTCQRKLS  525

Query  397  NPAQLNYPSFSVLFGK--SR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            +P  LNYPSFSV+FG+  SR  V+  RELTNVG   G++Y V +  P  + V VKP +L 
Sbjct  526  SPGDLNYPSFSVVFGRRSSRSSVKYRRELTNVGGDGGSVYTVRVTGPSDIAVAVKPARLA  585

Query  565  FKNVGDRLRYTVT  603
            FK  GD+LRYTVT
Sbjct  586  FKAAGDKLRYTVT  598



>ref|XP_002519362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42979.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 137/181 (76%), Gaps = 11/181 (6%)
 Frame = +1

Query  64   MSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELSNPWAHGSG  243
            MSCPH+SG+AAL+KAAHP WSP A++SALMTTAYT D+TN+P++DA   + SNPWA+GSG
Sbjct  1    MSCPHVSGIAALVKAAHPTWSPSALRSALMTTAYTVDSTNTPLQDAVTAKFSNPWAYGSG  60

Query  244  HVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPS  423
            HVDP +ALSPGLVYDI+P DY  FLCSL+Y            N+TC +K S+  +LNYPS
Sbjct  61   HVDPKRALSPGLVYDISPQDYVTFLCSLNYDL----------NLTCPRKFSDLGELNYPS  110

Query  424  FSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  600
            FSVLFG K+  VR +RELTNVG A   Y VA+ AP  V VTV P KLVFK VG++LRYT 
Sbjct  111  FSVLFGKKTTAVRYSRELTNVGTARATYRVAVTAPSEVAVTVAPAKLVFKKVGEKLRYTA  170

Query  601  T  603
            T
Sbjct  171  T  171



>gb|EMS60034.1| Subtilisin-like protease [Triticum urartu]
Length=478

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 143/200 (72%), Gaps = 7/200 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTT YT DNTNS 
Sbjct  243  GLAKDGRRTPFNIISGTSMSCPHISGLAALLKAAHPNWSPAAIKSALMTTTYTMDNTNSS  302

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   + P+  G+GHVDP KALSPGLVYDI+ +DY  FLCSLDY+   I+ I K  
Sbjct  303  LRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTSDYVAFLCSLDYSAAHIRVITKMA  362

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N++C  + S P  LNYPSFSV+F K    +VR  RELTNVG A  +Y+V +  P S  VT
Sbjct  363  NVSCPPR-SRPGDLNYPSFSVVFRKKPRHVVRYRRELTNVGPAMAVYDVKVSGPASAGVT  421

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            V P +LVFK VG + RY VT
Sbjct  422  VTPARLVFKKVGQKQRYYVT  441



>ref|XP_004983113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=766

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 149/200 (75%), Gaps = 7/200 (4%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D    +FNI+SGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAYT DNTNS 
Sbjct  532  GLAKDGRRTNFNIISGTSMSCPHISGVAALLKAAHPNWSPAAIKSALMTTAYTVDNTNSS  591

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    L+N +A+G+GHVDP KALSPGLVYDI+  DY  FLCSLDY+   IQ I K  
Sbjct  592  LRDAADGSLANVFAYGAGHVDPQKALSPGLVYDISTNDYVAFLCSLDYSAPHIQVITKMS  651

Query  370  NITCAKKLSNPAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N +C KK   P  LNYPSFSV+F +   R++R  RE+TNVG A ++Y V + +P SV+VT
Sbjct  652  NFSCPKKF-RPGDLNYPSFSVVFKQKSKRVMRFRREVTNVGPATSVYNVKVTSPASVSVT  710

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            V PTKL FK VG + RY VT
Sbjct  711  VTPTKLTFKKVGQKQRYYVT  730



>ref|XP_010238670.1| PREDICTED: subtilisin-like protease isoform X1 [Brachypodium 
distachyon]
Length=769

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 148/200 (74%), Gaps = 7/200 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPH+SG+AALLKAAHP WSP AIKSALMT++YT DNTNS 
Sbjct  534  GLAKDGRRTRFNIISGTSMSCPHVSGVAALLKAAHPNWSPAAIKSALMTSSYTVDNTNSS  593

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
             RD  G   +NP+A G+GHVDPHKALSPGLVYDI+  DY +FLCSLDY+   I+ + K  
Sbjct  594  FRDTAGSSPANPFAFGAGHVDPHKALSPGLVYDISTNDYVVFLCSLDYSVSHIRVVTKMS  653

Query  370  NITCAKKLSNPAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            NI+C +K S P  LNYPSFSV+F      +VR  RELTNVG A ++Y V + +P SV+V 
Sbjct  654  NISCPQK-SRPGDLNYPSFSVVFRNKPKHVVRYRRELTNVGPAMSVYNVKVSSPASVSVK  712

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            V P KLVFK +G +LRY VT
Sbjct  713  VSPEKLVFKKLGQKLRYYVT  732



>gb|EEE50901.1| hypothetical protein OsJ_31407 [Oryza sativa Japonica Group]
Length=758

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT DNTNS 
Sbjct  524  GLVKDGRRTHFNIISGTSMSCPHISGVAALLKAAHPEWSPAAIKSALMTTAYTVDNTNSS  583

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G  L+ P+A G+GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  
Sbjct  584  LRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMS  643

Query  370  NITCAKKLSNPAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            NITC +K   P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V 
Sbjct  644  NITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVK  702

Query  544  VKPTKLVFKNVGDRLRYTV  600
            V P KLVF  VG + RY V
Sbjct  703  VTPAKLVFNKVGQKQRYYV  721



>tpg|DAA61658.1| TPA: putative subtilase family protein [Zea mays]
Length=548

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT DNT SP+ DA  
Sbjct  316  RRSEFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTTDNTGSPLLDAAT  375

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCA  384
            +  + PWA G+GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  + PN+TC 
Sbjct  376  NTTATPWAFGAGHVDPVSALSPGLVYDASVDDYVAFLCTVGVAPRQIQAITAEGPNVTCT  435

Query  385  KKLSNPAQLNYPSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  555
            +KLS+P  LNYPSFSV+F +  SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP 
Sbjct  436  RKLSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPA  495

Query  556  KLVFKNVGDRLRYTVT  603
            +L F+  GD+LRYTVT
Sbjct  496  RLEFRRAGDKLRYTVT  511



>gb|AAM22744.1|AC092388_28 putative cucumisin-like serine protease [Oryza sativa Japonica 
Group]
 gb|AAP53584.1| Subtilisin N-terminal Region family protein, expressed [Oryza 
sativa Japonica Group]
Length=773

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT DNTNS 
Sbjct  539  GLVKDGRRTHFNIISGTSMSCPHISGVAALLKAAHPEWSPAAIKSALMTTAYTVDNTNSS  598

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G  L+ P+A G+GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  
Sbjct  599  LRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMS  658

Query  370  NITCAKKLSNPAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            NITC +K   P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V 
Sbjct  659  NITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVK  717

Query  544  VKPTKLVFKNVGDRLRYTV  600
            V P KLVF  VG + RY V
Sbjct  718  VTPAKLVFNKVGQKQRYYV  736



>gb|EAY78354.1| hypothetical protein OsI_33442 [Oryza sativa Indica Group]
Length=773

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT DNTNS 
Sbjct  539  GLVKDGRRTHFNIISGTSMSCPHISGVAALLKAAHPEWSPAAIKSALMTTAYTVDNTNSS  598

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G  L+ P+A G+GHVDP KALSPGL+YDI+  DY  FLCSL+YTT  IQ I K  
Sbjct  599  LRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPHIQVITKMS  658

Query  370  NITCAKKLSNPAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            NITC +K   P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V +  P SV+V 
Sbjct  659  NITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVSGPASVSVK  717

Query  544  VKPTKLVFKNVGDRLRYTV  600
            V P KLVF  VG + RY V
Sbjct  718  VTPAKLVFNKVGQKQRYYV  736



>dbj|BAJ89916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 149/195 (76%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRD---AGG  207
            +FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT DNT SP+ D   A  
Sbjct  541  AFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTVDNTGSPLLDAAGANA  600

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTT-QQIQAIVKAPNITCA  384
               + PW+ GSGHVDP KALSPGLVYD +  DY  FLC++   + +Q+QA+  APN TC 
Sbjct  601  TATATPWSFGSGHVDPVKALSPGLVYDTSIDDYVAFLCTVGGASPRQVQAVTGAPNATCQ  660

Query  385  KKLSNPAQLNYPSFSVLFG--KSR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  555
            +KLS+P  LNYPSFSV+FG  KSR  VR  RELTNVGAAG++Y   +  PPS+ V+VKP 
Sbjct  661  RKLSSPGDLNYPSFSVVFGLRKSRTTVRYHRELTNVGAAGSVYAAKVTGPPSIVVSVKPA  720

Query  556  KLVFKNVGDRLRYTV  600
            +LVFK  GD+LRYTV
Sbjct  721  RLVFKKAGDKLRYTV  735



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 146/196 (74%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT DNT SP+ DA  
Sbjct  542  RRSEFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTVDNTESPLLDAAT  601

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCA  384
            +  + PWA G+GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  A PN+TC 
Sbjct  602  NATATPWAFGAGHVDPVSALSPGLVYDASVDDYVAFLCAVGVAPRQIQAITAAGPNVTCT  661

Query  385  KKLSNPAQLNYPSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  555
            +KLS+P  LNYPSFSV+FG+  SR  V+  RELTNVG AG  Y V +  P  ++V+VKP 
Sbjct  662  RKLSSPGDLNYPSFSVVFGRRSSRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKPA  721

Query  556  KLVFKNVGDRLRYTVT  603
            +L F+  GD+LRYTVT
Sbjct  722  RLQFRRAGDKLRYTVT  737



>dbj|BAK06243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 143/200 (72%), Gaps = 7/200 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +DS    FNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTT YT DNTNS 
Sbjct  534  GLAKDSRRTSFNIISGTSMSCPHISGLAALLKAAHPNWSPAAIKSALMTTTYTMDNTNSS  593

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   + P+  G+GHVDP KALSPGLVYDI+  DY  FLCSLDY+   I+ I K  
Sbjct  594  LRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTNDYAAFLCSLDYSATHIRVITKMS  653

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N++C  + S P  LNYPSFSV+F K     VR  RELTNVG A  +Y+V +  P SV VT
Sbjct  654  NVSCPPR-SRPGDLNYPSFSVVFRKKARHAVRYRRELTNVGPAMAVYDVKVSGPASVGVT  712

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            V P KLVFK VG + RY VT
Sbjct  713  VTPAKLVFKKVGQKQRYYVT  732



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 146/196 (74%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT DNT SP+ DA  
Sbjct  512  RRSEFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTVDNTESPLLDAAT  571

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCA  384
            +  + PWA G+GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  A PN+TC 
Sbjct  572  NATATPWAFGAGHVDPVSALSPGLVYDNSVDDYVAFLCTVGVAPRQIQAITAAGPNVTCT  631

Query  385  KKLSNPAQLNYPSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  555
            +KLS+P  LNYPSFSV+FG+  SR  V+  RELTNVG AG  Y V +  P  ++V+VKP 
Sbjct  632  RKLSSPGDLNYPSFSVVFGQRSSRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKPA  691

Query  556  KLVFKNVGDRLRYTVT  603
            +L F+  GD+LRYTVT
Sbjct  692  RLQFRRAGDKLRYTVT  707



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 141/194 (73%), Gaps = 6/194 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT DNT SPI DA  +  +
Sbjct  541  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTVDNTGSPIVDAASNTTA  600

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             PW+ G+GHVDP KALSPGLVYD +  DY  FLCS+  +  Q+QAI  APN+TC +KLS+
Sbjct  601  TPWSIGAGHVDPVKALSPGLVYDTSVDDYVAFLCSVGTSPPQVQAITAAPNVTCQRKLSS  660

Query  400  PAQLNYPSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            P  LNYPSFSV+FG+         V+  RELTNVG   ++Y   +  P  + V VKP +L
Sbjct  661  PGDLNYPSFSVVFGRRSSSSRSTTVKYRRELTNVGDGRSVYTARVTGPSDIAVAVKPARL  720

Query  562  VFKNVGDRLRYTVT  603
             FK  GD+LRYTVT
Sbjct  721  AFKKAGDKLRYTVT  734



>ref|XP_002467295.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
 gb|EER94293.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
Length=767

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 148/200 (74%), Gaps = 7/200 (4%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AAL+KAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  533  GLAKDGRRTHFNIISGTSMSCPHISGVAALMKAAHPDWSPAAIKSALMTTAYTVDNTNSS  592

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    L+N +A+G+GHVDP KALSPGLVYDI+  DY  FLCSL+Y+   IQ I K  
Sbjct  593  LRDAADGSLANAFAYGAGHVDPQKALSPGLVYDISTNDYAAFLCSLNYSAPHIQVITKTS  652

Query  370  NITCAKKLSNPAQLNYPSFSVLFG-KSRIV-RQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N++C KK   P  LNYPSFSV+F  KS+ V R  RELTNVG A ++Y V + +P SV VT
Sbjct  653  NVSCPKKF-RPGDLNYPSFSVVFNQKSKPVQRFRRELTNVGPATSVYNVKVISPESVAVT  711

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            V P KL FK  G +LRY VT
Sbjct  712  VTPAKLTFKKAGQKLRYHVT  731



>tpg|DAA50071.1| TPA: putative subtilase family protein [Zea mays]
Length=773

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 149/205 (73%), Gaps = 11/205 (5%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AAL+KAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  533  GLAKDGRRTRFNIISGTSMSCPHISGVAALMKAAHPDWSPSAIKSALMTTAYTVDNTNSS  592

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    ++N +A+G+GHVDP +ALSPGLVYDI+  DY  FLCSL+Y+   +Q I KA 
Sbjct  593  LRDAADGSVANAFAYGAGHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKAS  652

Query  370  NITC-AKKLSNPAQLNYPSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPP  528
            N++C A   S P  LNYPSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P 
Sbjct  653  NVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPE  712

Query  529  SVTVTVKPTKLVFKNVGDRLRYTVT  603
            SV VTV P +L F+  G +LRY VT
Sbjct  713  SVAVTVTPARLTFRQAGQKLRYYVT  737



>ref|NP_001145743.1| uncharacterized protein LOC100279250 precursor [Zea mays]
 gb|ACN33223.1| unknown [Zea mays]
Length=773

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 149/205 (73%), Gaps = 11/205 (5%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AAL+KAAHP+WSP AIKSALMTTAYT DNTNS 
Sbjct  533  GLAKDGRRTRFNIISGTSMSCPHISGVAALMKAAHPDWSPSAIKSALMTTAYTVDNTNSS  592

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    ++N +A+G+GHVDP +ALSPGLVYDI+  DY  FLCSL+Y+   +Q I KA 
Sbjct  593  LRDAADGSVANAFAYGAGHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKAS  652

Query  370  NITC-AKKLSNPAQLNYPSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPP  528
            N++C A   S P  LNYPSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P 
Sbjct  653  NVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPE  712

Query  529  SVTVTVKPTKLVFKNVGDRLRYTVT  603
            SV VTV P +L F+  G +LRY VT
Sbjct  713  SVAVTVTPARLTFRQAGQKLRYYVT  737



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT DNT SP+ DA  
Sbjct  534  RRSEFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTTDNTGSPLLDAAT  593

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCA  384
            +  + PWA G+GHVDP  ALSPGLVYD +  DY  FLC++    +QIQAI  + PN+TC 
Sbjct  594  NTTATPWAFGAGHVDPVSALSPGLVYDASVDDYVAFLCTVGVAPRQIQAITAEGPNVTCT  653

Query  385  KKLSNPAQLNYPSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  555
            +KLS+P  LNYPSFSV+F +  SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP 
Sbjct  654  RKLSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPA  713

Query  556  KLVFKNVGDRLRYTVT  603
            +L F+  GD+LRYTVT
Sbjct  714  RLEFRRAGDKLRYTVT  729



>ref|XP_004956934.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +  +FNI+SGTSMSCPHISGLAA +KAAHP WSP AIKSALMTTAYT DNT+SP+ DA  
Sbjct  541  RRSAFNILSGTSMSCPHISGLAAFVKAAHPNWSPSAIKSALMTTAYTVDNTDSPLLDAAT  600

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCA  384
            +  + PWA G+GHVDP +ALSPGLVYD    DY  FLC++  + +Q+QA+  A PN+TC 
Sbjct  601  NATATPWAFGAGHVDPVRALSPGLVYDATVDDYVAFLCTVGVSPRQVQAVAAAGPNVTCT  660

Query  385  KKLSNPAQLNYPSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  555
            +KLS+P  LNYPSFSV+FG+  SR  V+  RELTNVG  G  Y V +  P  V V+VKP 
Sbjct  661  RKLSSPGDLNYPSFSVVFGRRSSRSTVKYRRELTNVGDTGATYTVKVTGPSDVGVSVKPA  720

Query  556  KLVFKNVGDRLRYTVT  603
             L F+  GD+LRYTVT
Sbjct  721  MLQFRRPGDKLRYTVT  736



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 145/191 (76%), Gaps = 4/191 (2%)
 Frame = +1

Query  25   LQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPI  192
            L+ED+    + I SGTSM+CPH +G+AALLKAAHP+WS  AIKSALMTTAYT DNTNS I
Sbjct  492  LKEDNRISEYVIESGTSMACPHATGVAALLKAAHPKWSASAIKSALMTTAYTIDNTNSVI  551

Query  193  RDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  372
            RD+     SNPWA+GSGH+D  KA SPGL+YDI+  +YT FLCSLDY  + I+ I   P 
Sbjct  552  RDSATGSSSNPWAYGSGHIDSRKAFSPGLIYDISKKEYTKFLCSLDYPLEFIRTITLNPK  611

Query  373  ITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            ++C+ +  +  +LNYPSFSVLFG   +V+ +R+LTN GAA + YEV + APP+VTVTVKP
Sbjct  612  VSCSSRFDDLGELNYPSFSVLFGNKTMVQYSRKLTNAGAANSAYEVIVAAPPAVTVTVKP  671

Query  553  TKLVFKNVGDR  585
              LVFKNVG++
Sbjct  672  RNLVFKNVGEK  682


 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 118/166 (71%), Gaps = 13/166 (8%)
 Frame = +1

Query  106  AAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELSNPWAHGSGHVDPHKALSPGLVY  285
            +AHP+WS  AI+SA+MTTAYT D+TN             PWA+GSGH+DP KA SPGL+Y
Sbjct  815  SAHPKWSVSAIQSAIMTTAYTIDDTN-------------PWAYGSGHIDPRKAFSPGLIY  861

Query  286  DIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQT  465
            DI+  +Y  FLCSL++  + ++ I + P +TC+K+  +  +LNYPSFSVLFG    V+ T
Sbjct  862  DISKEEYIKFLCSLNFPLEIVREITENPFLTCSKRFDDLGELNYPSFSVLFGNKTTVQYT  921

Query  466  RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  603
            R LTNVG A + YEV + APP++TVTVKP KLVFKNVG++  Y VT
Sbjct  922  RTLTNVGTAKSTYEVKVTAPPALTVTVKPRKLVFKNVGEKHSYRVT  967



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 144/196 (73%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT DNT SP+ DA  
Sbjct  534  RRSEFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTTDNTGSPLLDAAT  593

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCA  384
            +  + PWA G+GHVDP  ALSPGLVYD +  DY  FLC++    +QIQ I  + PN+TC 
Sbjct  594  NTTATPWAFGAGHVDPVSALSPGLVYDASVDDYVAFLCTVGVAPRQIQVITAEGPNVTCT  653

Query  385  KKLSNPAQLNYPSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  555
            +KLS+P  LNYPSFSV+F +  SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP 
Sbjct  654  RKLSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPA  713

Query  556  KLVFKNVGDRLRYTVT  603
            +L F+  GD+LRYTVT
Sbjct  714  RLEFRRAGDKLRYTVT  729



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 147/199 (74%), Gaps = 6/199 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT D T SP
Sbjct  544  GLAKDKRRTKFNIISGTSMSCPHISGVAALLKAAHPDWSPAAIKSALMTTAYTRDTTGSP  603

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LS P AHGSGHVDP  AL PGL+YD++ +DY  FLCSL+Y+  Q++ + K  
Sbjct  604  LRDAATGGLSTPLAHGSGHVDPQNALDPGLIYDLSTSDYLDFLCSLNYSDTQVRIVSKHS  663

