BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028G21

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004234637.1|  PREDICTED: protein BRICK 1                         142   3e-40   Solanum lycopersicum
ref|XP_010105126.1|  hypothetical protein L484_016117                   140   7e-40   Morus notabilis
ref|XP_009772388.1|  PREDICTED: protein BRICK 1                         140   8e-40   Nicotiana sylvestris
ref|XP_009605386.1|  PREDICTED: protein BRICK 1                         139   5e-39   Nicotiana tomentosiformis
ref|XP_008236619.1|  PREDICTED: protein BRICK 1                         139   6e-39   Prunus mume [ume]
ref|XP_002527222.1|  Protein BRICK1, putative                           138   6e-39   Ricinus communis
ref|XP_011466613.1|  PREDICTED: protein BRICK 1                         138   7e-39   Fragaria vesca subsp. vesca
gb|KJB44025.1|  hypothetical protein B456_007G230500                    137   1e-38   Gossypium raimondii
gb|KDP32167.1|  hypothetical protein JCGZ_12628                         137   2e-38   Jatropha curcas
ref|NP_179849.2|  protein BRICK 1                                       137   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KCW54648.1|  hypothetical protein EUGRSUZ_I00598                     138   2e-38   Eucalyptus grandis [rose gum]
emb|CDP02686.1|  unnamed protein product                                137   3e-38   Coffea canephora [robusta coffee]
ref|XP_007207525.1|  hypothetical protein PRUPE_ppa014091mg             137   3e-38   Prunus persica
ref|XP_010254626.1|  PREDICTED: protein BRICK 1                         136   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_004143434.1|  PREDICTED: protein BRICK 1-like isoform 1          136   4e-38   Cucumis sativus [cucumbers]
ref|XP_010646397.1|  PREDICTED: protein BRICK 1                         136   5e-38   Vitis vinifera
ref|XP_008385246.1|  PREDICTED: protein BRICK 1                         137   5e-38   
ref|XP_010027986.1|  PREDICTED: protein BRICK 1                         135   7e-38   Eucalyptus grandis [rose gum]
gb|KJB44024.1|  hypothetical protein B456_007G230500                    135   8e-38   Gossypium raimondii
ref|XP_011073637.1|  PREDICTED: protein BRICK 1                         135   1e-37   Sesamum indicum [beniseed]
ref|XP_003517200.1|  PREDICTED: protein BRICK 1 isoformX1               135   1e-37   Glycine max [soybeans]
ref|XP_006426215.1|  hypothetical protein CICLE_v10027006mg             135   1e-37   Citrus clementina [clementine]
ref|XP_008803777.1|  PREDICTED: protein BRICK 1                         134   3e-37   Phoenix dactylifera
gb|KHG01536.1|  Protein BRICK 1 -like protein                           136   3e-37   Gossypium arboreum [tree cotton]
ref|XP_010683051.1|  PREDICTED: protein BRICK 1                         133   5e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534258.1|  PREDICTED: protein BRICK 1                         133   5e-37   Glycine max [soybeans]
ref|XP_010555424.1|  PREDICTED: protein BRICK 1-like                    132   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_007047707.1|  Brick 1                                            133   1e-36   
ref|XP_009396152.1|  PREDICTED: protein BRICK 1                         132   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009140374.1|  PREDICTED: protein BRICK 1                         132   2e-36   Brassica rapa
ref|XP_010935480.1|  PREDICTED: protein BRICK 1                         132   2e-36   Elaeis guineensis
gb|EYU41348.1|  hypothetical protein MIMGU_mgv1a017260mg                132   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_010531342.1|  PREDICTED: protein BRICK 1                         132   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_010429193.1|  PREDICTED: protein BRICK 1-like                    132   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009418655.1|  PREDICTED: protein BRICK1-like                     129   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010244689.1|  PREDICTED: protein BRICK 1-like                    129   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004954506.1|  PREDICTED: protein BRICK1-like                     127   2e-34   
ref|XP_003563735.1|  PREDICTED: probable protein BRICK1                 126   5e-34   Brachypodium distachyon [annual false brome]
ref|XP_002454840.1|  hypothetical protein SORBIDRAFT_04g038300          125   6e-34   Sorghum bicolor [broomcorn]
ref|NP_001105190.1|  protein BRICK1                                     125   8e-34   Zea mays [maize]
gb|EMS63713.1|  hypothetical protein TRIUR3_10832                       125   1e-33   Triticum urartu