Query  370  NITCAK-KLSNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
            N +C + K+ +   LNYPSFSV+F G  ++VR +R LTNVG   ++Y V++ AP  V +T
Sbjct  664  NFSCPRDKVLDTGNLNYPSFSVIFRGYEKVVRYSRVLTNVGEPSSVYTVSVSAPEGVGIT  723

Query  544  VKPTKLVFKNVGDRLRYTV  600
            VKP +LVFK VG++  YTV
Sbjct  724  VKPQRLVFKGVGNKQGYTV  742



>ref|XP_010238218.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=805

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 144/198 (73%), Gaps = 11/198 (6%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE-L  216
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAY  DN  SP+ DA GD   
Sbjct  569  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYAVDNNGSPLLDAAGDNTT  628

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTT--QQIQAIVKA----PNIT  378
            + PW+ GSGHVDP KALSPGLVYD +  DY  FLC++   +  +QIQAI  +     N T
Sbjct  629  ATPWSFGSGHVDPVKALSPGLVYDTSIDDYVAFLCTVGGASSPRQIQAITGSRTAKGNAT  688

Query  379  CAKKLSNPAQLNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIE-APPSVTVTV  546
            C +KLS+P  LNYPSFSV++   +    V+  RELTNVGAAG++Y V +   P SV+V V
Sbjct  689  CQRKLSSPGDLNYPSFSVVYPLRKSHSTVKYRRELTNVGAAGSVYTVKVTGGPSSVSVAV  748

Query  547  KPTKLVFKNVGDRLRYTV  600
            KP +LVFK  GD+L+YTV
Sbjct  749  KPARLVFKKAGDKLKYTV  766



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 141/198 (71%), Gaps = 22/198 (11%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D+    FNIMSGTSMSCPHISG+AAL+KAAHPEWSP A+KSALMTTAYT DNT SP
Sbjct  514  GLGKDTRKTQFNIMSGTSMSCPHISGVAALIKAAHPEWSPSAVKSALMTTAYTRDNTKSP  573

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA    LSN        V P+               Y  FLCSLDYT + ++AIVK  
Sbjct  574  LRDAADGGLSNTIGX---WVRPY---------------YVAFLCSLDYTIEHVRAIVKRQ  615

Query  370  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            NITC++K S+P +LNYPSFSVLFG    VR TRELTNVGAA ++Y+VA+  PPSV V V 
Sbjct  616  NITCSRKFSDPGELNYPSFSVLFGSKXFVRYTRELTNVGAAXSVYQVAVTGPPSVGVVVX  675

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ LVFKNVG++ RYTVT
Sbjct  676  PSTLVFKNVGEKXRYTVT  693



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +1

Query  127  PGAIKSALMTTAYTHDNTNSPIRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDY  306
            P  +   LMTTAY HDNT SP+RDA G   S PWAHG+GHV+PH+ALSPGLVYD + TDY
Sbjct  564  PAPLNLHLMTTAYVHDNTKSPLRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYDASITDY  623

Query  307  TMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVG  486
              FLCSLDYT + IQ IVK   + C +K S+P QLNYPSFS+ FG  R+VR TR LTNVG
Sbjct  624  IKFLCSLDYTPEHIQLIVKRHAVNCTRKFSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVG  683

Query  487  AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  603
             AG++Y+V ++AP +V VTV+P +LVF  +G+R RYTVT
Sbjct  684  EAGSVYDVTVDAPSTVEVTVRPARLVFGKLGERKRYTVT  722



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL+ A P WSP AIKSAL+TT+Y+ D++ SPI+D    E S
Sbjct  539  FNIISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALITTSYSLDSSGSPIKDLATSEES  598

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKL  393
            NP+ HG+GH+DP++AL+PGL+YD+ P DY  FLCS+ Y ++QI   VK  + +  C  KL
Sbjct  599  NPFVHGAGHIDPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYSQLCEHKL  658

Query  394  SNPAQLNYPSFSVLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            SNP  LNYPSFSV+F    +V+ TR +TNVG     +Y V +EAP  V ++V P KL F 
Sbjct  659  SNPGNLNYPSFSVVFDDGEVVKYTRTVTNVGDETEVVYGVKVEAPQGVEISVVPNKLEFN  718

Query  571  NVGDRLRYTVT  603
                 L Y +T
Sbjct  719  KEKTTLSYEIT  729



>gb|EPS61652.1| hypothetical protein M569_13143, partial [Genlisea aurea]
Length=738

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 139/201 (69%), Gaps = 7/201 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL EDS    FNI+SGTSMSCPHISG++A+LKA HP+WSP AIKSAL+TT+YT DNTNSP
Sbjct  503  GLPEDSRVTPFNILSGTSMSCPHISGVSAILKAIHPDWSPSAIKSALITTSYTIDNTNSP  562

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            I D+    ++ P+  G+GHVDP KA+SPGLVYD   TDY  FLC  +YT + I  I    
Sbjct  563  IEDSVDSSVATPFVLGAGHVDPAKAVSPGLVYDANVTDYVSFLCWSNYTAESISTIAGGR  622

Query  370  NITC--AKKLSNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTV  540
            N+TC  A  + +P QLNYPSFSV+F    R V  TR +TNVG   + Y V++ AP + T+
Sbjct  623  NVTCPEANGVDDPGQLNYPSFSVVFVSGGRPVSYTRVVTNVGNGPSTYVVSVTAPSAATI  682

Query  541  TVKPTKLVFKNVGDRLRYTVT  603
             V P +LVF   G +L+YT T
Sbjct  683  VVIPKELVFGAKGQKLQYTST  703



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 129/188 (69%), Gaps = 25/188 (13%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL KAAHP WS  AIKSALMTTAY HDNT  PI DA     +
Sbjct  532  FNIISGTSMSCPHVSGVAALFKAAHPTWSTSAIKSALMTTAYAHDNTRKPITDAADGTPT  591

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            +PW  G+GH+DP KALSPGLVYD+   DY  F+CSL+YT +Q+Q+ V+  N         
Sbjct  592  SPWGLGAGHIDPRKALSPGLVYDLTADDYVAFVCSLNYTIKQVQSTVRRTN---------  642

Query  400  PAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  579
                            ++VR +RE+TNVG AG++Y+VA++AP +V V VKP +LVF  VG
Sbjct  643  ----------------KVVRYSREVTNVGDAGSVYKVAVQAPSTVAVRVKPRRLVFGKVG  686

Query  580  DRLRYTVT  603
            ++ RYTVT
Sbjct  687  EKQRYTVT  694



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 133/191 (70%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL+ A P WSP AIKSAL+TT+Y+ D++  PI+D    E S
Sbjct  539  FNIISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALITTSYSLDSSGKPIKDLSTSEES  598

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI--TCAKKL  393
            NP+ HG+GH++P++AL+PGL+YD+ P DY  FLCS+ Y ++QI   VK  +    C  KL
Sbjct  599  NPFVHGAGHINPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYFQLCEHKL  658

Query  394  SNPAQLNYPSFSVLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            +NP  LNYPSFSV+F +  +V+ TR +TNVG     +YEV +EAP  V ++V P KL F 
Sbjct  659  TNPGNLNYPSFSVVFDEEEVVKYTRTVTNVGDETEVVYEVKVEAPQGVVISVVPNKLEFN  718

Query  571  NVGDRLRYTVT  603
                   Y +T
Sbjct  719  KEKTTQSYEIT  729



>gb|KJB70156.1| hypothetical protein B456_011G061400 [Gossypium raimondii]
Length=764

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 137/192 (71%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALLK A+P WSP AIKSALMTTAY  DN+   I D    E +
Sbjct  528  FNIISGTSMSCPHVSGLAALLKKAYPNWSPAAIKSALMTTAYNLDNSGHTINDLATGEEA  587

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKL  393
            +P+ +G+GHVDP++AL+PGLVYD   +DY  FLCS+ Y +++I+  V+ PN +  CA KL
Sbjct  588  SPFIYGAGHVDPNRALNPGLVYDTDSSDYIAFLCSIGYDSKRIEVFVREPNSSDVCATKL  647

Query  394  SNPAQLNYPSFSVLFGKS-RIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            + P  LNYPSFSV+F  +  +V+  R++ NVG +AG +YE  + APP V ++V P+KL F
Sbjct  648  ATPGDLNYPSFSVVFNSNDHVVKYRRKVKNVGTSAGAVYEAKVNAPPGVKISVSPSKLEF  707

Query  568  KNVGDRLRYTVT  603
              V   L Y V+
Sbjct  708  SAVNQTLSYEVS  719



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 138/201 (69%), Gaps = 8/201 (4%)
 Frame = +1

Query  25   LQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPI  192
            L+ DS    FNI+SGTSMSCPH+SGLAALL+ AHP+WSP AIKSALMT+AY  DNT + I
Sbjct  527  LESDSRRVAFNIISGTSMSCPHVSGLAALLRKAHPKWSPAAIKSALMTSAYNLDNTGANI  586

Query  193  RDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-AP  369
             D      S P+ HG+GHVDP++A+ PGLVYD+  TDY  FLC++ Y +++I    K A 
Sbjct  587  TDLATGAESTPFVHGAGHVDPNRAVDPGLVYDLDTTDYIAFLCTIGYDSRRISVFTKDAS  646

Query  370  NITCAK-KLSNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTV  540
            ++ C K     P  LNYPSFSV+F G+  +V+  R +TNVG+    +YEV + APP V V
Sbjct  647  SVDCDKLGFKTPGNLNYPSFSVVFYGEESVVKYNRTVTNVGSEVDAVYEVRVGAPPGVEV  706

Query  541  TVKPTKLVFKNVGDRLRYTVT  603
            +V P+KLVF    D+L Y VT
Sbjct  707  SVSPSKLVFSETEDKLSYEVT  727



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   208 bits (529),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 134/193 (69%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI SGTSMSCPH+SGLAALL+ AHP+W+P AIKSALMTTAY  DN    I+D    E S
Sbjct  540  FNIASGTSMSCPHVSGLAALLRKAHPKWTPAAIKSALMTTAYNVDNIGESIKDLATGEES  599

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK---APNITCAKK  390
            NP+ HGSGHVDP++AL+PGLVYD+  +DY  FLC++ Y+  +I   V+    P    A+ 
Sbjct  600  NPFVHGSGHVDPNRALNPGLVYDLGTSDYVAFLCAVGYSPGRIAVFVRDGPVPVDCGAQG  659

Query  391  LSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            +  P  LNYPSFSV+F   + +V+ TR + NVG+ A  +YEV + APPSV VTV P++LV
Sbjct  660  MGTPGDLNYPSFSVVFSPGNSVVKYTRVVKNVGSNAEAVYEVKVNAPPSVEVTVSPSQLV  719

Query  565  FKNVGDRLRYTVT  603
            F    D L Y V+
Sbjct  720  FSQGNDTLSYEVS  732



>dbj|BAJ90522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPHISGLAALLKAAHP WSP AIKSALMTTAYT DN+N  + D   
Sbjct  104  RRTEFNILSGTSMACPHISGLAALLKAAHPTWSPAAIKSALMTTAYTRDNSNGTMTDEST  163

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
             +++  +  G+GHVDP +A+ PGLVYDIAP DY  FLC+L+YT Q I+AI  +  +   A
Sbjct  164  GKVAGVFDFGAGHVDPMRAMDPGLVYDIAPMDYVNFLCNLNYTEQNIRAITRRQADCRGA  223

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++  +   LNYPS S  F   G    +R    R +TNVG   ++Y   + AP   TVTV+
Sbjct  224  RRAGHAGNLNYPSLSATFTADGAKAKMRTHFIRTVTNVGGGRSVYRATVRAPEGSTVTVR  283

Query  550  PTKLVFKNVGDRLRYTV  600
            P +L F+  G +L +TV
Sbjct  284  PERLAFRRDGQKLSFTV  300



>ref|XP_004492670.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=785

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+K+ H +WSP AIKS+LMTTAYT +N N+PI D   +  S
Sbjct  557  FNIVSGTSMSCPHVSGIAALIKSVHKDWSPAAIKSSLMTTAYTLNNRNAPISDLAPNNNS  616

Query  220  ---NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
               NP+A GSGHVDP  A  PGLVYDI+  DY  + CSL++T+ QI AI+      C+ K
Sbjct  617  ASANPFAFGSGHVDPESASDPGLVYDISTNDYLNYFCSLNFTSSQI-AILSKSKFNCSMK  675

Query  391  LSNPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
                  LNYPSFSV+F   GKS  V   R +TNVG + ++YEV +E P  V V+V+P KL
Sbjct  676  QVQVGDLNYPSFSVIFSRTGKSASVTYKRVVTNVGKSESVYEVKVEQPNGVVVSVEPRKL  735

Query  562  VFKNVGDRLRYTVT  603
             F  +G +LRY VT
Sbjct  736  KFDKLGQKLRYKVT  749



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ A+P+WSP AIKSALMTTAY  DN+   I+D    E S
Sbjct  369  FNIISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALMTTAYNLDNSGENIKDLASGEES  428

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKL  393
             P+ HG+GHVDP++AL+PGLVYDI  ++Y  FLCS+ Y  ++I   V+ P  +  C + L
Sbjct  429  TPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPVSSDICTRAL  488

Query  394  SNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVF  567
            + P  LNYPSFSV+F  +  +V+  R + NVG++   +YEV + APP+V V V P+KL F
Sbjct  489  ATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAF  548

Query  568  KNVGDRLRYTVT  603
                  L Y +T
Sbjct  549  SAEKKALAYEIT  560



>ref|XP_003536496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN02773.1| Subtilisin-like protease [Glycine soja]
Length=782

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 125/191 (65%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY HDNT  P+RDA   E S
Sbjct  556  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTIKPLRDASNAEAS  615

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P +AL PGLVYDI P DY  FLCSL  TT ++    K  N TC   LS+
Sbjct  616  TPYDHGAGHINPRRALDPGLVYDIQPQDYIEFLCSLKLTTSELGVFAKYSNRTCRHSLSS  675

Query  400  PAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F     + ++   R  TNVG   + Y V + +    +V V+P  L F 
Sbjct  676  PGDLNYPAISVVFPLKNSTSVLTVHRTATNVGLPVSKYHVVVSSFKGASVKVEPDTLSFT  735

Query  571  NVGDRLRYTVT  603
                +L Y VT
Sbjct  736  RKYQKLSYKVT  746



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 130/192 (68%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ AHP+WSP AIKSALMTTAY  DN+   I D      S
Sbjct  535  FNIISGTSMSCPHVSGLAALLRKAHPKWSPAAIKSALMTTAYNLDNSGGNITDLATGSES  594

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITC-AKKL  393
            NP+ HGSGHVDP++A+ PGLVYD+  TDY  FLC++ Y +++I    K A ++ C A   
Sbjct  595  NPFVHGSGHVDPNRAVDPGLVYDLEITDYVAFLCTIGYDSRRISVFTKQASSVDCDALGF  654

Query  394  SNPAQLNYPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVF  567
              P  LNYPSFSV+F G   +V+  R + NVG  A  +YEV +  P  V V+V P+KLVF
Sbjct  655  KTPGNLNYPSFSVVFSGSESVVKYKRTVKNVGKEANAVYEVKVNTPLGVEVSVSPSKLVF  714

Query  568  KNVGDRLRYTVT  603
                D+L Y VT
Sbjct  715  SEKEDKLSYEVT  726



>gb|EYU31528.1| hypothetical protein MIMGU_mgv1a0212142mg, partial [Erythranthe 
guttata]
Length=435

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 136/192 (71%), Gaps = 4/192 (2%)
 Frame = +1

Query  31   EDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGD  210
            + +FNI+SGTSMSCPH+SG+AALLK+AHP+WSP AIKSA+MTTAY  +   +PI D    
Sbjct  211  KSTFNIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTAYQENLKGNPIEDE-SL  269

Query  211  ELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
            + +N +A GSGHV+P +A  PGLVYDI P DY  +LC L+Y  Q++  +V    + C+K+
Sbjct  270  QPANVFAIGSGHVNPSRANDPGLVYDILPDDYLQYLCGLNYPNQEVSILV-GRKVDCSKE  328

Query  391  LSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
             S P AQLNYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF
Sbjct  329  KSIPEAQLNYPSFSIVFG-STPQTYTRTLTNVGKANSSYDVEIVSPDGVNVKVEPKKLVF  387

Query  568  KNVGDRLRYTVT  603
              +GD+  Y+VT
Sbjct  388  PKLGDKSSYSVT  399



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 134/194 (69%), Gaps = 6/194 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL+ A+PEWSP AIKSALMTTAY  DN+   I+D G  + S
Sbjct  551  FNIISGTSMSCPHVSGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGKIKDLGTGKES  610

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI--TC--AK  387
            NP+ HG+GHVDP+KAL+PGLVYD+   DY  FLCS+ Y  ++IQ   + P     C   +
Sbjct  611  NPFVHGAGHVDPNKALNPGLVYDLNINDYLAFLCSIGYDAKEIQIFTREPTSYNVCENER  670

Query  388  KLSNPAQLNYPSFSVLFGKSR-IVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKL  561
            K ++P  LNYPSFSV+FG +  +V+  R LTNVG +   +Y V + AP  V V+V P+KL
Sbjct  671  KFTSPGDLNYPSFSVVFGANNGLVKYKRVLTNVGDSVDAVYTVKVNAPFGVDVSVSPSKL  730

Query  562  VFKNVGDRLRYTVT  603
            VF +      + VT
Sbjct  731  VFSSENKTQAFEVT  744



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 127/191 (66%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY HDNT +P++DA     S
Sbjct  544  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTLNPLKDASTAVPS  603

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            NP+ HG+GHV+P KAL PGLVYDI P DY  FLC+   T  Q++   K  N TC   L+ 
Sbjct  604  NPYDHGAGHVNPRKALDPGLVYDIRPQDYYEFLCTQSLTPTQLKVFSKYANRTCKHSLAG  663

Query  400  PAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P +LNYP+ SV+F +     ++   R +TNVG   + Y V++      +V V+P  L F 
Sbjct  664  PGELNYPAISVVFPEKASVSVISVRRTVTNVGPPVSNYHVSVSPFRGASVKVEPKSLSFN  723

Query  571  NVGDRLRYTVT  603
              G +L Y VT
Sbjct  724  KAGQKLSYKVT  734



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ A+P+WSP AIKSALMTTAY  DN+   I+D    E S
Sbjct  541  FNIISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALMTTAYNLDNSGENIKDLASGEES  600

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKL  393
             P+ HG+GHVDP++AL+PGLVYDI  ++Y  FLCS+ Y  ++I   V+ P  +  C + L
Sbjct  601  TPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPVSSDICTRAL  660

Query  394  SNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVF  567
            + P  LNYPSFSV+F  +  +V+  R + NVG++   +YEV + APP+V + V P+KL F
Sbjct  661  ATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAINVWPSKLAF  720

Query  568  KNVGDRLRYTVT  603
                  L Y +T
Sbjct  721  SAEKKALAYEIT  732



>ref|XP_008784364.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=798

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AIKSALMTTAYT DN    + D   
Sbjct  559  RRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIKSALMTTAYTKDNKKMTMLDEST  618

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S+ +  GSGHVDP +AL PGLVYDI+  DY  FLC+L+YT Q I+A+  +A + + A
Sbjct  619  GNSSDVFDFGSGHVDPQRALDPGLVYDISTMDYVNFLCNLNYTRQNIRAVTRRAADCSRA  678

Query  385  KKLSNPAQLNYPSFSVLF-----GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            +K  +P  LNYPSF+ +F     GK R     R LTNVG    +Y  ++  P   TV V+
Sbjct  679  RKTGHPGNLNYPSFAAVFVDDGSGKRRSTHFIRTLTNVGNGKAVYRASVRGPEGSTVAVE  738

Query  550  PTKLVFKNVGDRLRYTV  600
            P +L F+  G +L + +
Sbjct  739  PEELAFRRTGQKLSFVL  755



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 132/192 (69%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ A+P+WSP  IKSALMTTAY  DN+   I+D    E S
Sbjct  541  FNIISGTSMSCPHVSGLAALLRKAYPDWSPAVIKSALMTTAYNLDNSGENIKDLASGEES  600

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKL  393
             P+ HG+GHVDP++AL+PGLVYDI  ++Y  FLCS+ Y  ++I   V+ P  +  C + L
Sbjct  601  TPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPASSDICTRAL  660

Query  394  SNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVF  567
            + P  LNYPSFSV+F  +  +V+  R + NVG++   +YEV + APP+V V V P+KL F
Sbjct  661  ATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAF  720

Query  568  KNVGDRLRYTVT  603
                  L Y +T
Sbjct  721  SAEKKALAYEIT  732



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+AALLK+ H +WSP AIKSALMTTAYT +N  +PI D   D   
Sbjct  510  FNILSGTSMSCPHVSGIAALLKSFHKDWSPAAIKSALMTTAYTLNNKGAPISDMASDNSP  569

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
             + P+A GSGHV+P  A  PGLVYDI+  DY  +LCS++YT+ QI  + +   +   K L
Sbjct  570  FATPFAFGSGHVNPVNASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKTL  629

Query  394  SNPAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
                 LNYPSFSVLFG+S     V   R +TNVG   + Y V +E P  V+VTV+P KL 
Sbjct  630  LQAGNLNYPSFSVLFGRSASNASVTYRRVVTNVGNPQSAYAVKLEQPNGVSVTVEPRKLK  689

Query  565  FKNVGDRLRYTVT  603
            F+ VG +L Y VT
Sbjct  690  FEKVGQKLSYKVT  702



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 124/191 (65%), Gaps = 5/191 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI++GTSMSCPH+SG+AALLK+ H +WSP AIKSALMTTAY  DN  SPI D      +
Sbjct  544  FNILTGTSMSCPHVSGIAALLKSRHKDWSPAAIKSALMTTAYVTDNKGSPILDVAFSSSA  603

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLS  396
             P+A GSGHVDP +A  PGL+YDI+P DY  +LCSL Y   QI   V   N TC K  + 
Sbjct  604  TPFALGSGHVDPERASDPGLIYDISPKDYIYYLCSLKYNASQISLFVD--NFTCPKHAIM  661

Query  397  NPAQLNYPSFSVLFGKSRI--VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
             P  LNYPSF+V F  S    V   R +TNVG   + Y+V +E P  V+V VKP  L FK
Sbjct  662  QPGDLNYPSFAVNFKSSAAENVTYKRTVTNVGTPKSTYKVLVEEPKGVSVIVKPEILTFK  721

Query  571  NVGDRLRYTVT  603
             +G +L Y VT
Sbjct  722  MLGKKLSYKVT  732



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 125/191 (65%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT  P+RDA   + S
Sbjct  552  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTIKPLRDASSADAS  611

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P++AL PGLVYDI P DY  FLC+   T  ++    K  N TC   L++
Sbjct  612  TPYDHGAGHINPNRALDPGLVYDIQPQDYFEFLCTQKLTPSELGVFAKYSNRTCRHSLAS  671

Query  400  PAQLNYPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F +   S ++   R  TNVG A + Y V +      +V V+P  L F 
Sbjct  672  PGDLNYPAISVVFSQINSSSVLTVHRTATNVGPAVSKYHVVVSPFKGASVKVEPETLSFT  731

Query  571  NVGDRLRYTVT  603
                +L Y VT
Sbjct  732  KKYQKLSYKVT  742



>ref|XP_004308418.2| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 133/197 (68%), Gaps = 9/197 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGD--E  213
            FN++SGTSMSCPH+SGLAAL+K+ H +WSP AIKSALMTTAYT +N  SPI D G +  +
Sbjct  544  FNMVSGTSMSCPHVSGLAALIKSVHKDWSPAAIKSALMTTAYTLNNKGSPISDFGSNNSQ  603

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKK  390
             +NP+A GSGH DP  A  PGL+YDI   DY ++LCSL+YT+ QI        N TC   
Sbjct  604  PANPFAFGSGHADPESAADPGLIYDITTNDYLLYLCSLNYTSPQIALFSSGISNFTCPSN  663

Query  391  --LSNPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAG-TLYEVAIEAPPSVTVTVKP  552
              +  P  LNYPS SV+F   G+      TR +TNVGA   + Y V +EAP  V+VTV+P
Sbjct  664  STVLQPGNLNYPSLSVVFRRDGRKMSATYTRTVTNVGAINPSTYAVQVEAPIGVSVTVEP  723

Query  553  TKLVFKNVGDRLRYTVT  603
             KLVFK +G++L Y V+
Sbjct  724  RKLVFKKMGEKLSYKVS  740



>ref|XP_011035007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=769

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 129/194 (66%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FN++SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAY  DN  SPI DAG    +
Sbjct  541  FNVISGTSMSCPHVSGLAALLKSVHKKWSPAAIKSALMTTAYATDNRGSPIADAGSSNSA  600

Query  220  N--PWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKK  390
            +  P+A GSGHVDP +A  PGL+YDI   DY  + CSLDYT+ QI A V   N+TC   K
Sbjct  601  SATPFAFGSGHVDPERASDPGLIYDITIEDYLNYFCSLDYTSSQI-AQVSRRNVTCPDNK  659

Query  391  LSNPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
               P  LNYPSF+V F    ++  V+  R LTNVG   + Y V +E P  V+V ++P  L
Sbjct  660  ALQPGDLNYPSFAVNFEGNARNNRVKYKRTLTNVGTPSSTYAVKVEEPNGVSVILEPKSL  719

Query  562  VFKNVGDRLRYTVT  603
             F+ +G +L Y VT
Sbjct  720  SFEKLGQKLSYNVT  733



>gb|KHN01461.1| Subtilisin-like protease [Glycine soja]
Length=346

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 131/197 (66%), Gaps = 7/197 (4%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT DN   P+ D   
Sbjct  108  RRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNKGDPMLDEST  167

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--  381
              +S+ + +G+GHV P KA++PGLVYDI+ +DY  FLC+ +YTT  I  I +  N  C  
Sbjct  168  GNVSSVFDYGAGHVHPVKAMNPGLVYDISTSDYVNFLCNSNYTTNTIHVITRR-NADCSG  226

Query  382  AKKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            AK+  +   LNYPS S +F   GK R+     R +TNVG   ++Y+V I+ P    VTVK
Sbjct  227  AKRAGHSGNLNYPSLSAVFQLYGKKRMATHFIRTVTNVGDPNSVYKVTIKPPRGTVVTVK  286

Query  550  PTKLVFKNVGDRLRYTV  600
            P  L F+ VG +L + V
Sbjct  287  PDTLNFRRVGQKLNFLV  303



>gb|KJB57037.1| hypothetical protein B456_009G146000 [Gossypium raimondii]
Length=768

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 127/192 (66%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALLK A+P+WSP AIKSALMTTAYT DN+ S I+D    E S
Sbjct  532  FNIISGTSMSCPHVSGLAALLKKAYPKWSPAAIKSALMTTAYTLDNSGSTIKDLATGEES  591

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKL  393
            +P+ HG+GHVDP++AL+PGLVYDI   DY  FLCS+ Y   +I   V+ P  +  C  KL
Sbjct  592  SPFGHGAGHVDPNRALNPGLVYDIDNDDYIAFLCSIGYDLNRIAVFVRGPTGSDICEGKL  651

Query  394  SNPAQLNYPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            + P  LNYPSFSV+F     +V+  R + NVG +   +Y   + AP  V + V P KL F
Sbjct  652  ATPGDLNYPSFSVVFYSNDHVVKYKRTVKNVGTSVDVVYTAKVNAPAGVEINVSPCKLEF  711

Query  568  KNVGDRLRYTVT  603
                  L Y +T
Sbjct  712  SGENKTLSYEIT  723



>ref|XP_006606084.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 123/191 (64%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY HDNT  P+RDA   E S
Sbjct  555  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTIKPLRDASNAEAS  614

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P +AL PGLVYDI P DY  FLC+   TT ++    K  N TC   LS+
Sbjct  615  TPYDHGAGHINPRRALDPGLVYDIQPQDYFEFLCTQKLTTSELGVFAKYSNRTCKHSLSS  674

Query  400  PAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F     + ++   R  TNVG   + Y V +      +V V+P  L F 
Sbjct  675  PGDLNYPAISVVFPLKNSTSVLTVHRTATNVGLPVSKYHVVVSPFKGASVKVEPDTLSFT  734

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  735  RKYQKLSYKIT  745



>dbj|BAJ88858.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=785

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPHISGLAALLKAAHP WSP AIKSALMTTAYT DN+N  + D   
Sbjct  541  RRTEFNILSGTSMACPHISGLAALLKAAHPTWSPAAIKSALMTTAYTRDNSNGTMTDEST  600

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
             +++  +  G+GHVDP +A+ PGLVYDIAP DY  FLC+L+YT Q I+AI  +  +   A
Sbjct  601  GKVAGVFDFGAGHVDPMRAMDPGLVYDIAPMDYVNFLCNLNYTEQNIRAITRRQADCRGA  660

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++  +   LNYPS S  F   G    +R    R +TNVG   ++Y   + AP   TVTV+
Sbjct  661  RRAGHAGNLNYPSLSATFTADGAKAKMRTHFIRTVTNVGGGRSVYRATVRAPEGSTVTVR  720

Query  550  PTKLVFKNVGDRLRYTV  600
            P +L F+  G +L +TV
Sbjct  721  PERLAFRRDGQKLSFTV  737



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 137/193 (71%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL+ A+P+WSP AIKSAL+TTAYT DN+ + I+D      S
Sbjct  539  FNIISGTSMSCPHVSGIAALLRKAYPKWSPAAIKSALVTTAYTLDNSGNKIKDLANGGES  598

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK--APNITCAKK-  390
             P+ HG+GHVDP++AL+PGLVYDI   DY  F+CS+ Y  +QI   ++  A +  CA+  
Sbjct  599  TPFVHGAGHVDPNRALNPGLVYDIDVNDYVAFMCSIGYGPRQIAVFMRELAGDDICARNS  658

Query  391  LSNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            L++P  LNYPSF+V+F   R +V+  R +TNVG+    +YEV ++AP  V ++V+P+KLV
Sbjct  659  LASPGDLNYPSFAVVFKPGRELVKYKRVVTNVGSVVDAVYEVNVDAPAGVEISVEPSKLV  718

Query  565  FKNVGDRLRYTVT  603
            F  V     Y VT
Sbjct  719  FSEVNQTQSYEVT  731



>gb|KHN04600.1| Subtilisin-like protease [Glycine soja]
Length=734

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+A L+K+ H +WSP AIKSALMTTA T +N  +PI D G +   
Sbjct  506  FNIVSGTSMSCPHVSGIATLIKSVHKDWSPAAIKSALMTTASTSNNKGAPIADNGSNNSA  565

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
             ++P+A GSGHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK 
Sbjct  566  FADPFAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKS  624

Query  394  S-NPAQLNYPSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            + +   LNYPSF+VLFG   ++  V   R +TNVG   + Y V +E P  V+V+V+P  +
Sbjct  625  ALHAGDLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNI  684

Query  562  VFKNVGDRLRYTVT  603
             F+ +GD+L Y VT
Sbjct  685  SFRKIGDKLSYKVT  698



>ref|XP_006583358.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=734

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+A L+K+ H +WSP AIKSALMTTA T +N  +PI D G +   
Sbjct  506  FNIVSGTSMSCPHVSGIATLIKSVHKDWSPAAIKSALMTTASTSNNKGAPIADNGSNNSA  565

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
             ++P+A GSGHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK 
Sbjct  566  FADPFAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKS  624

Query  394  S-NPAQLNYPSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            + +   LNYPSF+VLFG   ++  V   R +TNVG   + Y V +E P  V+V+V+P  +
Sbjct  625  ALHAGDLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNI  684

Query  562  VFKNVGDRLRYTVT  603
             F+ +GD+L Y VT
Sbjct  685  SFRKIGDKLSYKVT  698



>gb|KHN15704.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 123/191 (64%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY HDNT  P+RDA   E S
Sbjct  515  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTIKPLRDASNAEAS  574

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P +AL PGLVYDI P DY  FLC+   TT ++    K  N TC   LS+
Sbjct  575  TPYDHGAGHINPRRALDPGLVYDIQPQDYFEFLCTQKLTTSELGVFAKYSNRTCKHSLSS  634

Query  400  PAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F     + ++   R  TNVG   + Y V +      +V V+P  L F 
Sbjct  635  PGDLNYPAISVVFPLKNSTSVLTVHRTATNVGLPVSKYHVVVSPFKGASVKVEPDTLSFT  694

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  695  RKYQKLSYKIT  705



>ref|XP_003528890.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=763

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+A L+K+ H +WSP AIKSALMTTA T +N  +PI D G +   
Sbjct  535  FNIVSGTSMSCPHVSGIATLIKSVHKDWSPAAIKSALMTTASTSNNKGAPIADNGSNNSA  594

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
             ++P+A GSGHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK 
Sbjct  595  FADPFAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKS  653

Query  394  S-NPAQLNYPSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            + +   LNYPSF+VLFG   ++  V   R +TNVG   + Y V +E P  V+V+V+P  +
Sbjct  654  ALHAGDLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNI  713

Query  562  VFKNVGDRLRYTVT  603
             F+ +GD+L Y VT
Sbjct  714  SFRKIGDKLSYKVT  727



>ref|XP_010917391.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=797

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 131/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP WSP AIKSALMTTAYT DN N  + D   
Sbjct  555  RRTEFNILSGTSMACPHVSGLAALLKAAHPGWSPAAIKSALMTTAYTKDNRNMTMLDEST  614

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITCA  384
               S+ +  GSGHVDP +A+ PGL+YDI+  DY  FLC+L+YT Q I+AI + P + + A
Sbjct  615  GNSSDVFDFGSGHVDPQRAMDPGLLYDISLVDYVNFLCNLNYTQQNIRAITRRPADCSRA  674

Query  385  KKLSNPAQLNYPSFSVLF-----GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            +K  +   LNYPSF+ +F     GKS      R +TN+G+ G +Y  ++  P   TV V+
Sbjct  675  RKAGHAGNLNYPSFAAVFVDDGSGKSMSTHFIRTVTNIGSGGAVYRASVRVPEGSTVMVE  734

Query  550  PTKLVFKNVGDRLRYTV  600
            P +LVF+  G +L + +
Sbjct  735  PKELVFRRPGQKLSFML  751



>gb|KFK26784.1| hypothetical protein AALP_AA8G293000 [Arabis alpina]
Length=758

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 127/192 (66%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP AIKSALMTTAY HDN   PI DA G   S
Sbjct  531  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNMLKPITDASGAAPS  590

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
             P+ HGSGH+DP KA+ PGLVYDI P DY  FLC+ D T  Q++   K  N TC   L+ 
Sbjct  591  TPYDHGSGHIDPLKAIDPGLVYDIGPQDYFEFLCTQDLTPAQLKVFTKHSNRTCKNTLAN  650

Query  397  NPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF    + +++   R +TNVG   + Y+V++      +VTV+P  L F
Sbjct  651  NPGNLNYPAISALFPENARVKVMTLRRTVTNVGPHISSYKVSVSPFKGASVTVQPKTLNF  710

Query  568  KNVGDRLRYTVT  603
                 +L YTVT
Sbjct  711  TLKHQKLSYTVT  722



>gb|KHN01421.1| Subtilisin-like protease [Glycine soja]
Length=387

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 127/198 (64%), Gaps = 10/198 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH SG+AALL+ A+PEWSP AIKSALMTTAY  DN+   I+D G  + S
Sbjct  150  FNIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGSIKDLGSGKES  209

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--------NI  375
            NP+ HG+GHVDP++A++PGLVYD+   DY  FLCS+ Y   QI    + P         +
Sbjct  210  NPFIHGAGHVDPNRAINPGLVYDLDTGDYVAFLCSVGYDANQIAVFTREPAAESVCEGKV  269

Query  376  TCAKKLSNPAQLNYPSFSV-LFGKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVK  549
                KL++P  LNYPSF+V L G+  +V+  R +TNVG+    +Y V +  PP V V V 
Sbjct  270  GRTGKLASPGDLNYPSFAVKLGGEGDLVKNKRVVTNVGSEVDAVYTVKVNPPPGVGVGVS  329

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ +VF        + VT
Sbjct  330  PSTIVFSAENKTQAFEVT  347



>ref|XP_006574858.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006574859.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=772

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+AALLK+ H +WSP AIKSALMTTAYT +N  +PI D   +   
Sbjct  544  FNILSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMASNNSP  603

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
            L+ P+A GSGHV+P  A  PGLVYDI+  DY  +LCS++YT+ QI  + +   +   K +
Sbjct  604  LATPFAFGSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAV  663

Query  394  SNPAQLNYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
                 LNYPSF+VL GKS +   V   R +TNVG   + Y V +E P  V+VTV+P KL 
Sbjct  664  LQAGDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLK  723

Query  565  FKNVGDRLRYTVT  603
            F+ VG +L Y VT
Sbjct  724  FEKVGQKLSYKVT  736



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 125/195 (64%), Gaps = 7/195 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLA+LLK+ H +WSP AIKSALMTTAYT +N  +PI D G    S
Sbjct  536  FNIISGTSMSCPHVSGLASLLKSVHRDWSPAAIKSALMTTAYTLNNKGAPIADIGSTSTS  595

Query  220  N---PWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
                P+A GSGHVDP  A  PGLVYDI   DY  +LCSL Y + QI       N TC K 
Sbjct  596  KSATPFAFGSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKN  655

Query  391  -LSNPAQLNYPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             +  P  LNYPSFSVLF K   +  V   R + NVG   + Y V ++ P  V+VTV+P  
Sbjct  656  AVLQPGDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRS  715

Query  559  LVFKNVGDRLRYTVT  603
            L FK +G++L Y V+
Sbjct  716  LRFKKMGEKLSYKVS  730



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 125/195 (64%), Gaps = 7/195 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLA+LLK+ H +WSP AIKSALMTTAYT +N  +PI D G    S
Sbjct  536  FNIISGTSMSCPHVSGLASLLKSVHRDWSPAAIKSALMTTAYTLNNKGAPIADIGSTSTS  595

Query  220  N---PWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
                P+A GSGHVDP  A  PGLVYDI   DY  +LCSL Y + QI       N TC K 
Sbjct  596  KSATPFAFGSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKN  655

Query  391  -LSNPAQLNYPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             +  P  LNYPSFSVLF K   +  V   R + NVG   + Y V ++ P  V+VTV+P  
Sbjct  656  AVLQPGDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRS  715

Query  559  LVFKNVGDRLRYTVT  603
            L FK +G++L Y V+
Sbjct  716  LGFKKMGEKLSYKVS  730



>ref|XP_009410252.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=790

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AIKSALMTTAY  DN  + + D   
Sbjct  550  RRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIKSALMTTAYVKDNRGTTMLDEST  609

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S+ +  GSGHV+P +A+ PGLVYD+ PTDY  FLC+L+YT Q I+AI  +A +   A
Sbjct  610  GNSSDVFDFGSGHVNPQRAMDPGLVYDLTPTDYVNFLCNLNYTQQNIKAITRRAADCRGA  669

Query  385  KKLSNPAQLNYPSFSVLFGKSRIVRQ-----TRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            +K  +   LNYPSFS +F +    R+      R + NVG    +Y   + AP   TVTV+
Sbjct  670  RKAGHAGNLNYPSFSAVFVEDGTKRRMSTHFIRTVRNVGNGAAVYRATVRAPEGSTVTVE  729

Query  550  PTKLVFKNVGDRLRYTV  600
            PT+L F+  G +L + V
Sbjct  730  PTELAFRRAGQKLSFLV  746



>gb|KHN27220.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+AALLK+ H +WSP AIKSALMTTAYT +N  +PI D   +   
Sbjct  513  FNILSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMASNNSP  572

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
            L+ P+A GSGHV+P  A  PGLVYDI+  DY  +LCS++YT+ QI  + +   +   K +
Sbjct  573  LATPFAFGSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAV  632

Query  394  SNPAQLNYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
                 LNYPSF+VL GKS +   V   R +TNVG   + Y V +E P  V+VTV+P KL 
Sbjct  633  LQAGDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLN  692

Query  565  FKNVGDRLRYTVT  603
            F+ VG +L Y VT
Sbjct  693  FEKVGQKLSYKVT  705



>ref|XP_008454764.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008454765.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=768