ref|NP_001048610.1|  Os02g0829900                                       125   1e-33   
ref|XP_003612953.1|  Oligopeptidase A                                   135   3e-33   
dbj|BAJ92386.1|  predicted protein                                      124   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006648169.1|  PREDICTED: probable protein BRICK1-like            124   4e-33   
ref|XP_006856618.1|  hypothetical protein AMTR_s00046p00225220          119   2e-31   
ref|XP_004143435.1|  PREDICTED: protein BRICK 1-like isoform 2          119   2e-31   
ref|XP_002319999.2|  hypothetical protein POPTR_0014s01030g             117   2e-30   Populus trichocarpa [western balsam poplar]
emb|CDY13739.1|  BnaA09g42410D                                          112   6e-29   Brassica napus [oilseed rape]
ref|XP_002878627.1|  hypothetical protein ARALYDRAFT_343817             117   4e-27   
gb|EEE58106.1|  hypothetical protein OsJ_08984                          110   9e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ABR17532.1|  unknown                                                 102   5e-25   Picea sitchensis
ref|XP_008342688.1|  PREDICTED: protein BRICK 1-like                  90.9    3e-20   
ref|XP_001759003.1|  predicted protein                                88.6    1e-19   
gb|AAD15572.1|  unknown protein                                       87.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AGW80641.1|  BRK1                                                  77.4    1e-15   Physcomitrium pyriforme
gb|AGW80631.1|  BRK1                                                  77.0    2e-15   Physcomitrium collenchymatum
gb|AGW80649.1|  BRK1                                                  75.5    6e-15   Physcomitrium collenchymatum
ref|XP_002973853.1|  hypothetical protein SELMODRAFT_9224             72.4    1e-13   
gb|ACG38184.1|  hypothetical protein                                  68.6    3e-12   Zea mays [maize]
gb|AGW80637.1|  BRK1                                                  66.6    1e-11   Physcomitrella readeri
gb|AGW80651.1|  BRK1                                                  65.5    2e-11   Physcomitrella magdalenae
gb|AGW80627.1|  BRK1                                                  65.5    2e-11   Funaria flavicans
dbj|GAM17110.1|  hypothetical protein SAMD00019534_002850             60.1    5e-09   Acytostelium subglobosum LB1
ref|XP_003288931.1|  component of scar regulatory complex             59.3    7e-09   Dictyostelium purpureum
gb|EFA80526.1|  component of SCAR regulatory complex                  58.5    1e-08   Heterostelium album PN500
pdb|3PP5|A  Chain A, High-Resolution Structure Of The Trimeric Sc...  57.4    4e-08   Dictyostelium discoideum
ref|XP_008352566.1|  PREDICTED: protein BRICK 1-like                  56.2    7e-08   
ref|XP_641829.1|  component of SCAR regulatory complex                56.6    8e-08   Dictyostelium discoideum AX4
ref|XP_004360471.1|  component of SCAR regulatory complex             55.5    2e-07   Cavenderia fasciculata
gb|AGW80639.1|  BRK1                                                  53.1    6e-07   Physcomitrella readeri
ref|XP_974722.3|  PREDICTED: probable protein BRICK1-B                53.5    9e-07   
ref|XP_004352072.1|  hypothetical protein ACA1_036220                 53.5    9e-07   Acanthamoeba castellanii str. Neff
ref|XP_004992386.1|  BRICK 1 protein                                  53.5    2e-06   Salpingoeca rosetta
ref|XP_003746479.1|  PREDICTED: probable protein BRICK1-A-like        52.4    2e-06   
gb|EGW06212.1|  putative protein BRICK1                               52.4    3e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_005777074.1|  hypothetical protein EMIHUDRAFT_206700           52.0    3e-06   Emiliania huxleyi CCMP1516
emb|CDW58344.1|  hypothetical protein TTRE_0000665301                 51.6    3e-06   Trichuris trichiura
ref|XP_009011910.1|  hypothetical protein HELRODRAFT_156389           51.6    4e-06   Helobdella robusta
ref|XP_009055596.1|  hypothetical protein LOTGIDRAFT_105126           51.6    5e-06   Lottia gigantea
ref|XP_004345416.1|  hypothetical protein CAOG_05826                  51.2    6e-06   Capsaspora owczarzaki ATCC 30864
ref|XP_002406594.1|  conserved hypothetical protein                   51.2    6e-06   Ixodes scapularis [blacklegged tick]
gb|AGW80636.1|  BRK1                                                  50.4    6e-06   Aphanorrhegma serratum
gb|ELT90738.1|  hypothetical protein CAPTEDRAFT_167653                51.2    7e-06   Capitella teleta
ref|XP_004536815.1|  PREDICTED: probable protein BRICK1-B-like is...  51.2    7e-06   Ceratitis capitata [medfly]