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 126/194 (65%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG--GDE  213
            FNI+SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAY  DN N  I D G     
Sbjct  540  FNIISGTSMSCPHVSGLAALLKSVHKDWSPAAIKSALMTTAYVTDNKNHLISDVGRASGG  599

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-  390
             ++P+A GSGHVDP KA  PGLVYDIAP DY  +LCSL Y + QI A+V     TC+ K 
Sbjct  600  PADPFAFGSGHVDPEKASDPGLVYDIAPQDYITYLCSLKYNSTQI-ALVSRGKFTCSSKR  658

Query  391  -LSNPAQLNYPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
                P  LNYPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL
Sbjct  659  TFFQPGDLNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRIYNPKGIRIIVKPEKL  718

Query  562  VFKNVGDRLRYTVT  603
             F  +G++L Y V+
Sbjct  719  SFVKLGEKLSYKVS  732



>gb|ADE77855.1| unknown [Picea sitchensis]
Length=394

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SG+AALLK AHP+WSP A++SALMTTAYT DN    + D   
Sbjct  158  RRTQFNILSGTSMACPHVSGVAALLKGAHPQWSPAAVRSALMTTAYTQDNRGHRMIDEAS  217

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
               S P+  G+GHV P +A+ PGL+YD+   DY  FLCSL+YT++ IQ I + P    A+
Sbjct  218  GNASTPFDFGAGHVHPERAMDPGLIYDMGTEDYVRFLCSLNYTSKAIQVITRKPTRCPAR  277

Query  388  KLSNPAQLNYPSFSVLFGKSRIVRQT----RELTNVGAAGTLYEVAIEAP-PSVTVTVKP  552
            ++S P  +NYPSFS +F  ++  + +    R +TNVG   ++Y V +  P   VTVTVKP
Sbjct  278  RIS-PGNINYPSFSAVFDLTQPKKLSTVFFRTVTNVGPPLSVYRVRVIHPRGGVTVTVKP  336

Query  553  TKLVFKNVGDRLRYTVT  603
             KLVF     +L YTVT
Sbjct  337  RKLVFTEKNQKLSYTVT  353



>ref|XP_009411443.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=765

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 126/193 (65%), Gaps = 5/193 (3%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            +FNI+SGTSMSCPH+SGLAALLK+ HP+WSP AI+SALMTTA++ D+ N+ I D      
Sbjct  542  NFNIISGTSMSCPHVSGLAALLKSLHPDWSPAAIRSALMTTAFSVDSQNASIIDVSTGLP  601

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KL  393
            + P+  GSGHVDP KA  PGL+YDIAP DY  +LCSL YT QQ+ A        C K K+
Sbjct  602  ATPFVLGSGHVDPEKASKPGLIYDIAPDDYLNYLCSLKYTPQQL-ATFAGKKYNCPKNKI  660

Query  394  SNPAQLNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
                 LNYPSFSVLF   R    +  TR +TNVG A   Y V +  P  V +TVKP  L 
Sbjct  661  IRARDLNYPSFSVLFDSGRKKATLTHTRTVTNVGQAPCGYTVNVREPQGVRITVKPKVLT  720

Query  565  FKNVGDRLRYTVT  603
            F  VG ++RY VT
Sbjct  721  FNKVGQKMRYMVT  733



>ref|XP_004140440.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004167887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=766

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 127/194 (65%), Gaps = 8/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG--GDE  213
            FNI+SGTSMSCPH+SGLAALLK+AH +WSP AIKSALMTTAY  DN  S I D G    E
Sbjct  537  FNIISGTSMSCPHVSGLAALLKSAHNDWSPAAIKSALMTTAYITDNKMSLISDVGQANGE  596

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-  390
             + P+  GSGHVDP KA  PGL+YDI P DY  +LCSL Y + QI A+V   N TC+ K 
Sbjct  597  PATPFTFGSGHVDPEKASDPGLIYDITPQDYINYLCSLKYNSTQI-ALVSRGNFTCSSKR  655

Query  391  -LSNPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             +  P  LNYPSFSV      K   +   R +TNVG + + Y V I  P  +TV VKP K
Sbjct  656  TVVKPGDLNYPSFSVFMKKKAKKVSITLKRTVTNVGISRSDYTVKINNPKGITVIVKPEK  715

Query  559  LVFKNVGDRLRYTV  600
            L F ++G++L Y V
Sbjct  716  LSFGSLGEQLSYQV  729



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 129/190 (68%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+ G+AALLKA+HP+WSP AIKSALMTTAYTHDNT  P++DA     S
Sbjct  559  FNILSGTSMSCPHVGGVAALLKASHPDWSPAAIKSALMTTAYTHDNTFRPLKDAATGAPS  618

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            NP+ HG+GH+ P KA+ PGL+YDI+P DY  FLC+   T  Q++   K+ N TC ++L++
Sbjct  619  NPYDHGAGHIRPAKAVDPGLIYDISPDDYFEFLCTQKLTPSQLKVFTKSSNRTCKQRLAS  678

Query  400  PAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKN  573
            P  LNYP+ S +F +  + ++   R +TNVG   + Y V +     V V V+P  L F +
Sbjct  679  PGDLNYPAISAVFREQPAPVLTLHRTVTNVGPPVSTYHVKVTPFRGVDVAVEPKTLHFTH  738

Query  574  VGDRLRYTVT  603
               +L Y VT
Sbjct  739  QNQKLSYKVT  748



>ref|XP_010442681.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=779

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 128/192 (67%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP AIKSALMTTAY HDNT  P+ DA G   S
Sbjct  552  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAPS  611

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PGLVYDI P DY  FLC+ D +  Q++   K  N +C   L+ 
Sbjct  612  SPYDHGAGHIDPLKAIDPGLVYDIGPQDYFYFLCTQDLSPSQLKVFTKHSNRSCKHTLAK  671

Query  397  NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF ++  V+     R LTNVG     Y+V++      +VTV+P  L F
Sbjct  672  NPGNLNYPAISALFPENTRVKSMTLRRTLTNVGPHIASYKVSVSPFKGASVTVQPKTLNF  731

Query  568  KNVGDRLRYTVT  603
                 +L YTVT
Sbjct  732  TTKHQKLSYTVT  743



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 131/194 (68%), Gaps = 6/194 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL+ A+P WSP AIKSALMTTAY  DN+   I+D G  + S
Sbjct  535  FNIISGTSMSCPHVSGIAALLRKAYPNWSPAAIKSALMTTAYDVDNSGEKIKDLGTGKES  594

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI--TCAK--  387
            NP+ HG+GHVDP++AL+PGLVYD+   DY  FLCS+ Y  ++IQ   + P     C K  
Sbjct  595  NPFVHGAGHVDPNRALNPGLVYDLNSNDYLSFLCSIGYDAKKIQIFTREPTSFDVCEKRE  654

Query  388  KLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKL  561
            KL +P  LNYPSFSV+FG  + +V+  R +TNVG     +Y V + +P  V V+V P+KL
Sbjct  655  KLVSPGNLNYPSFSVVFGVNNGLVKYKRVVTNVGGYVDAVYTVKVNSPFGVDVSVSPSKL  714

Query  562  VFKNVGDRLRYTVT  603
            VF        + +T
Sbjct  715  VFSGENKTQAFEIT  728



>ref|XP_010932346.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=804

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHPEWSP  IKSALMTTAYT DN    + D   
Sbjct  565  RRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAVIKSALMTTAYTKDNKKMTMLDEST  624

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S+ +  GSGHVDP +A+ PGLVYDI+  DY  FLC+L+YT Q I+AI  +A + + A
Sbjct  625  GNSSDVFDFGSGHVDPLRAMDPGLVYDISTIDYLNFLCNLNYTQQDIRAITRRAADCSGA  684

Query  385  KKLSNPAQLNYPSFSVLF-----GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            +K  +   LNYPSF+ +F     GK       R +TNVG    +Y  ++ AP   TVTV+
Sbjct  685  RKAGHAGNLNYPSFAAVFVGDGSGKKMSTHFIRMVTNVGNGRAVYRASVRAPEKSTVTVE  744

Query  550  PTKLVFKNVGDRLRYTV  600
            P +LVF+  G +L + V
Sbjct  745  PEELVFRRTGQKLSFVV  761



>gb|ACN28035.1| unknown [Zea mays]
Length=380

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 133/207 (64%), Gaps = 14/207 (7%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL  D+    FNI+SGTSMSCPH+SGLAALL++AHPEWSP A++SALMTTAY   +  S 
Sbjct  139  GLAADTRRVGFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYASYSGGSS  198

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            + DA    ++ P+ +G+GHVDP +AL PGLVYD+   DY  FLC+L Y++  I A+ ++ 
Sbjct  199  LLDAATGGMATPFDYGAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSR  258

Query  370  NITCAK-KLSNPAQLNYPSFSVLF--------GKSRIVRQTRELTNVGAAGTLY-EVAIE  519
               CA+ K  +   LNYPSFSV +        G S  V  TR LTNVG AGT     ++ 
Sbjct  259  EYACAENKTYSVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLA  318

Query  520  APPSVTVTVKPTKLVFKNVGDRLRYTV  600
            A   V V V+P +L F +VG++  YTV
Sbjct  319  AAKGVAVDVEPAELEFTSVGEKKSYTV  345



>ref|XP_006576383.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006576384.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=766

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+AAL+K+ H +WSP AIKSALMTTA T +N  +PI D G +   
Sbjct  538  FNIVSGTSMSCPHVSGIAALIKSVHKDWSPAAIKSALMTTASTSNNKGAPISDNGSNNSA  597

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
             ++P+A GSGHV+P +A  PGLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK 
Sbjct  598  FADPFAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKS  656

Query  394  S-NPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            + +   LNYPSF+VLF    ++  V   R +TNVG   + Y V +E P  V+VTV+P  +
Sbjct  657  ALHAGGLNYPSFAVLFDTSARNASVTYKRVVTNVGNPSSSYAVKVEEPKGVSVTVEPRNI  716

Query  562  VFKNVGDRLRYTVT  603
             F+ +GD+L Y V+
Sbjct  717  GFRKIGDKLSYKVS  730



>gb|ADE76648.1| unknown [Picea sitchensis]
Length=394

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SG+AALLK AHP+WSP A++SALMTTAYT DN    + D   
Sbjct  158  RRTQFNILSGTSMACPHVSGVAALLKGAHPQWSPAAVRSALMTTAYTQDNRGHRMIDEAS  217

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
               S P+  G+GHV P +A+ PGL+YD+   DY  FLCSL+YT++ IQ I + P    A+
Sbjct  218  GNASTPFDFGAGHVHPERAMDPGLIYDMDTEDYVRFLCSLNYTSKAIQVITRKPTRCPAR  277

Query  388  KLSNPAQLNYPSFSVLFGKSRIVRQT----RELTNVGAAGTLYEVAIEAP-PSVTVTVKP  552
            ++S P  +NYPSFS +F  ++  + +    R +TNVG   ++Y V +  P   VTVTVKP
Sbjct  278  RIS-PGNINYPSFSAVFDLTQPKKLSTVFFRTVTNVGPPLSVYRVRVIHPRGGVTVTVKP  336

Query  553  TKLVFKNVGDRLRYTVT  603
             KLVF     +L YTVT
Sbjct  337  RKLVFTEKNQKLSYTVT  353



>ref|XP_008454762.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 128/195 (66%), Gaps = 8/195 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG--GDE  213
            FNI+SGTSMSCPH+SGLAALLK+AH +WSP AIKSALMTTAY  D+  S I D G    E
Sbjct  535  FNIISGTSMSCPHVSGLAALLKSAHNDWSPAAIKSALMTTAYVTDSKMSLISDVGQANGE  594

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-  390
             + P+  GSGHVDP KA  PGL+YDI P DY  +LCSL Y + QI A+V   N+TC+ K 
Sbjct  595  PATPFTFGSGHVDPEKASDPGLIYDITPQDYINYLCSLKYNSSQI-ALVSRGNLTCSSKR  653

Query  391  -LSNPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             +  P  LNYPSFSV      K   +   R +TNVG   + Y V I  P  VTV VKP K
Sbjct  654  TVVKPGDLNYPSFSVFMKKKAKKVSITLKRTVTNVGITRSDYTVKINNPKGVTVIVKPEK  713

Query  559  LVFKNVGDRLRYTVT  603
            L F ++G++L Y V+
Sbjct  714  LSFGSLGEQLSYKVS  728



>ref|XP_007135377.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
 gb|ESW07371.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
Length=781

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 134/196 (68%), Gaps = 5/196 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT DN   P+ D   
Sbjct  543  RRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNKGDPMLDEST  602

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
              +S+ + +G+GHV P KA++PGLVYDI+P+DY  FLC+ +YTT  I  I  K+ + + A
Sbjct  603  GNVSSVFDYGAGHVHPVKAMNPGLVYDISPSDYVNFLCNSNYTTNSIHVITRKSADCSGA  662

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            K+  +   LNYPS S +F   GK R+     R +TNVG   ++Y+V I+ P  + VTVKP
Sbjct  663  KRAGHSGNLNYPSLSAVFQQYGKKRMSTHFIRTVTNVGDPNSVYKVTIKPPGGMVVTVKP  722

Query  553  TKLVFKNVGDRLRYTV  600
              L F+ +G +L + V
Sbjct  723  DTLTFRKMGQKLNFLV  738



>ref|XP_010482516.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010482517.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=779

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 129/192 (67%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP AIKSALMTTAY HDNT  P+ DA G   S
Sbjct  552  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAPS  611

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PGLVYDI P DY  FLC+ D +  Q++   K  N +C   L+ 
Sbjct  612  SPYDHGAGHIDPLKAIDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRSCKHTLAK  671

Query  397  NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF ++  V+     R +TNVG     Y+V++      +VTV+P  L F
Sbjct  672  NPGNLNYPAISALFPENTRVKSITLRRTVTNVGPHIASYKVSVSPFKGASVTVQPKTLSF  731

Query  568  KNVGDRLRYTVT  603
             +   +L YTVT
Sbjct  732  TSKHQKLSYTVT  743



>ref|XP_006857985.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
 gb|ERN19452.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
Length=786

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 129/199 (65%), Gaps = 7/199 (4%)
 Frame = +1

Query  25   LQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPI  192
            LQ+D    +FNI+SGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY HDNT+  +
Sbjct  551  LQQDRRRVAFNILSGTSMSCPHVSGVAALLKAAHPDWSPAAIKSALMTTAYVHDNTHGSL  610

Query  193  RDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  372
            RDA  D+ S  + HG+GH++P +AL PGL+YDI P DY  FLCS+  T +Q++   K+ N
Sbjct  611  RDAATDKPSTHFDHGAGHINPSRALDPGLIYDINPQDYYEFLCSVKLTPEQLKVFSKSTN  670

Query  373  ITCAKKLSNPAQLNYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVT  543
             TC      P+ LNYP+ S +F +  +   V   R +TNVG+  + Y V I       V 
Sbjct  671  QTCRHAFRTPSDLNYPAISAVFAEKPVTSTVSVRRTVTNVGSPVSTYRVRIAPIVGADVI  730

Query  544  VKPTKLVFKNVGDRLRYTV  600
            VKP  L F     +L Y V
Sbjct  731  VKPRTLNFTEKYQKLSYEV  749



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 127/194 (65%), Gaps = 3/194 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSMSCPH+SGL ALLK AHP+WSPGAIKSALMTTAY     +  I D   
Sbjct  531  RRTEFNIISGTSMSCPHVSGLLALLKGAHPDWSPGAIKSALMTTAYAAYPGDGGILDVAT  590

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
               + P+  G+GHVDP KAL PGLVYD+   DY  FLC+L+YT  QI  + +  N TC +
Sbjct  591  GRAATPFDFGAGHVDPPKALDPGLVYDLTTEDYLDFLCALNYTPLQIARLSRLTNYTCDR  650

Query  388  -KLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
             K    + LNYPSF+V F   S  V+ TR LTNVGA GT Y+  + AP  V V V+PT L
Sbjct  651  QKAYEVSDLNYPSFAVAFATASTTVKHTRTLTNVGAPGT-YKATVSAPEGVKVVVEPTAL  709

Query  562  VFKNVGDRLRYTVT  603
             F  +G++  YTVT
Sbjct  710  TFSALGEKKNYTVT  723



>ref|XP_002272999.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
 ref|XP_010661616.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=768

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 135/204 (66%), Gaps = 10/204 (5%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    F+++SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAYT DN  SP
Sbjct  529  GLKSDNRSVLFDVLSGTSMSCPHVSGLAALLKSVHKDWSPAAIKSALMTTAYTLDNKRSP  588

Query  190  IRDAG-GDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA  366
            I D G G   + P+A+GSGHV+P KA  PGL+YDI   DY  +LCSL+YT+ QI  + + 
Sbjct  589  ISDFGSGGSSATPFAYGSGHVNPEKASKPGLIYDITTEDYLNYLCSLNYTSSQIARVSRR  648

Query  367  PNITCAKKLSN--PAQLNYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPS  531
             + TC     +  P  LNYPSF+VLF G ++  R T  R +TNVG   T Y   ++ P  
Sbjct  649  ISFTCPNDSVHLQPGDLNYPSFAVLFNGNAQKNRATYKRSVTNVGYPTTTYVAQVQEPEG  708

Query  532  VTVTVKPTKLVFKNVGDRLRYTVT  603
            V+V VKP  L FK +  +L Y V+
Sbjct  709  VSVMVKPNVLKFKELNQKLSYKVS  732



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 135/193 (70%), Gaps = 6/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRD-AGGDEL  216
            FNI+SGTSMSCPH SGLAALL+ A+P+WSP AIKSALMTTAY  DN    I+D A GDE 
Sbjct  546  FNIISGTSMSCPHASGLAALLRKAYPDWSPAAIKSALMTTAYNLDNGGRNIKDLASGDE-  604

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKK  390
            S+P+ HG+GHVDP++AL+PGLVYDI   DY  FLC++ Y  ++I   ++ P  +  CA +
Sbjct  605  SSPFVHGAGHVDPNRALNPGLVYDIDVDDYVGFLCAIGYEPRRIAVFLREPMSSTVCANR  664

Query  391  LSNPAQLNYPSFS-VLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLV  564
            ++ P +LNYPSFS VL     +V+  R + NVG +A  +YEV ++AP +V V+V P+KL 
Sbjct  665  MATPGELNYPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLE  724

Query  565  FKNVGDRLRYTVT  603
            F      L Y +T
Sbjct  725  FSAENQILSYEIT  737



>gb|KHN39620.1| Subtilisin-like protease, partial [Glycine soja]
Length=618

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 128/198 (65%), Gaps = 10/198 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH SG+AALL+ A+PEWSP AIKSALMTTAY  DN+   I+D G  + S
Sbjct  381  FNIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGNIKDLGSGKES  440

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA-----  384
            NP+ HG+GHVDP++AL+PGLVYD+   DY  FLCS+ Y   QI    + P +        
Sbjct  441  NPFIHGAGHVDPNRALNPGLVYDLDSNDYLAFLCSVGYDANQIAVFTREPAVESVCEGKV  500

Query  385  ---KKLSNPAQLNYPSFSV-LFGKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVK  549
                KL++P  LNYPSF+V L G+  +V+  R +TNVG+    +Y V + APP V V V 
Sbjct  501  GRTGKLASPGDLNYPSFAVKLGGEGDLVKYRRVVTNVGSEVDVVYTVKVNAPPGVGVGVS  560

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ LVF        + VT
Sbjct  561  PSTLVFSGENKTQAFEVT  578



>emb|CAN81091.1| hypothetical protein VITISV_040911 [Vitis vinifera]
Length=430

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 135/204 (66%), Gaps = 10/204 (5%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D+    F+++SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAYT DN  SP
Sbjct  191  GLKSDNRSVLFDVLSGTSMSCPHVSGLAALLKSVHKDWSPAAIKSALMTTAYTLDNKRSP  250

Query  190  IRD-AGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA  366
            I D   G   + P+A+GSGHV+P KA +PGL+YDI   DY  +LCS++YT+ QI  + + 
Sbjct  251  ISDXGSGGSSATPFAYGSGHVNPEKASNPGLIYDITTEDYLNYLCSVNYTSSQIARVSRR  310

Query  367  PNITCAKKLSN--PAQLNYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPS  531
             + TC     +  P  LNYPSF+VLF G ++  R T  R +TNVG   T Y   ++ P  
Sbjct  311  ISFTCPNDTVHLQPGDLNYPSFAVLFNGNAQKNRATYKRSVTNVGYPTTTYVAQVQEPEG  370

Query  532  VTVTVKPTKLVFKNVGDRLRYTVT  603
            V+V VKP  L FK +  +L Y V+
Sbjct  371  VSVMVKPNVLKFKELNQKLSYKVS  394



>gb|EYU29555.1| hypothetical protein MIMGU_mgv1a022042mg [Erythranthe guttata]
Length=720

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 135/192 (70%), Gaps = 8/192 (4%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            +FNI+SGTSMSCPH+SG+AALLK+ HP+WSP  IKSA+MTTAY  +   +PI D   ++L
Sbjct  498  AFNIISGTSMSCPHLSGVAALLKSVHPDWSPAVIKSAIMTTAYQVNLKGNPIED---EQL  554

Query  217  --SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
              +  +  GSGHV+P +A  PGLVYDI P DY  ++C L+YT QQ+  IV   N+ C+K+
Sbjct  555  QPATVFDIGSGHVNPSRADDPGLVYDILPDDYIPYVCGLNYTNQQVGIIV-GRNVDCSKE  613

Query  391  LSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
             S P AQLNYPSFS++FG S     TR LTNVG A + Y+V I +P  VTV V+P KLVF
Sbjct  614  KSIPEAQLNYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIVSPNGVTVKVEPKKLVF  672

Query  568  KNVGDRLRYTVT  603
              +GD+  Y VT
Sbjct  673  PKLGDKSSYNVT  684



>ref|XP_002864127.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40386.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 130/192 (68%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP AIKSALMTTAY HDNT  P+ DA G   S
Sbjct  513  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAPS  572

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PGLVYDI P +Y  FLC+ D +  Q++   K  N TC   L+ 
Sbjct  573  SPYDHGAGHIDPLKAIDPGLVYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRTCKHTLAK  632

Query  397  NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF ++  V+     R +TNVG   + Y+V++      +VTV+P  L F
Sbjct  633  NPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHISSYKVSVSPFKGASVTVQPKTLNF  692

Query  568  KNVGDRLRYTVT  603
             +   +L YTVT
Sbjct  693  TSKHQKLSYTVT  704



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 135/193 (70%), Gaps = 6/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRD-AGGDEL  216
            FNI+SGTSMSCPH SGLAALL+ A+P+WSP AIKSALMTTAY  DN    I+D A GDE 
Sbjct  597  FNIISGTSMSCPHASGLAALLRKAYPDWSPAAIKSALMTTAYNLDNGGRNIKDLASGDE-  655

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKK  390
            S+P+ HG+GHVDP++AL+PGLVYDI   DY  FLC++ Y  ++I   ++ P  +  CA +
Sbjct  656  SSPFVHGAGHVDPNRALNPGLVYDIDVDDYVGFLCAIGYEPRRIAVFLREPMSSTVCANR  715

Query  391  LSNPAQLNYPSFS-VLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLV  564
            ++ P +LNYPSFS VL     +V+  R + NVG +A  +YEV ++AP +V V+V P+KL 
Sbjct  716  MATPGELNYPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLE  775

Query  565  FKNVGDRLRYTVT  603
            F      L Y +T
Sbjct  776  FSAENQILSYEIT  788



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 135/193 (70%), Gaps = 7/193 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGD-EL  216
            FNI+SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAYT D   +PI DA  +  L
Sbjct  540  FNILSGTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKKRTPIADAVSETSL  599

Query  217  S-NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKK  390
            S  P+A GSGHVDP KA +PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  
Sbjct  600  SATPFAIGSGHVDPEKASNPGLIYDISTEDYLHYICSLNYNSSQIALLLRK-NYTCPSHA  658

Query  391  LSNPAQLNYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            + +P  LNYPSF+VLF  KSR + QT  R  TNVG   + Y V + AP  V+VTVKP  L
Sbjct  659  IQSPGDLNYPSFAVLFDSKSRNLIQTFKRSATNVGNPMSTYVVQVNAPSGVSVTVKPKIL  718

Query  562  VFKNVGDRLRYTV  600
             F+  G +LRY +
Sbjct  719  KFEKKGQKLRYKM  731



>ref|XP_006490276.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO65327.1| hypothetical protein CISIN_1g044578mg [Citrus sinensis]
Length=769

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 126/191 (66%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT++P++DA   E S
Sbjct  543  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHNPLKDASSYEPS  602

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            +P+ HG+GH++P KAL PGL+YDI   DY  FLCS   T  ++Q   K  N TC   ++ 
Sbjct  603  SPYDHGAGHINPVKALDPGLIYDINAQDYFDFLCSQKLTPMELQVFRKYANRTCRHSIAK  662

Query  400  PAQLNYPSFSVLFGKSRIVRQ---TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F ++  V      R +TNVG   + Y V +     V + V+P KL F 
Sbjct  663  PGDLNYPAISVVFPETANVSALTLRRTVTNVGPPVSNYHVVVSPFKGVAIKVEPQKLHFT  722

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  723  KKYQKLSYKIT  733



>ref|XP_006421788.1| hypothetical protein CICLE_v10004381mg [Citrus clementina]
 gb|ESR35028.1| hypothetical protein CICLE_v10004381mg [Citrus clementina]
Length=769

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 126/191 (66%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT++P++DA   E S
Sbjct  543  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHNPLKDASSYEPS  602

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            +P+ HG+GH++P KAL PGL+YDI   DY  FLCS   T  ++Q   K  N TC   ++ 
Sbjct  603  SPYDHGAGHINPVKALDPGLIYDINAQDYFDFLCSQKLTPMELQVFRKYANRTCRHSIAK  662

Query  400  PAQLNYPSFSVLFGKSRIVRQ---TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F ++  V      R +TNVG   + Y V +     V + V+P KL F 
Sbjct  663  PGDLNYPAISVVFPETANVSALTLRRTVTNVGPPVSNYHVVVSPFKGVAIKVEPQKLHFT  722

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  723  KKYQKLSYKIT  733



>ref|XP_009381912.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=1224

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28    QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
             ++  FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AIKSALMTT+Y  DN  + + D   
Sbjct  984   RKTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIKSALMTTSYVKDNRGTTMLDEST  1043

Query  208   DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITCA  384
                S+ + +GSGHV P +A+ PGLVYD+  TDY  FLC+L+YT Q I+AI + P +   A
Sbjct  1044  GNSSDVFDYGSGHVHPQRAIDPGLVYDLTATDYVNFLCNLNYTQQNIKAITRRPADCRGA  1103

Query  385   KKLSNPAQLNYPSFSVLFGKSRIVRQ-----TRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
             +K  +   LNYPSFS +F +    R+      R +TNVG    +Y   + AP   TVTV+
Sbjct  1104  RKAGHAGNLNYPSFSAVFVEDGAKRRMSTHFIRTVTNVGNGAAVYRAEVRAPEGSTVTVE  1163

Query  550   PTKLVFKNVGDRLRYTV  600
             PT+L F+  G +L + V
Sbjct  1164  PTELAFRRAGQKLSFLV  1180



>ref|XP_002320086.2| subtilase family protein [Populus trichocarpa]
 gb|EEE98401.2| subtilase family protein [Populus trichocarpa]
Length=769

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 127/194 (65%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FN++SGTSMSCPH+SGLAALLK+ H  WSP AIKSALMTTAY  DN  SPI DAG    +
Sbjct  541  FNVISGTSMSCPHVSGLAALLKSVHKTWSPAAIKSALMTTAYVTDNRGSPIADAGSSNSA  600

Query  220  N--PWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKK  390
            +  P+A GSGHVDP  A  PGL+YDI   DY  + CSL+YT+ QI A V   N+TC   K
Sbjct  601  SATPFAFGSGHVDPESASDPGLIYDITIEDYLNYFCSLNYTSSQI-AQVSRRNVTCPDNK  659

Query  391  LSNPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
               P  LNYPSF+V F    ++  V+  R LTNVG   + Y V +E P  V+V ++P  L
Sbjct  660  ALQPGDLNYPSFAVNFEGNARNNRVKYKRTLTNVGTPWSTYAVKVEEPNGVSVILEPKSL  719

Query  562  VFKNVGDRLRYTVT  603
             F+ +G +L Y VT
Sbjct  720  SFEKLGQKLSYNVT  733



>emb|CDX75757.1| BnaC03g38400D [Brassica napus]
Length=403

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 127/196 (65%), Gaps = 5/196 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT DN + PI D   
Sbjct  166  RRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDEPILDEST  225

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S+   +GSGHV P KA+ PGLVYDI   DY  FLC+ +YT   I  I  +  +   A
Sbjct  226  GNTSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGANIVTITRRKADCDGA  285

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            ++  +   LNYPSFSV+F   G+S++     R +TNVG   ++YEV I  P    VTV P
Sbjct  286  RRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDFDSVYEVKIRPPRGTNVTVAP  345

Query  553  TKLVFKNVGDRLRYTV  600
             KL F+ VG +L + V
Sbjct  346  EKLSFRRVGQKLSFVV  361



>ref|XP_008797372.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=796

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 129/197 (65%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHPEWSP A+KSALMTTAYT DN    + D   
Sbjct  555  RRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAVKSALMTTAYTKDNRKMTMLDEST  614

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S+ +  GSGHVDP +A+ PGL+YD++  DY  FLC+L+YT Q I++I  +A + + A
Sbjct  615  GNSSDVFDFGSGHVDPQRAMDPGLIYDVSLLDYVNFLCNLNYTQQNIRSITRRAADCSGA  674

Query  385  KKLSNPAQLNYPSFSVLF-----GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            +K  +   LNYPSF+ +F     GK       R + NV   G +Y  ++ AP   TVTV+
Sbjct  675  RKAGHAGNLNYPSFAAVFVDNGSGKRMSTHFIRTVRNVARGGAVYRASVRAPEGSTVTVE  734

Query  550  PTKLVFKNVGDRLRYTV  600
            P +LVF+  G +L + +
Sbjct  735  PKELVFRRTGQKLSFIL  751



>ref|XP_010240288.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=778

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 124/190 (65%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH++G+AALLKA+HP+WSP  IKSALMTTAY HDNT S ++DA   + S
Sbjct  553  FNILSGTSMSCPHVAGVAALLKASHPDWSPAQIKSALMTTAYVHDNTYSLLKDAATGKAS  612

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH+ P +ALSPGLVYDI   DY  FLC+ D T  Q++A  K  N+TC   LS+
Sbjct  613  TPFQHGAGHIHPLRALSPGLVYDIGQGDYLEFLCTQDLTPMQLKAFTKNSNMTCKHSLSS  672

Query  400  PAQLNYPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKN  573
            P  LNYP+ S +F     V  T  R +TNVG   + Y V +       V V+P  L F +
Sbjct  673  PGDLNYPAISAVFTDQPSVPLTVHRTVTNVGPPSSTYHVKVTKFKGADVVVEPNTLHFSS  732

Query  574  VGDRLRYTVT  603
               +L Y VT
Sbjct  733  SNQKLAYKVT  742



>ref|XP_010029506.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=780

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 130/196 (66%), Gaps = 5/196 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT DN    + D   
Sbjct  543  RKTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGETMLDEST  602

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S    +G+GHV P KA+ PGL+YD+ P DY  FLC+ +YTT  IQ +  K  + + A
Sbjct  603  GNTSTVMDYGAGHVHPQKAMDPGLIYDLTPYDYVDFLCNSNYTTANIQVVTRKKADCSGA  662

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            K+  +   LNYPS SV F   GK ++     R +TNVG A ++Y V++  P  V+VTV+P
Sbjct  663  KRAGHSGNLNYPSLSVTFQQYGKPKMSTHFIRSVTNVGDAESVYRVSVRPPKGVSVTVRP  722

Query  553  TKLVFKNVGDRLRYTV  600
             KL F+ +G +L + V
Sbjct  723  EKLAFRRIGQKLNFLV  738



>gb|EYU28634.1| hypothetical protein MIMGU_mgv1a024623mg, partial [Erythranthe 
guttata]
Length=699

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = +1

Query  31   EDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGD  210
            + +FNI+SGTSMSCPH+SG+AALL++AHP+WSP AIKSA+MTTAY  +   +PI D    
Sbjct  475  KSTFNIISGTSMSCPHLSGVAALLRSAHPDWSPAAIKSAIMTTAYQENLKGNPIEDE-SL  533

Query  211  ELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
            + +N +A GSGHV+P +A  PGLVYDI P DY  +LC L+Y  Q++  +V    + C+K+
Sbjct  534  QPANVFAIGSGHVNPSRANDPGLVYDILPDDYLQYLCGLNYPNQEVSILV-GRKVDCSKE  592

Query  391  LSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
             S P AQLNYPSFS++ G S     TR LTNVG A + Y+V I +P  V V V+P KLVF
Sbjct  593  KSIPEAQLNYPSFSIVLG-STPQTYTRTLTNVGKANSSYDVKIVSPDGVNVKVEPKKLVF  651

Query  568  KNVGDRLRYTVT  603
              +GD+  Y+VT
Sbjct  652  PKLGDKSSYSVT  663



>gb|KHN13887.1| Subtilisin-like protease [Glycine soja]
Length=687

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 132/198 (67%), Gaps = 7/198 (4%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +E  FNI+ GTSMSCPH+SG+AALLK+ H +WSP AIKSALMTTAYT +N  +PI D   
Sbjct  455  REVLFNILWGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMAS  514

Query  208  DE--LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC  381
            D    + P+A GSGHV+P  A  PGLVYDI   DY  +LCSL+YT+ QI A++      C
Sbjct  515  DNKAFATPFAFGSGHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQI-ALLSRGKFAC  573

Query  382  AKK-LSNPAQLNYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            +KK +     LNYPSF+VLF +S +   V  TR +TNVG   + Y V ++ P  V+VTV+
Sbjct  574  SKKAVLQAGDLNYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVE  633

Query  550  PTKLVFKNVGDRLRYTVT  603
            P  L F+ VG +L Y VT
Sbjct  634  PRVLKFEKVGQKLSYKVT  651



>ref|XP_003551824.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=767

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 132/198 (67%), Gaps = 7/198 (4%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +E  FNI+ GTSMSCPH+SG+AALLK+ H +WSP AIKSALMTTAYT +N  +PI D   
Sbjct  535  REVLFNILWGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMAS  594

Query  208  DE--LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC  381
            D    + P+A GSGHV+P  A  PGLVYDI   DY  +LCSL+YT+ QI A++      C
Sbjct  595  DNKAFATPFAFGSGHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQI-ALLSRGKFAC  653

Query  382  AKK-LSNPAQLNYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            +KK +     LNYPSF+VLF +S +   V  TR +TNVG   + Y V ++ P  V+VTV+
Sbjct  654  SKKAVLQAGDLNYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVE  713

Query  550  PTKLVFKNVGDRLRYTVT  603
            P  L F+ VG +L Y VT
Sbjct  714  PRVLKFEKVGQKLSYKVT  731



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 125/197 (63%), Gaps = 10/197 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSM+CPH+SGLAALL+ AHP+WSP AIKSALMTTAY  DN+ S I D      S
Sbjct  553  FNIISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALMTTAYNSDNSGSQITDLATGNKS  612

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKKLS  396
             P  HGSGHV+P  AL PGLVYDI P DY  FLCS+ Y ++ I+  V+    + C  +  
Sbjct  613  TPLIHGSGHVNPIGALDPGLVYDIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCDSQKM  671

Query  397  NPAQLNYPSFSVLFG-------KSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKP  552
             P  LNYPSFSV+F        + R+V+  R + NVG++   +Y V +  PPSV + V P
Sbjct  672  KPGDLNYPSFSVVFNADSAVIKRGRVVKHKRVVRNVGSSKNAVYSVKVNPPPSVKINVSP  731

Query  553  TKLVFKNVGDRLRYTVT  603
            +KLVF        Y VT
Sbjct  732  SKLVFTEKNQVASYEVT  748



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 132/192 (69%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+ ALL+ A+P+WSP AIKSAL+TTAYT DN+   I+D    E S
Sbjct  538  FNIISGTSMSCPHVSGIVALLRKAYPDWSPAAIKSALVTTAYTLDNSGKNIKDLASAEES  597

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKL  393
             P+ HG+GHVDP+ AL PGLVYD+  +DY  FLC++ Y + +I   V+ P  +  C+ K+
Sbjct  598  TPFIHGAGHVDPNSALDPGLVYDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKV  657

Query  394  SNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVF  567
            S+P  LNYPSFSV+F   S +V   R + NVG++   +YEV + +P +V + V P+KLVF
Sbjct  658  SSPGNLNYPSFSVVFQSTSDVVTCKRVVKNVGSSLDAVYEVKVNSPANVDIKVSPSKLVF  717

Query  568  KNVGDRLRYTVT  603
                  L Y +T
Sbjct  718  SAENKTLSYEIT  729



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 7/193 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAYT D   +PI DA  +   
Sbjct  542  FNILSGTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKERTPIADAVSETSI  601

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKK  390
             + P+  GSGHVDP KA +PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  
Sbjct  602  SATPFGIGSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLR-KNYTCPSHV  660

Query  391  LSNPAQLNYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            L +P  LNYPSF+VLF  KSR + QT  R +TNVG   + Y V +  P  V+VTVKP  L
Sbjct  661  LKSPGDLNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKIL  720

Query  562  VFKNVGDRLRYTV  600
             F+  G +LRY +
Sbjct  721  KFQKKGQKLRYKM  733



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 128/200 (64%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   GLQED----SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL+ D    +FN++SGTSMSCPH+SGLAALLK A P WSP A+KSALMTTAY  DN  S 
Sbjct  524  GLETDGRRWNFNVISGTSMSCPHVSGLAALLKNAFPHWSPAAVKSALMTTAYDSDNNGST  583

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            I+D    + S P+  GSGHVDP++AL PGLVYDI P DY  +LC+L Y + +I       
Sbjct  584  IKDLADGKESTPFVRGSGHVDPNRALDPGLVYDIKPEDYVAYLCALGYDSVRIAVFTGGK  643

Query  370  NITC-AKKLSNPAQLNYPSFSVLFGKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVT  543
            ++ C     +    LNYPSFS++FG  + V + +R +TNVG A + Y  +I  P SV + 
Sbjct  644  SVDCRVVGFAKSGDLNYPSFSMVFGPGKTVAKFSRTVTNVGDARSAYAASINGPDSVRIR  703

Query  544  VKPTKLVFKNVGDRLRYTVT  603
            V P KLVF      L Y+VT
Sbjct  704  VDPEKLVFCAQNQSLSYSVT  723



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 7/193 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAYT D   +PI DA  +   
Sbjct  540  FNILSGTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKERTPIADAVSETSI  599

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKK  390
             + P+  GSGHVDP KA +PGL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  
Sbjct  600  SATPFGIGSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLR-KNYTCPSHV  658

Query  391  LSNPAQLNYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            L +P  LNYPSF+VLF  KSR + QT  R +TNVG   + Y V +  P  V+VTVKP  L
Sbjct  659  LKSPGDLNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKIL  718

Query  562  VFKNVGDRLRYTV  600
             F+  G +LRY +
Sbjct  719  KFQKKGQKLRYKM  731



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 128/198 (65%), Gaps = 10/198 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH SG+AALL+ A+PEWSP AIKSALMTTAY  DN+   I+D G  + S
Sbjct  536  FNIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGNIKDLGSGKES  595

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA-----  384
            NP+ HG+GHVDP++AL+PGLVYD+   DY  FLCS+ Y   QI    + P +        
Sbjct  596  NPFIHGAGHVDPNRALNPGLVYDLDSNDYLAFLCSVGYDANQIAVFTREPAVESVCEGKV  655

Query  385  ---KKLSNPAQLNYPSFSV-LFGKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVK  549
                KL++P  LNYPSF+V L G+  +V+  R +TNVG+    +Y V + APP V V V 
Sbjct  656  GRTGKLASPGDLNYPSFAVKLGGEGDLVKYRRVVTNVGSEVDVVYTVKVNAPPGVGVGVS  715

Query  550  PTKLVFKNVGDRLRYTVT  603
            P+ LVF        + VT
Sbjct  716  PSTLVFSGENKTQAFEVT  733



>ref|XP_006280041.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
 gb|EOA12939.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
Length=779

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 128/192 (67%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP A+KSALMTTAY HDNT  P+ DA G   S
Sbjct  552  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNTLKPLSDASGAAPS  611

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PGLVYDI P DY  FLC+ D +  Q++   K  N TC   L+ 
Sbjct  612  SPYDHGAGHIDPLKAMDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRTCKHTLAK  671

Query  397  NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF ++  V+     R + NVG   + Y+V +      +VTV+P  L F
Sbjct  672  NPGNLNYPAISALFPENTRVKSMTLRRTVINVGPHISSYKVFVSPFKGASVTVQPKTLNF  731

Query  568  KNVGDRLRYTVT  603
             +   +L YTVT
Sbjct  732  TSKHQKLSYTVT  743



>ref|XP_002321861.2| subtilase family protein [Populus trichocarpa]
 gb|EEF05988.2| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 123/190 (65%), Gaps = 3/190 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT++P++DA     S
Sbjct  551  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHNPLKDASATTPS  610

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P KAL PGL+YDI P DY  FLC+   T  Q++   K  N +C   L+N
Sbjct  611  TPYDHGAGHINPMKALDPGLIYDIEPQDYFDFLCTQKLTPTQLKVFGKYANRSCRHSLAN  670

Query  400  PAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F      +++   R +TNVG   + Y   I      TV V+P  L F 
Sbjct  671  PGDLNYPAISVVFPDDTSIKVLTLHRTVTNVGLPTSKYHAVISPFKGATVKVEPEILNFT  730

Query  571  NVGDRLRYTV  600
                +L Y +
Sbjct  731  MKNQKLSYKI  740



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 121/193 (63%), Gaps = 7/193 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLK+ H +WSP AIKSALMTTAY  DN  +PI D      +
Sbjct  544  FNIISGTSMSCPHVSGIAALLKSKHKDWSPAAIKSALMTTAYVADNKGTPILDVASGSSA  603

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LS  396
             P+  GSGH DP +A  PGL+YDI+P DY  +LCSL YT  QI   V   N TC K  + 
Sbjct  604  TPFGLGSGHADPERASDPGLIYDISPKDYIYYLCSLKYTDSQISGFVY--NFTCPKDAIM  661

Query  397  NPAQLNYPSFSVLFGKSRIVRQT----RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
             P  LNYPSF V F  S     T    R +TNVG   + Y+V +E P  V+V V P  L 
Sbjct  662  QPGDLNYPSFVVNFKSSAAENITLTYHRTVTNVGTPKSTYDVLVEEPEGVSVVVTPKVLT  721

Query  565  FKNVGDRLRYTVT  603
            F  +G++L Y VT
Sbjct  722  FNMLGEKLSYKVT  734



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 128/193 (66%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL+ A+P WS  AIKSAL+TTAYT DN    I D G  E S
Sbjct  576  FNIISGTSMSCPHVSGIAALLRKAYPNWSIAAIKSALITTAYTLDNAGKKINDLGTGEES  635

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP---NITCAKK  390
             P+ HG+GHVDP++AL+PGLVYD+   DY  FLCS+ Y+ +QI   V  P   +I     
Sbjct  636  TPFVHGAGHVDPNRALNPGLVYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDICTRNS  695

Query  391  LSNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            L++P  LNYPSFSV+    + +V+  R  TNVGA A  +YEV + AP  V ++V+P KLV
Sbjct  696  LASPGDLNYPSFSVVLSSDQGLVKYKRIATNVGADADAVYEVTVNAPAGVEISVEPRKLV  755

Query  565  FKNVGDRLRYTVT  603
            F        Y VT
Sbjct  756  FSAENQTQSYEVT  768



>ref|XP_007139243.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 ref|XP_007139244.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11237.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11238.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
Length=770

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 132/194 (68%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SG+AALLK+ H +WSP AIKSALMTT+YT +N  +PI D   +   
Sbjct  542  FNILSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTSYTLNNKGAPISDMASNNSS  601

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-  390
            L+ P+  GSGHV+P  A  PGLVYDI+  DY  + CS++YT+ QI A++      C+KK 
Sbjct  602  LATPFVFGSGHVNPVSASDPGLVYDISTKDYLNYFCSINYTSSQI-ALLSRRKFVCSKKA  660

Query  391  LSNPAQLNYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            +     LNYPSF+VLFG+S     V   R +TNVG + + Y V +E P  V+V+V+P KL
Sbjct  661  VLQAGDLNYPSFAVLFGRSAFNASVTYMRVVTNVGKSKSSYAVKVEQPNGVSVSVEPRKL  720

Query  562  VFKNVGDRLRYTVT  603
             F+ +G +L Y VT
Sbjct  721  KFEKLGQKLSYNVT  734



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH++G+AAL+++AHP W+P AIKSALMT++   DN  SPI D+     +
Sbjct  542  FNIISGTSMSCPHVAGIAALIRSAHPAWTPAAIKSALMTSSALFDNRKSPISDSITALPA  601

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            +  A G+GHV+P+ AL PGLVYD+   DY  FLCSL+YT + IQ + K    +C K  S 
Sbjct  602  DALAMGAGHVNPNAALDPGLVYDLGIDDYVSFLCSLNYTAKHIQILTKNAT-SCPKLRSR  660

Query  400  PAQLNYPSFSVLFGKSRIVRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNV  576
            P  LNYPSFSV+F    +VR TR  +TNVG A ++YE+A+E+P +V V V+P  L F   
Sbjct  661  PGDLNYPSFSVVFKPRSLVRVTRRTVTNVGGAPSVYEMAVESPENVNVIVEPRTLAFTKQ  720

Query  577  GDRLRYTV  600
             ++  YTV
Sbjct  721  NEKATYTV  728



>ref|XP_010919194.1| PREDICTED: subtilisin-like protease isoform X1 [Elaeis guineensis]
Length=774

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +  +FNI+SGTSMSCPH+SGLAALLK  H +WSP AIKSALMTTA T +N N  + D   
Sbjct  547  RRTNFNIISGTSMSCPHVSGLAALLKGVHRDWSPAAIKSALMTTASTLNNKNGSVVDVSS  606

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--  381
             + + P+A GSGHVDP +A +PGLVYDI+P DY  +LCSL+YT+ Q+  + +  N +C  
Sbjct  607  GQPATPFAFGSGHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARK-NYSCPN  665

Query  382  AKKLSNPAQLNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
             + L N   LNYPSFSVLF +      V QTR +TNVG A   Y V +  P  VT+ V P
Sbjct  666  NRILGNIRDLNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDP  725

Query  553  TKLVFKNVGDRLRYTVT  603
             +L F  +G +L Y V+
Sbjct  726  KELDFVELGQKLSYKVS  742



>emb|CDX97539.1| BnaA05g25400D [Brassica napus]
Length=481

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 126/193 (65%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ AHP+WSP AIKSAL+TTAY  +N+  PI D    + S
Sbjct  242  FNIISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDTENSGEPIEDLATGKSS  301

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA---KK  390
            N + HG+GHVDP+KAL+PGLVYDI   DY  FLC++ Y    I   ++ P +  A    K
Sbjct  302  NSFIHGAGHVDPNKALNPGLVYDIDVKDYVAFLCAVGYEFPGILVFLQDPTLYNACETSK  361

Query  391  LSNPAQLNYPSFSVLFGKS-RIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            L     LNYPSFSV+FG +  +V+  R + NVG     +YEV +++P +V + V P KL 
Sbjct  362  LRTAGDLNYPSFSVVFGSTVDVVKYRRVVKNVGTNVDAVYEVGVKSPANVEIDVSPRKLA  421

Query  565  FKNVGDRLRYTVT  603
            F      L Y VT
Sbjct  422  FSKGEGELEYEVT  434



>ref|XP_006407103.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
 gb|ESQ48556.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
Length=779

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 131/196 (67%), Gaps = 5/196 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT DN + P+RD   
Sbjct  542  RRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDEPMRDEST  601

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S+   +GSGHV P KA+ PGLVYDI   DY  FLC+ +YT   I  I  +  +   A
Sbjct  602  GNTSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGANIVTITRRKADCDGA  661

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            ++  +   LNYPSFSV+F   G+S++     R +TNVG + ++YEV I  P   TVTV+P
Sbjct  662  RRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEVKIRPPRGTTVTVEP  721

Query  553  TKLVFKNVGDRLRYTV  600
             KL F+ VG +L + V
Sbjct  722  EKLSFRRVGQKLNFVV  737



>gb|EMT32146.1| Subtilisin-like protease [Aegilops tauschii]
Length=229

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 121/185 (65%), Gaps = 6/185 (3%)
 Frame = +1

Query  64   MSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELSNPWAHGSG  243
            M+CPH+SGLAALLKAAHP WSP AIKSALMTTAYT DN+N  + D    ++++ +  G+G
Sbjct  1    MACPHVSGLAALLKAAHPTWSPAAIKSALMTTAYTRDNSNGTMTDESTGKVADVFDFGAG  60

Query  244  HVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCAKKLSNPAQLNYP  420
            HVDP +A+ PGLVYDIAP DY  FLC+L+YT Q I+AI  +  +   A++  +   LNYP
Sbjct  61   HVDPMRAMDPGLVYDIAPLDYLNFLCNLNYTEQNIRAITRRQADCRGARRAGHAGNLNYP  120

Query  421  SFSVLF----GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  585
            S S  F     K+R+     R +TNVG   + Y   + AP    VTV+P +L F+  G +
Sbjct  121  SLSATFVADGAKARMRTHFIRTVTNVGGGRSAYRATVRAPEGCNVTVRPDRLAFRRDGQK  180

Query  586  LRYTV  600
            L +TV
Sbjct  181  LSFTV  185



>ref|XP_010919195.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
Length=767

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 130/197 (66%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +  +FNI+SGTSMSCPH+SGLAALLK  H +WSP AIKSALMTTA T +N N  + D   
Sbjct  540  RRTNFNIISGTSMSCPHVSGLAALLKGVHRDWSPAAIKSALMTTASTLNNKNGSVVDVSS  599

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--  381
             + + P+A GSGHVDP +A +PGLVYDI+P DY  +LCSL+YT+ Q+  + +  N +C  
Sbjct  600  GQPATPFAFGSGHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARK-NYSCPN  658

Query  382  AKKLSNPAQLNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
             + L N   LNYPSFSVLF +      V QTR +TNVG A   Y V +  P  VT+ V P
Sbjct  659  NRILGNIRDLNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDP  718

Query  553  TKLVFKNVGDRLRYTVT  603
             +L F  +G +L Y V+
Sbjct  719  KELDFVELGQKLSYKVS  735



>gb|EEC83669.1| hypothetical protein OsI_29445 [Oryza sativa Indica Group]
Length=705

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 128/197 (65%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPHISGLAALLKAAHP WSP AIKSALMTTAY  DN+N  + D   
Sbjct  464  RRTEFNILSGTSMACPHISGLAALLKAAHPTWSPAAIKSALMTTAYIKDNSNGTMVDEST  523

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITCA  384
              +++ +  G+GHVDP +A+ PGLVYDI P DY  FLC+L+YT Q I+AI + P +   A
Sbjct  524  GVVADVFDFGAGHVDPMRAMDPGLVYDITPVDYVNFLCNLNYTEQNIRAITRRPADCRGA  583

Query  385  KKLSNPAQLNYPSFSVLFGK--SRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++  +   LNYPS S  F    +R   +T   R +TNVG    +Y   + +P    VTV+
Sbjct  584  RRAGHAGNLNYPSMSATFAADGTRATMKTHFIRTVTNVGGGRAVYRATVRSPEGCAVTVQ  643

Query  550  PTKLVFKNVGDRLRYTV  600
            P +L F+  G +L +TV
Sbjct  644  PRQLAFRRDGQKLSFTV  660



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 126/192 (66%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL   +P+WSP AIKSALMTTAY  DN+   I+D    E S
Sbjct  544  FNIISGTSMSCPHVSGIAALLHKTYPDWSPAAIKSALMTTAYNLDNSGEIIKDLSTGEES  603

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITC-AKKL  393
             P+  G+GHVDP+KAL PGL+YD    DY  FLC++ Y+TQQI    +    + C A  L
Sbjct  604  TPFVRGAGHVDPNKALDPGLIYDSQVEDYLAFLCAIGYSTQQIALFTRDETTVNCSAMTL  663

Query  394  SNPAQLNYPSFSVLFGK-SRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVF  567
            ++P  LNYP+FSV+F   S IV  +R + NVG     +YE  I  PP V VTV P+KLVF
Sbjct  664  ASPGDLNYPAFSVVFSSTSDIVTFSRVVRNVGGPDDAVYEAEISGPPGVNVTVAPSKLVF  723

Query  568  KNVGDRLRYTVT  603
              V   L Y +T
Sbjct  724  DAVDQSLSYEIT  735



>gb|EYU29564.1| hypothetical protein MIMGU_mgv1a023796mg [Erythranthe guttata]
Length=738

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 138/192 (72%), Gaps = 8/192 (4%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            +FN++SGTSMSCPH+SG+AALLK+ HP+WSP AIKSA+MTTA + +   +PI D   ++L
Sbjct  516  TFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADSVNLQGNPIED---EQL  572

Query  217  --SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
              +N +A GSGHV+P +A  PGLVYDI P DY  +LC L+YT Q++  IV A  + C+K+
Sbjct  573  QPANVFAIGSGHVNPSRANDPGLVYDIMPDDYIPYLCGLNYTNQEVGIIV-ARKVDCSKE  631

Query  391  LSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
             + P AQLNYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF
Sbjct  632  KTIPEAQLNYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIGSPDGVNVKVEPKKLVF  690

Query  568  KNVGDRLRYTVT  603
              +GD+  Y+VT
Sbjct  691  PKLGDKSSYSVT  702



>ref|XP_011041660.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=778

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 122/190 (64%), Gaps = 3/190 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT+ P++DA     S
Sbjct  551  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHHPLKDASATTPS  610

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P KAL PGL+YDI P DY  FLC+   T  Q++   K  N +C   L+N
Sbjct  611  TPYDHGAGHINPMKALDPGLIYDIEPQDYFDFLCTQKLTPTQLKVFGKYANRSCRHSLAN  670

Query  400  PAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F      +++   R +TNVG   + Y   I      TV V+P  L F 
Sbjct  671  PGDLNYPAISVVFPDDTSIKVLTLHRTVTNVGLPTSKYHAVISPFKGATVKVEPEILNFT  730

Query  571  NVGDRLRYTV  600
                +L Y +
Sbjct  731  MKNQKLSYKI  740



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 127/194 (65%), Gaps = 3/194 (2%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSMSCPH+SGL ALLK AHP+WSPGAIKSALMTTAY     +  I D   
Sbjct  531  RRTEFNIISGTSMSCPHVSGLLALLKGAHPDWSPGAIKSALMTTAYAAYPGDGGILDVAT  590

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
               + P+  G+GHVDP KAL PGLVY++   DY  FLC+L+YT  QI  + +  N TC +
Sbjct  591  GRAATPFDFGAGHVDPPKALDPGLVYNLTNEDYLDFLCALNYTPLQIARLSRLTNYTCDR  650

Query  388  -KLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
             K    + LNYPSF+V F   S  V+ TR LTNVGA GT Y+  + AP  V V V+PT L
Sbjct  651  QKAYEVSDLNYPSFAVAFATASTTVKHTRTLTNVGAPGT-YKATVSAPEDVKVVVEPTAL  709

Query  562  VFKNVGDRLRYTVT  603
             F  +G++  YTVT
Sbjct  710  TFAALGEKKNYTVT  723



>ref|XP_004308141.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=778

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 123/191 (64%), Gaps = 6/191 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLK+ HPEWSP AIKSALMTTAY HDNTN P+ DA   E+S
Sbjct  555  FNILSGTSMSCPHVSGIAALLKSRHPEWSPAAIKSALMTTAYVHDNTNKPLEDASRAEIS  614

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P KAL PGLVYDI P DY  FLC+   T  Q++      N TC   L+N
Sbjct  615  TPFDHGAGHINPSKALDPGLVYDIQPQDYLEFLCTQKLTPMQLKVF---SNRTCRHTLAN  671

Query  400  PAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
               LNYP+ SV+F ++    ++   R +TNVG A + Y   +       V V+P  L F 
Sbjct  672  AGDLNYPAISVVFVENTNVSVLTVHRTVTNVGPAVSSYHAIVSPFKGAYVKVEPRILKFT  731

Query  571  NVGDRLRYTVT  603
                +L Y VT
Sbjct  732  KANQKLSYKVT  742



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH SGLAALLK AHP+W+P A+KSALMTTAY  DN+     D    + S
Sbjct  535  FNIISGTSMSCPHASGLAALLKRAHPKWTPAAVKSALMTTAYNLDNSGKVFTDLATGQES  594

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-L  393
             P+ HGSGHVDP++AL PGLVYDI  +DY  FLCS+ Y    +   V+ +  + C+++ L
Sbjct  595  TPFVHGSGHVDPNRALDPGLVYDIETSDYVNFLCSIGYDGDDVAVFVRDSSRVNCSEQNL  654

Query  394  SNPAQLNYPSFSVLF-GKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            + P  LNYPSFSV+F G+S  +V+  R + NVG     +YEV + AP SV V+V P KLV
Sbjct  655  ATPGDLNYPSFSVVFTGESNGVVKYKRVMKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLV  714

Query  565  FKNVGDRLRYTVT  603
            F      L Y ++
Sbjct  715  FSEEKKSLSYEIS  727



>ref|XP_004140477.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=739

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 126/194 (65%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG--GDE  213
            FNI+SGTSMSCPH+SGLAAL+K+ H +WSP AIKSALMTTAY  DN    I D G     
Sbjct  511  FNIISGTSMSCPHVSGLAALVKSVHKDWSPAAIKSALMTTAYVTDNKKHLISDVGRASGG  570

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-  390
             ++ +A GSGHVDP KA  PGL+YDIAP DY  +LCSL YT+ QI ++V     TC+ K 
Sbjct  571  PADSFAFGSGHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQI-SLVSRGKFTCSSKN  629

Query  391  -LSNPAQLNYPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
              S P  LNYPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL
Sbjct  630  TFSQPGDLNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKL  689

Query  562  VFKNVGDRLRYTVT  603
             F  +G++L Y V+
Sbjct  690  NFVKLGEKLSYKVS  703



>ref|NP_001061952.1| Os08g0452100 [Oryza sativa Japonica Group]
 dbj|BAD08783.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF23866.1| Os08g0452100 [Oryza sativa Japonica Group]
 gb|EAZ42947.1| hypothetical protein OsJ_27537 [Oryza sativa Japonica Group]
Length=796

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 128/197 (65%), Gaps = 6/197 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPHISGLAALLKAAHP WSP AIKSALMTTAY  DN+N  + D   
Sbjct  555  RRTEFNILSGTSMACPHISGLAALLKAAHPTWSPAAIKSALMTTAYIKDNSNGTMVDEST  614

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITCA  384
              +++ +  G+GHVDP +A+ PGLVYDI P DY  FLC+L+YT Q I+AI + P +   A
Sbjct  615  GVVADVFDFGAGHVDPMRAMDPGLVYDITPVDYVNFLCNLNYTEQNIRAITRRPADCRGA  674

Query  385  KKLSNPAQLNYPSFSVLFGK--SRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            ++  +   LNYPS S  F    +R   +T   R +TNVG    +Y   + +P    VTV+
Sbjct  675  RRAGHAGNLNYPSMSATFAADGTRATMKTHFIRTVTNVGGGRAVYRATVRSPEGCAVTVQ  734

Query  550  PTKLVFKNVGDRLRYTV  600
            P +L F+  G +L +TV
Sbjct  735  PRQLAFRRDGQKLSFTV  751



>gb|EAY95232.1| hypothetical protein OsI_17050 [Oryza sativa Indica Group]
Length=462

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 123/190 (65%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH++G+AAL+KA+HP+WSP  IKSALMTTAY HDNT  P++DA   + S
Sbjct  237  FNILSGTSMSCPHVAGVAALIKASHPDWSPAQIKSALMTTAYVHDNTYRPMKDAATGKAS  296

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH+ P +AL+PGLVYDI   DY  FLC+   T  Q++   K  N+TC    S+
Sbjct  297  TPFEHGAGHIHPVRALTPGLVYDIGQADYLEFLCTQHMTPMQLRTFTKNSNMTCRHTFSS  356

Query  400  PAQLNYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKN  573
             + LNYP+ SV+F    S+ +   R +TNVG   + Y V +       V V+P  L F +
Sbjct  357  ASDLNYPAISVVFADQPSKALTVRRTVTNVGPPSSTYHVKVTKFKGADVVVEPNTLHFVS  416

Query  574  VGDRLRYTVT  603
               +L Y VT
Sbjct  417  TNQKLSYKVT  426



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ A+P WSP A+KSALMTTAY  DN+   I D    + S
Sbjct  563  FNIISGTSMSCPHVSGLAALLRNAYPSWSPAAVKSALMTTAYYLDNSGKNITDLATGKQS  622

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITC-AKKL  393
            +P+ HGSGHVDP+KAL+PGLVYDI   DY   LC++ Y + +I   +K P  I C AK L
Sbjct  623  SPFVHGSGHVDPNKALNPGLVYDINANDYISLLCAMGYNSTRIAIFLKEPTTIDCAAKNL  682

Query  394  SNPAQLNYPSFSVLFGKSR-IVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            S    LNYPSFSV+F   + +V+ TR + NVG +A  +YEV++ AP +V V+V P KL F
Sbjct  683  STAGNLNYPSFSVVFESGKNVVKYTRVVKNVGSSADAVYEVSVNAPLNVDVSVSPRKLEF  742

Query  568  KNVGDRLRYTVT  603
                  L Y ++
Sbjct  743  SADKQTLSYEIS  754



>ref|XP_004171629.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=769

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 126/194 (65%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG--GDE  213
            FNI+SGTSMSCPH+SGLAAL+K+ H +WSP AIKSALMTTAY  DN    I D G     
Sbjct  541  FNIISGTSMSCPHVSGLAALVKSVHKDWSPAAIKSALMTTAYVTDNKKHLISDVGRASGG  600

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-  390
             ++ +A GSGHVDP KA  PGL+YDIAP DY  +LCSL YT+ QI ++V     TC+ K 
Sbjct  601  PADSFAFGSGHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQI-SLVSRGKFTCSSKN  659

Query  391  -LSNPAQLNYPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
              S P  LNYPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL
Sbjct  660  TFSQPGDLNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKL  719

Query  562  VFKNVGDRLRYTVT  603
             F  +G++L Y V+
Sbjct  720  NFVKLGEKLSYKVS  733



>ref|XP_004973598.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=811

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 128/201 (64%), Gaps = 10/201 (5%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP WSP AIKSALMTTAY  DN+N  + D   
Sbjct  565  RRTEFNILSGTSMACPHVSGLAALLKAAHPTWSPAAIKSALMTTAYVRDNSNGTMVDEST  624

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
              ++  +  G+GHVDP +A+ PGLVYDI+P DY  FLC+L+YT Q I+AI  +  +   A
Sbjct  625  GAVAGAFDFGAGHVDPMRAMDPGLVYDISPMDYVSFLCNLNYTEQNIRAITRRQADCRGA  684

Query  385  KKLSNPAQLNYPSFSVLF-------GKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVT  537
            ++  +   LNYPS S  F       G++  +R    R  TNVG    +Y  ++ AP    
Sbjct  685  RRAGHAGNLNYPSLSATFVAAEAGTGRATTMRTHFIRRATNVGGGPAVYRASVSAPEGCN  744

Query  538  VTVKPTKLVFKNVGDRLRYTV  600
            VTV+P +L F+  G RL +TV
Sbjct  745  VTVQPRQLAFRRDGQRLSFTV  765



>ref|XP_002510884.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51486.1| Cucumisin precursor, putative [Ricinus communis]
Length=775

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 121/191 (63%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT  P++DA  D  S
Sbjct  549  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTQKPLQDASTDAPS  608

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            +P+ HG+GH++P KAL PGL+YDI   DY  FLC+   +  Q++   K  N TC K L +
Sbjct  609  SPYDHGAGHINPLKALDPGLIYDIEAQDYFEFLCTQRLSITQLRVFGKYANRTCQKSLLS  668

Query  400  PAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ S +F  S  +      R +TNVG   + Y   +      TV ++P  L F 
Sbjct  669  PGDLNYPAISAVFTDSNTISSLTLHRTVTNVGPPTSTYHAVVSRFKGATVKIEPKTLKFT  728

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  729  AKNQKLSYRIT  739



>emb|CDY00497.1| BnaA10g07760D [Brassica napus]
Length=775

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP A+KSALMTTAY HDN   P+ DA G E S
Sbjct  547  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLEPLTDAAGAEPS  606

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PGLVYDI P +Y  FLC+ + +  Q++   K  N +C   L+ 
Sbjct  607  SPYDHGAGHIDPLKAIDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNRSCRHSLAG  666

Query  397  -NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
             NP  LNYP+ S LF ++  V+     R +TNVG   + Y+V++      TVTV+P  L 
Sbjct  667  NNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVSSYKVSVSPFKGATVTVQPKTLN  726

Query  565  FKNVGDRLRYTVT  603
            F     +L YTVT
Sbjct  727  FTTKHQKLSYTVT  739



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ AHP+WSP AIKSAL+TTAY  +N+  PI D    E S
Sbjct  537  FNIISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDTENSGEPIEDLATGESS  596

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA---KK  390
            N + HG+GHVDP+KAL+PGLVYD+   DY  FLC++ Y    I   ++ P++  A    K
Sbjct  597  NSFIHGAGHVDPNKALNPGLVYDVDAKDYVAFLCAVGYEFPGILVFLQDPSLYDACETSK  656

Query  391  LSNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            L     LNYPSFSV+FG +  +V+  R + NVG+    +YEV ++AP +V + V P+KL 
Sbjct  657  LRTAGDLNYPSFSVVFGSNDGVVKYRRVVKNVGSNVDAVYEVGVKAPANVEIDVSPSKLA  716

Query  565  FKNVGDRLRYTVT  603
            F      + Y VT
Sbjct  717  FSKETREMEYEVT  729



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 128/193 (66%), Gaps = 4/193 (2%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            +FNI+SGTSMSCPH+SGLAALL  A+P WSP AIKSALMTTAY+ DN+ + I+D      
Sbjct  531  NFNIISGTSMSCPHVSGLAALLIKAYPNWSPAAIKSALMTTAYSLDNSGNTIKDLATGVE  590

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN--ITCAKK  390
            S+P+ +G+GHVDP+ AL PGLVYDI   DY  FLCS+ Y +++I   V+ P     C  K
Sbjct  591  SSPFVYGAGHVDPNIALMPGLVYDIDDGDYVAFLCSIGYDSKRIAIFVREPTGPDVCEGK  650

Query  391  LSNPAQLNYPSFSVLF-GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLV  564
            L+ P  LNYPSFSV+F     +V+  R + NVG +   +YE  + APP V ++V P+KL 
Sbjct  651  LATPGNLNYPSFSVVFDSNDHVVKYKRTVKNVGPSVDAVYEAKVNAPPGVEISVSPSKLE  710

Query  565  FKNVGDRLRYTVT  603
            F      L Y +T
Sbjct  711  FSAENQTLSYEIT  723



>gb|KCW56428.1| hypothetical protein EUGRSUZ_I02156 [Eucalyptus grandis]
Length=897

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 130/196 (66%), Gaps = 5/196 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            ++  FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT DN    + D   
Sbjct  660  RKTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGETMLDEST  719

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S    +G+GHV P KA+ PGL+YD+ P DY  FLC+ +YTT  IQ +  K  + + A
Sbjct  720  GNTSTVMDYGAGHVHPQKAMDPGLIYDLTPYDYVDFLCNSNYTTANIQVVTRKKADCSGA  779

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            K+  +   LNYPS SV F   GK ++     R +TNVG A ++Y V++  P  V+VTV+P
Sbjct  780  KRAGHSGNLNYPSLSVTFQQYGKPKMSTHFIRSVTNVGDAESVYRVSVRPPKGVSVTVRP  839

Query  553  TKLVFKNVGDRLRYTV  600
             KL F+ +G +L + V
Sbjct  840  EKLAFRRIGQKLNFLV  855



>ref|XP_009107228.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP A+KSALMTTAY HDN   P+ DA G E S
Sbjct  547  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLEPLTDAAGAEPS  606

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PGLVYDI P +Y  FLC+ + +  Q++   K  N +C   L+ 
Sbjct  607  SPYDHGAGHIDPLKAIDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNRSCRHSLAG  666

Query  397  -NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
             NP  LNYP+ S LF ++  V+     R +TNVG   + Y+V++      TVTV+P  L 
Sbjct  667  NNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVSSYKVSVSPFKGATVTVQPKTLN  726

Query  565  FKNVGDRLRYTVT  603
            F     +L YTVT
Sbjct  727  FTTKHQKLSYTVT  739



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 125/197 (63%), Gaps = 10/197 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSM+CPH+SGLAALL+ AHP+WSP AIKSALMTTAY  DN+ S I D      S
Sbjct  533  FNIISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALMTTAYNSDNSGSQITDLASGNKS  592

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKKLS  396
             P  HGSGHV+P  AL PGLVYDI P DY  FLCS+ Y ++ I+  V+    + C  +  
Sbjct  593  TPLIHGSGHVNPIGALDPGLVYDIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCDSQKM  651

Query  397  NPAQLNYPSFSVLFG-------KSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKP  552
             P  LNYPSFSV+F        +  +V+  R + NVG++   +Y V + +PPSV + V P
Sbjct  652  KPGDLNYPSFSVVFNADSAVIKRGGVVKHKRVVRNVGSSKDAVYSVKVNSPPSVKINVSP  711

Query  553  TKLVFKNVGDRLRYTVT  603
            +KLVF        Y VT
Sbjct  712  SKLVFTEKNQVASYEVT  728



>gb|EMT22975.1| Subtilisin-like protease [Aegilops tauschii]
Length=432

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 127/172 (74%), Gaps = 7/172 (4%)
 Frame = +1

Query  106  AAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELSN---PWAHGSGHVDPHKALSPG  276
            AAHP+WSP AIKSALMTTAYT DNT SP+ DA G   +    PW+ GSGHVDP KALSPG
Sbjct  156  AAHPDWSPSAIKSALMTTAYTVDNTGSPLLDAAGANATATATPWSFGSGHVDPVKALSPG  215

Query  277  LVYDIAPTDYTMFLCSLDYTT-QQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFG--KS  447
            LVYD +  DY  FLC++   + +Q+QAI  APN TC +KLS+P  LNYPSFSV+FG  KS
Sbjct  216  LVYDTSVDDYVAFLCTVGGASPRQVQAITGAPNATCQRKLSSPGDLNYPSFSVVFGLRKS  275

Query  448  R-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTV  600
            R  VR  RELTNVGAAG +Y   +  PPS+ V+VKP +LVFK  GD+LRYTV
Sbjct  276  RSTVRYHRELTNVGAAGAVYAAKVTGPPSIAVSVKPARLVFKKAGDKLRYTV  327



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 124/186 (67%), Gaps = 10/186 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH SG+AALL+ A+PEWSP AIKSALMTTAY  DN+   I+D G  + S
Sbjct  541  FNIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGNIKDLGTGKES  600

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--------NI  375
            NP+ HG+GHVDP++AL+PGLVYD    DY  FLCS+ Y   QI    + P         +
Sbjct  601  NPFTHGAGHVDPNRALNPGLVYDSDINDYLAFLCSIGYDANQIAVFTREPAAANPCEGKV  660

Query  376  TCAKKLSNPAQLNYPSFSVLFGK-SRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVK  549
                +L++P  LNYPSFSV  G+ S +V+  R +TNVG+    +Y V + APP V VTV 
Sbjct  661  GRTGRLASPGDLNYPSFSVELGRGSDLVKYKRVVTNVGSVVDAVYTVKVNAPPGVDVTVA  720

Query  550  PTKLVF  567
            P  LVF
Sbjct  721  PNTLVF  726



>emb|CDX99895.1| BnaC09g28100D [Brassica napus]
Length=775

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 130/194 (67%), Gaps = 5/194 (3%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            +FNI+SGTSMSCPH+SG+AAL+++ HP+WSP A+KSALMTTAY HDN   P+ DA G E 
Sbjct  546  NFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLEPLTDAAGAEP  605

Query  217  SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS  396
            S+P+ HG+GH+DP KA+ PGLVYDI P +Y  FLC+ + +  Q++   K  N +C   L+
Sbjct  606  SSPYDHGAGHIDPLKAMDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNRSCRHSLA  665

Query  397  --NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
              NP  LNYP+ S LF ++  V+     R +TNVG   + Y+V++      TVTV+P  L
Sbjct  666  GNNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVSSYKVSLSPFKGATVTVQPKTL  725

Query  562  VFKNVGDRLRYTVT  603
             F     +L YTVT
Sbjct  726  NFTTKHQKLSYTVT  739



>ref|XP_011091250.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=775

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 130/193 (67%), Gaps = 7/193 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAG--GDE  213
            FNI+SGTSMSCPHISGLAALLK+ H +WSP AIKSALMTTAYTHD+ NSPI DA     +
Sbjct  546  FNIVSGTSMSCPHISGLAALLKSLHKDWSPAAIKSALMTTAYTHDSHNSPIFDAASTNSK  605

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
            ++ P+A GSGHVDP KA  PGL+YDI+  DY  +LCSL+Y + Q+ A+    N TC+   
Sbjct  606  IATPFAFGSGHVDPEKASDPGLIYDISTEDYLSYLCSLNYNSSQM-ALFAGGNFTCSPGS  664

Query  394  S-NPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
                + LNYPSF+VL     ++  V   R +TNVG   + Y V +  P  V++ V+P  L
Sbjct  665  DLQSSDLNYPSFAVLLSSNARNITVTYKRTVTNVGTPVSTYAVKVTEPEGVSIIVEPKVL  724

Query  562  VFKNVGDRLRYTV  600
             F+ +G++L Y V
Sbjct  725  KFRKLGEKLSYRV  737



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 122/191 (64%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT+ P++DA   E S
Sbjct  554  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHKPLQDASAAEAS  613

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P KAL PGLVYDI   DY  FLC+   T  Q++   K  N +C   L++
Sbjct  614  TPYDHGAGHINPRKALDPGLVYDIEAQDYLEFLCTQRLTPMQLKVFTKYSNRSCKHALAS  673

Query  400  PAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F +     ++   R +TNVG   + Y   +       V V+P  L F 
Sbjct  674  PGDLNYPAISVVFPERTNVSLLTLHRTVTNVGPPVSNYHAIVSPFKGAYVKVEPRTLKFT  733

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  734  RANQKLSYKIT  744



>ref|XP_010443668.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=779

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 126/192 (66%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP AIKSALMTTAY HDNT  P+ DA G   S
Sbjct  552  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAPS  611

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PG VYDI P DY  FLC+ D +  Q++   K  N +C   L+ 
Sbjct  612  SPYDHGAGHIDPLKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRSCKHTLAK  671

Query  397  NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF ++  V+     R +TNVG     Y+V++      +VTV P  L F
Sbjct  672  NPGNLNYPAISALFPENTRVKSMTLRRTVTNVGPHIASYKVSVSPFKGASVTVLPKTLNF  731

Query  568  KNVGDRLRYTVT  603
                 +L YTVT
Sbjct  732  TTKHQKLSYTVT  743



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 124/186 (67%), Gaps = 10/186 (5%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH SG+AALL+ A+PEWSP AIKSALMTTAY  DN+   I+D G  + S
Sbjct  573  FNIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGNIKDLGTGKES  632

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--------NI  375
            NP+ HG+GHVDP++AL+PGLVYD    DY  FLCS+ Y   QI    + P         +
Sbjct  633  NPFTHGAGHVDPNRALNPGLVYDSDINDYLAFLCSIGYDANQIAVFTREPAAANPCEGKV  692

Query  376  TCAKKLSNPAQLNYPSFSVLFGK-SRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVK  549
                +L++P  LNYPSFSV  G+ S +V+  R +TNVG+    +Y V + APP V VTV 
Sbjct  693  GRTGRLASPGDLNYPSFSVELGRGSDLVKYKRVVTNVGSVVDAVYTVKVNAPPGVDVTVA  752

Query  550  PTKLVF  567
            P  LVF
Sbjct  753  PNTLVF  758



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 130/192 (68%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALL+ A+P+WSP AIKSAL+TTAYT DN+   I+D    E S
Sbjct  536  FNIISGTSMSCPHVSGIAALLRKAYPDWSPAAIKSALVTTAYTLDNSGKNIKDLASGEES  595

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKL  393
             P+ HG+GHVDP+ AL PGLVYD+  +DY  FLC++ Y + +I   V+ P  +  C+ K+
Sbjct  596  TPFIHGAGHVDPNSALDPGLVYDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKV  655

Query  394  SNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVF  567
             +P  LNYPS SV+F   S +V   R + NVG +   +YEV + +P +V + V P+KLVF
Sbjct  656  GSPGNLNYPSISVVFQSTSDVVTYKRVVKNVGGSLDAVYEVKVNSPANVDIKVSPSKLVF  715

Query  568  KNVGDRLRYTVT  603
                  L Y +T
Sbjct  716  SAENKTLSYEIT  727



>ref|XP_010443674.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
 ref|XP_010443682.1| PREDICTED: subtilisin-like protease isoform X3 [Camelina sativa]
Length=779

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 126/192 (66%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+++ HP+WSP AIKSALMTTAY HDNT  P+ DA G   S
Sbjct  552  FNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAPS  611

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP KA+ PG VYDI P DY  FLC+ D +  Q++   K  N +C   L+ 
Sbjct  612  SPYDHGAGHIDPLKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRSCKHTLAK  671

Query  397  NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF ++  V+     R +TNVG     Y+V++      +VTV P  L F
Sbjct  672  NPGNLNYPAISALFPENTRVKSMTLRRTVTNVGPHIASYKVSVSPFKGASVTVLPKTLNF  731

Query  568  KNVGDRLRYTVT  603
                 +L YTVT
Sbjct  732  TTKHQKLSYTVT  743



>ref|XP_010059916.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=768

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 135/197 (69%), Gaps = 11/197 (6%)
 Frame = +1

Query  34   DSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGD-  210
            + FN++SGTSM+CPHI+G+AALL+  HPEWSP AI+SA+MTT+YT D+TNSPI+D G D 
Sbjct  531  NDFNLLSGTSMACPHIAGVAALLRGVHPEWSPAAIRSAMMTTSYTRDSTNSPIKDIGNDY  590

Query  211  ELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
            + ++P   G+GHVDP+KAL PGL+YD+ P DY   +C+++YT++QIQ + ++ +  C   
Sbjct  591  KPASPVGMGAGHVDPNKALDPGLIYDVTPQDYVNLMCAMNYTSKQIQMVTRSSSYNC---  647

Query  391  LSNPA-QLNYPSFSVLFGK----SRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
             SNP+  LNYPSF   FG     S +V++  R +TNVGA  + Y   +       V++ P
Sbjct  648  -SNPSLDLNYPSFIAFFGSNSSDSPMVQEFYRTVTNVGAGASTYRAEVNPMEGFKVSIVP  706

Query  553  TKLVFKNVGDRLRYTVT  603
             KL FK   ++L Y +T
Sbjct  707  DKLTFKEKYEKLSYKLT  723



>gb|EYU29364.1| hypothetical protein MIMGU_mgv1a022867mg [Erythranthe guttata]
Length=672

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 134/192 (70%), Gaps = 8/192 (4%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            +FNI+SGTSMSCPH+SG+AALLK+ HP+WSP  IKSA+MTTAY  +   +PI D   ++L
Sbjct  450  AFNIISGTSMSCPHLSGVAALLKSVHPDWSPAVIKSAIMTTAYQVNLKGNPIED---EQL  506

Query  217  --SNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
              +  +  GSGHV+P +A  PGLVYDI P DY  ++C L+YT QQ+  IV   N+ C+K+
Sbjct  507  QPATVFDIGSGHVNPSRADDPGLVYDILPDDYIPYVCGLNYTNQQVGIIV-GRNVDCSKE  565

Query  391  LSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
             S P AQLNYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P +LVF
Sbjct  566  KSIPEAQLNYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIVSPDGVIVKVEPKQLVF  624

Query  568  KNVGDRLRYTVT  603
              +GD+  Y VT
Sbjct  625  PKLGDKSSYNVT  636



>ref|XP_008234331.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=841

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 122/191 (64%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT+ P++DA   E S
Sbjct  615  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHKPLQDASAAEAS  674

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P KAL PGLVYDI   DY  FLC+   T  Q++   K  N +C   L++
Sbjct  675  TPYDHGAGHINPRKALDPGLVYDIEAQDYLEFLCTQRLTPMQLKVFTKYSNRSCKHSLAS  734

Query  400  PAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F +     ++   R +TNVG   + Y   +       V V+P  L F 
Sbjct  735  PGDLNYPAISVVFPERTNVSLLTLHRTVTNVGPPVSNYHAIVSPFKGAYVKVEPRTLKFT  794

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  795  RANQKLSYKIT  805



>ref|NP_568765.1| subtilase 1.3 [Arabidopsis thaliana]
 dbj|BAB11244.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL87307.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AED96122.1| subtilase 1.3 [Arabidopsis thaliana]
Length=780

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 128/192 (67%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AAL+K+ HP+WSP AIKSALMTTAY HDN   P+ DA G   S
Sbjct  553  FNILSGTSMSCPHVSGVAALIKSRHPDWSPAAIKSALMTTAYVHDNMFKPLTDASGAAPS  612

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-  396
            +P+ HG+GH+DP +A  PGLVYDI P +Y  FLC+ D +  Q++   K  N TC   L+ 
Sbjct  613  SPYDHGAGHIDPLRATDPGLVYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRTCKHTLAK  672

Query  397  NPAQLNYPSFSVLFGKSRIVRQT---RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVF  567
            NP  LNYP+ S LF ++  V+     R +TNVG   + Y+V++      +VTV+P  L F
Sbjct  673  NPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHISSYKVSVSPFKGASVTVQPKTLNF  732

Query  568  KNVGDRLRYTVT  603
             +   +L YTVT
Sbjct  733  TSKHQKLSYTVT  744



>ref|XP_009375850.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 126/193 (65%), Gaps = 6/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGD--E  213
            FNI+SGTSMSCPH+SGLA+LLK+ H  WSP  IKSALMTTAYT +N  SPI D G +  +
Sbjct  536  FNIISGTSMSCPHVSGLASLLKSEHNNWSPAEIKSALMTTAYTINNKRSPISDVGSNSSQ  595

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKK  390
             ++P+A GSGHVDP  A  PGLVYDI   DY ++LCSL+Y + QI       N TC    
Sbjct  596  PASPFAFGSGHVDPESAADPGLVYDITTEDYLLYLCSLNYNSSQIALFSNGVNFTCPGTS  655

Query  391  LSNPAQLNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            +     LNYPSFSV+F + R    V   R + NVG+  + Y V ++ P  V+V+V+P  L
Sbjct  656  VVQSGDLNYPSFSVIFDQDRRKTSVTYKRTVKNVGSIPSTYAVQVKEPAGVSVSVEPKTL  715

Query  562  VFKNVGDRLRYTV  600
             FK +G+++ Y V
Sbjct  716  RFKKMGEKMSYKV  728



>ref|XP_006857965.1| hypothetical protein AMTR_s00069p00175260 [Amborella trichopoda]
 gb|ERN19432.1| hypothetical protein AMTR_s00069p00175260 [Amborella trichopoda]
Length=770

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 126/193 (65%), Gaps = 6/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALLK+ H +WSP AIKSALMTTAYT DN   PI D G    +
Sbjct  545  FNIISGTSMSCPHVSGLAALLKSVHNDWSPAAIKSALMTTAYTFDNKGKPITDMGKKAQA  604

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLS  396
             P+A GSGHV+P +A +PGLVYDI+  DY  +LCSL+Y++ Q+ AI+   + TC  +K  
Sbjct  605  TPFAFGSGHVNPERATNPGLVYDISTDDYLNYLCSLNYSSSQM-AIMAGQSYTCPTQKAL  663

Query  397  NPAQLNYPSFSVLFGKSRI----VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
             P  LNYPSFS+ F         V  +R +TNVG  G+ YE  + AP  V V V P  L 
Sbjct  664  LPGDLNYPSFSLDFSNGGFNNSSVTYSRVVTNVGTQGSKYEARVVAPEGVVVKVDPLVLA  723

Query  565  FKNVGDRLRYTVT  603
            F   G++  Y VT
Sbjct  724  FGKKGEKNSYKVT  736



>ref|XP_007134944.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
 gb|ESW06938.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
Length=764

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 128/194 (66%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            +NI+SGTSMSCPH+SG+AAL+K+ H  WSP AIKSALMTTA   +N  S I D G     
Sbjct  536  YNIVSGTSMSCPHVSGIAALIKSVHKGWSPAAIKSALMTTASISNNKGSAIADYGSKNSA  595

Query  214  LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKL  393
             ++P+A GSGHV+P +A  PGLVYDI   DY  +LCSL YT+ QI A++   N  CAKK 
Sbjct  596  FADPFAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-ALLSKGNFKCAKKS  654

Query  394  S-NPAQLNYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  561
            +     LNYPSF+VLFG S +   VR  R +TNVG     Y V +E P  V+V V+PT +
Sbjct  655  ALRAGDLNYPSFAVLFGTSALNASVRYKRIVTNVGNPKISYAVKVEEPKGVSVRVEPTNI  714

Query  562  VFKNVGDRLRYTVT  603
             F+  G++L Y V+
Sbjct  715  SFRKTGEKLSYKVS  728



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALLK AHP+W+P AIKSAL+TTAY  D+  +PI D      S
Sbjct  513  FNIISGTSMSCPHVSGLAALLKKAHPDWTPAAIKSALVTTAYVVDDNGAPISDLATGGKS  572

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKL  393
            N + HG+GHVDP++AL PGLVYDI  +DY  FLC++ Y   +I     A   T   A  L
Sbjct  573  NSFVHGAGHVDPNRALDPGLVYDIQTSDYVAFLCTIGYDANRISVFTDAAYSTDCSAVGL  632

Query  394  SNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVF  567
              P  LNYPSFS +F G+  +V+  R + NVG  A  +YEV ++AP   +VTV P+KL F
Sbjct  633  GTPGNLNYPSFSAVFSGRGAVVKYKRTVKNVGLNADAVYEVEVKAPIGASVTVTPSKLTF  692

Query  568  KNVGDRLRYTV  600
                  L + V
Sbjct  693  SQNATELSFEV  703



>ref|XP_009357945.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=691

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 125/192 (65%), Gaps = 5/192 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT DN    + D      S
Sbjct  458  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRGETMLDESSGNTS  517

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCAKKLS  396
                 G+GHV P KA+ PGLVYDI   DY  FLC+ +YTT+ IQ +  K  N   AK+  
Sbjct  518  TVMDFGAGHVHPQKAMDPGLVYDITSYDYVNFLCNYNYTTKNIQTVTRKLANCNGAKRAG  577

Query  397  NPAQLNYPSFSVLF---GKSRI-VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
            +   LNYPS SV+F   GK ++     R +TNVG   ++Y+V I  P   TVTV+P +L 
Sbjct  578  HAGNLNYPSLSVVFQQYGKHKMNTHFIRTVTNVGGPKSVYQVRISPPAGTTVTVEPERLA  637

Query  565  FKNVGDRLRYTV  600
            F+ VG +L + V
Sbjct  638  FRRVGQKLNFLV  649



>ref|XP_010061844.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW90792.1| hypothetical protein EUGRSUZ_A02859 [Eucalyptus grandis]
Length=780

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 125/191 (65%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY HDNT  PI+DA     S
Sbjct  554  FNILSGTSMSCPHVSGVAALLKARHPDWSPAAIKSALMTTAYVHDNTRKPIQDASTATAS  613

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P KA+ PGLVYDI P DY  FLC+   T+ Q++   K  N +C   L+ 
Sbjct  614  TPYDHGAGHINPLKAIDPGLVYDIQPQDYFEFLCAQKLTSTQLKVFAKYANRSCHHSLAR  673

Query  400  PAQLNYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
               LNYP+ SVLF  K+ +   T  R +TNVG   + Y V +     V+V V+P+ L F 
Sbjct  674  AGDLNYPAISVLFPEKASVTSLTVQRTVTNVGPPVSNYHVVVSPIKGVSVRVEPSTLKFT  733

Query  571  NVGDRLRYTVT  603
                +L Y +T
Sbjct  734  QRHQKLTYKMT  744



>gb|KDP22364.1| hypothetical protein JCGZ_26195 [Jatropha curcas]
Length=778

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 121/190 (64%), Gaps = 3/190 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY HDNT  P+RDA  D  S
Sbjct  552  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTQKPLRDASQDVPS  611

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            +P+ HG+GH++P KAL PGL+YDI    Y  FLC+   +  Q++   K  N  C K L++
Sbjct  612  SPYDHGAGHINPMKALDPGLIYDIDAQGYFEFLCTQRLSPTQLKVFGKYANRKCQKSLAS  671

Query  400  PAQLNYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            PA LNYP+ S +F  +    IV   R +TNVG   + Y   +      TV V+P  L F 
Sbjct  672  PADLNYPAISAVFPDNTSISIVTLGRTVTNVGPPVSTYHAVVSRFKGATVKVEPKTLHFT  731

Query  571  NVGDRLRYTV  600
                RL Y +
Sbjct  732  TKNQRLSYKI  741



>gb|AAL32016.1|AF436834_1 AT3g14240/MLN21_2 [Arabidopsis thaliana]
Length=581

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 130/196 (66%), Gaps = 5/196 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SAL+TTAYT DN+  P+ D   
Sbjct  344  RRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALITTAYTVDNSGEPMMDEST  403

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S+   +GSGHV P KA+ PGLVYDI   DY  FLC+ +YT   I  I  +  +   A
Sbjct  404  GNTSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTRTNIVTITRRQADCDGA  463

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            ++  +   LNYPSFSV+F   G+S++     R +TNVG + ++YE+ I  P   TVTV+P
Sbjct  464  RRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEIKIRPPRGTTVTVEP  523

Query  553  TKLVFKNVGDRLRYTV  600
             KL F+ VG +L + V
Sbjct  524  EKLSFRRVGQKLSFVV  539



>ref|XP_010089708.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38258.1| Subtilisin-like protease [Morus notabilis]
Length=787

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 125/196 (64%), Gaps = 5/196 (3%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT DN    + D   
Sbjct  550  RRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGETVLDEST  609

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIV-KAPNITCA  384
               S     G+GHV P KA+ PGLVYDI   DY  FLC+ +YTT+ IQ I  K+ + + A
Sbjct  610  GNSSTVMDFGAGHVHPEKAIDPGLVYDITSYDYVDFLCNSNYTTKNIQVITRKSADCSGA  669

Query  385  KKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKP  552
            KK  +   LNYPS S LF   G+ ++     R +TNVG   ++Y V I  P    VTV+P
Sbjct  670  KKAGHAGNLNYPSLSALFQQYGRHKMSTHFIRTVTNVGDPNSVYRVTISPPSGTVVTVEP  729

Query  553  TKLVFKNVGDRLRYTV  600
             KL F+ VG RL + V
Sbjct  730  EKLAFRRVGQRLNFLV  745



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 127/191 (66%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKS+LMTTAY HDNT +P++DA   + S
Sbjct  556  FNILSGTSMSCPHVSGVAALLKAKHPEWSPAAIKSSLMTTAYIHDNTRNPLKDASTGKPS  615

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
            NP+ HG+GH++P KAL PGL+YD+   DY  FLC+   T  Q++   K+ N +C   L+N
Sbjct  616  NPFGHGAGHLNPLKALDPGLIYDMGVQDYFEFLCTQKLTPMQLKVFTKSSNRSCHHTLAN  675

Query  400  PAQLNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ S +F +     ++   R +TNVG+  + Y   +      +V+V+P  L F 
Sbjct  676  PGDLNYPAISAVFPEQHSISLLTLHRTVTNVGSPVSTYHARVSQFKGASVSVEPKTLQFT  735

Query  571  NVGDRLRYTVT  603
            +   +L Y +T
Sbjct  736  SKHRKLAYKIT  746



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 128/193 (66%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SGLAALL+ AHP+WSP AIKSAL+TTAY  +N+  PI D    + S
Sbjct  539  FNIISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDVENSGEPIEDLATGKSS  598

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA---KK  390
            N + HG+GHVDP+KAL+PGLVYDI   +Y  FLC++ Y    I   ++ P +  A    K
Sbjct  599  NSFIHGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPTLFNACETSK  658

Query  391  LSNPAQLNYPSFSVLFGKS-RIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLV  564
            L     LNYPSFSV+FG +  +V+  R + NVG+    +YEV +++P +V + V P+KL 
Sbjct  659  LRTAGDLNYPSFSVVFGSTGEVVKYKRAVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLA  718

Query  565  FKNVGDRLRYTVT  603
            F      L Y VT
Sbjct  719  FSKEKSELEYEVT  731



>gb|EMT16255.1| Subtilisin-like protease [Aegilops tauschii]
Length=761

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL +D     FNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTT YT DNTNS 
Sbjct  348  GLAKDGRRTPFNIISGTSMSCPHISGLAALLKAAHPNWSPAAIKSALMTTTYTMDNTNSS  407

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            +RDA G   + P+  G+GHVDP KALSPGLVYDI+  DY  FLCSLDY+   I+ I K  
Sbjct  408  LRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTNDYVAFLCSLDYSATHIRVITKMS  467

Query  370  NITCAKKLSNPAQLNYPSFSVLFGK  444
            N++C  + S P  LNYPSFSV+F K
Sbjct  468  NVSCPPR-SRPGDLNYPSFSVVFRK  491


 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = +1

Query  142  SALMTTAYTHDNTNSPIRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLC  321
            SALMTT YT  NT S +RDA G   + P+  G+GHVDP KALSPGLVYDI+  DY  FLC
Sbjct  497  SALMTTTYTMANTTSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTNDYVAFLC  556

Query  322  SLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAG  495
            SLDY+   I+ I K  N++C  + S P  LNYPSFSV+F K    +VR  RELTNVG A 
Sbjct  557  SLDYSATHIRVITKMSNVSCPPR-SRPGDLNYPSFSVVFRKKPRHVVRYRRELTNVGPAM  615

Query  496  TLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVT  603
             +Y+V +  P SV VTV P KLVFK VG + RY VT
Sbjct  616  AVYDVKVSGPASVGVTVTPAKLVFKKVGQKQRYYVT  651



>gb|EYU29554.1| hypothetical protein MIMGU_mgv1a0256351mg, partial [Erythranthe 
guttata]
Length=434

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 131/193 (68%), Gaps = 10/193 (5%)
 Frame = +1

Query  37   SFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDEL  216
            +FNI+SGTSMSCPH+SG+AALLK+ HP+WSP  IKSA+MTTAY  +   +PI     DE 
Sbjct  212  AFNIISGTSMSCPHLSGVAALLKSVHPDWSPAVIKSAIMTTAYQVNLKGNPIE----DEQ  267

Query  217  SNP---WAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK  387
              P   +  GSGHV+  +A  PGLVYDI P DY  F+C L+YT QQ+  IV   ++ C+K
Sbjct  268  LQPATVFDIGSGHVNLSRADDPGLVYDILPDDYIPFVCGLNYTNQQVGIIV-GRDVDCSK  326

Query  388  KLSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  564
            + S P AQLNYPSFS++FG S     TR LTNVG   + Y+V I +P +V V V+P KLV
Sbjct  327  EKSIPEAQLNYPSFSIIFG-STPQTYTRTLTNVGKPDSSYDVEIVSPDNVIVKVEPKKLV  385

Query  565  FKNVGDRLRYTVT  603
            F  +GD+  Y VT
Sbjct  386  FPKLGDKSSYNVT  398



>ref|XP_008354238.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=440

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 3/190 (2%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDELS  219
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY HDNT  P++D+    +S
Sbjct  214  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTRKPLQDSSAASIS  273

Query  220  NPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN  399
             P+ HG+GH++P +AL PGL+YDI   DY  FLC+   T  Q++   K  N +C   L++
Sbjct  274  TPYDHGAGHINPVRALDPGLIYDIEAQDYLEFLCTQRLTPTQLKVFTKYSNRSCKNNLAS  333

Query  400  PAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFK  570
            P  LNYP+ SV+F       ++   R +TNVG A + Y   +       V V+P  L F 
Sbjct  334  PGDLNYPALSVVFPXRTNVSVLTLHRTVTNVGPAVSNYHAIVSPFKGAYVKVEPRXLKFT  393

Query  571  NVGDRLRYTV  600
                +L Y +
Sbjct  394  XANQKLSYKI  403



>ref|XP_003554304.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
 gb|KHN02462.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=768

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 137/201 (68%), Gaps = 12/201 (6%)
 Frame = +1

Query  22   GLQEDS----FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSP  189
            GL ED+    F++MSGTSM+CPH+SG+AAL+++AHP W+P A+KSA+MTTA   D+T  P
Sbjct  527  GLPEDARRVNFSVMSGTSMACPHVSGIAALIRSAHPRWTPAAVKSAIMTTAEVTDHTGRP  586

Query  190  IRDAGGDELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  369
            I D   D+ +  +  G+GHV+P +AL+PGLVYDI P DY   LCSL YT  +I +I    
Sbjct  587  ILDE--DQPAGVFDMGAGHVNPQRALNPGLVYDIRPDDYITHLCSLGYTKSEIFSITHR-  643

Query  370  NITCAK--KLSNPAQLNYPSFSVLFGKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVT  537
            N++C    K++    LNYPSFSV+F K  + R+  +R LTNVG+A ++Y V ++AP  V 
Sbjct  644  NVSCNGIIKMNRGFSLNYPSFSVIF-KDEVRRKMFSRRLTNVGSANSIYSVEVKAPAGVK  702

Query  538  VTVKPTKLVFKNVGDRLRYTV  600
            V VKP +LVFK V   L Y V
Sbjct  703  VIVKPKRLVFKQVNQSLSYRV  723



>ref|XP_006490976.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO85943.1| hypothetical protein CISIN_1g004242mg [Citrus sinensis]
Length=766

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 129/195 (66%), Gaps = 8/195 (4%)
 Frame = +1

Query  40   FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGGDE--  213
            FNI+SGTSMSCPH+SGLAALLK+ H +WS  AIKSALMTTAYT +N NSPI D GG    
Sbjct  540  FNIISGTSMSCPHVSGLAALLKSVHEDWSTAAIKSALMTTAYTLNNRNSPIADVGGSSDT  599

Query  214  -LSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK  390
             L+  +A GSGHVDP  A  PGL+YDIA  DY  +LCSL+YT+ Q+ A+    N TC   
Sbjct  600  PLATAFAFGSGHVDPESASDPGLIYDIATEDYLDYLCSLNYTSLQL-ALFAGGNFTCPNP  658

Query  391  LS-NPAQLNYPSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  558
             + +P +LNYPSF+V F    K+  +   R +TNVG +   Y V +E P  V VT+ P  
Sbjct  659  SAFHPGKLNYPSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVEEPNGVLVTITPPI  718

Query  559  LVFKNVGDRLRYTVT  603
            L F+ +G+ L Y VT
Sbjct  719  LSFQKIGEILSYKVT  733



>ref|XP_003528733.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=782

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 131/197 (66%), Gaps = 7/197 (4%)
 Frame = +1

Query  28   QEDSFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTHDNTNSPIRDAGG  207
            +   FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT DN   P+ D   
Sbjct  544  RRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNKGDPMLDEST  603

Query  208  DELSNPWAHGSGHVDPHKALSPGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--  381
              +S+ + +G+GHV P KA++PGLVYDI+ +DY  FLC+ +YTT  I  I +  N  C  
Sbjct  604  GNVSSVFDYGAGHVHPVKAMNPGLVYDISTSDYVNFLCNSNYTTNTIHVITRR-NADCSG  662

Query  382  AKKLSNPAQLNYPSFSVLF---GKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVK  549
            AK+  +   LNYPS S +F   GK R+     R +TNVG   ++Y+V I+ P    VTVK
Sbjct  663  AKRAGHSGNLNYPSLSAVFQLYGKKRMATHFIRTVTNVGDPNSVYKVTIKPPRGTVVTVK  722

Query  550  PTKLVFKNVGDRLRYTV  600
            P  L F+ VG +L + V
Sbjct  723  PDTLNFRRVGQKLNFLV  739



Lambda      K        H        a         alpha
   0.317    0.131    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370