ref|XP_005632227.1|  PREDICTED: probable protein BRICK1-like          51.6    7e-06   
ref|XP_003910378.1|  PREDICTED: protein BRICK1                        50.8    7e-06   Papio anubis [baboon]
ref|XP_005182216.1|  PREDICTED: probable protein BRICK1-B             50.8    8e-06   Musca domestica
ref|XP_002063473.1|  GK21927                                          50.8    8e-06   Drosophila willistoni
gb|KFD63622.1|  hypothetical protein M514_09673                       54.3    8e-06   Trichuris suis
ref|XP_001176942.1|  PREDICTED: protein BRICK1                        50.8    9e-06   
ref|XP_002737834.1|  PREDICTED: probable protein BRICK1-B-like        50.8    1e-05   Saccoglossus kowalevskii
ref|XP_308258.2|  AGAP007614-PA                                       50.4    1e-05   Anopheles gambiae str. PEST
ref|XP_011426774.1|  PREDICTED: protein BRICK1-like                   50.4    1e-05   Crassostrea gigas
ref|XP_005578995.1|  PREDICTED: protein BRICK1-like                   50.4    1e-05   
gb|AGW80628.1|  BRK1                                                  49.7    1e-05   Funaria hygrometrica
ref|XP_004926995.1|  PREDICTED: probable protein BRICK1-B-like        50.4    1e-05   Bombyx mori [silk moth]
ref|XP_007631517.1|  PREDICTED: LOW QUALITY PROTEIN: protein BRICK1   51.6    1e-05   
gb|EHJ65206.1|  putative syntaxin interacting protein 1               50.1    1e-05   
ref|XP_002806005.1|  PREDICTED: probable protein BRICK1-like          50.1    1e-05   
ref|XP_001601160.1|  PREDICTED: protein BRICK1                        50.1    1e-05   Nasonia vitripennis
ref|XP_011299974.1|  PREDICTED: probable protein BRICK1-B             50.1    1e-05   Fopius arisanus
ref|XP_008556779.1|  PREDICTED: probable protein BRICK1-B             50.1    1e-05   Microplitis demolitor
gb|ABR27847.1|  syntaxin interacting protein 1                        50.1    2e-05   Triatoma infestans
gb|KFD49406.1|  hypothetical protein M513_09673                       53.5    2e-05   Trichuris suis
gb|KHJ45139.1|  hypothetical protein D918_04443                       53.5    2e-05   Trichuris suis
ref|XP_011496641.1|  PREDICTED: probable protein BRICK1-B isoform X1  50.1    2e-05   Ceratosolen solmsi marchali
ref|XP_002132174.2|  PREDICTED: probable protein BRICK1-A             50.4    2e-05   Ciona intestinalis [sea vase]
ref|XP_003217597.2|  PREDICTED: protein BRICK1                        50.4    2e-05   Anolis carolinensis [Carolina anole]
ref|XP_011347559.1|  PREDICTED: probable protein BRICK1-B isoform X2  49.7    2e-05   
gb|ACO11207.1|  Probable protein BRICK1                               50.1    2e-05   Caligus rogercresseyi
ref|XP_002799727.1|  PREDICTED: probable protein BRICK1-like          49.7    2e-05   
gb|ACO12543.1|  Probable protein BRICK1                               50.1    2e-05   Lepeophtheirus salmonis
ref|NP_001165171.1|  probable protein BRICK1-B                        49.7    2e-05   Xenopus laevis [clawed frog]
gb|ACO10920.1|  Probable protein BRICK1                               50.1    2e-05   Caligus rogercresseyi
ref|XP_008483290.1|  PREDICTED: probable protein BRICK1-B isoform X1  49.7    2e-05   
ref|NP_726400.1|  HSPC300, isoform A                                  49.7    2e-05   Drosophila melanogaster
gb|KDR08993.1|  putative protein BRICK1-B                             49.7    2e-05   Zootermopsis nevadensis
ref|XP_001987077.1|  GH20169                                          49.7    2e-05   Drosophila grimshawi
ref|XP_002005836.1|  GI20687                                          49.7    2e-05   Drosophila mojavensis
dbj|BAN21323.1|  conserved hypothetical protein                       49.7    2e-05   Riptortus pedestris
ref|XP_002050000.1|  GJ21896                                          49.7    2e-05   Drosophila virilis
ref|XP_008284280.1|  PREDICTED: protein BRICK1 isoform X1             50.1    2e-05   Stegastes partitus
ref|XP_001631572.1|  predicted protein                                49.3    2e-05   Nematostella vectensis
ref|XP_011347558.1|  PREDICTED: probable protein BRICK1-B isoform X1  49.3    2e-05   
ref|XP_003132409.3|  PREDICTED: probable protein BRICK1-like isof...  49.7    3e-05   Sus scrofa [pigs]
ref|XP_001750252.1|  hypothetical protein                             53.1    3e-05   Monosiga brevicollis MX1
ref|XP_004402293.1|  PREDICTED: probable protein BRICK1-like          49.3    3e-05   
ref|XP_008696116.1|  PREDICTED: protein BRICK1                        49.7    3e-05   Ursus maritimus [white bear]
ref|XP_003399198.1|  PREDICTED: probable protein BRICK1-B-like        49.3    3e-05   Bombus terrestris [large earth bumblebee]
gb|EFZ16776.1|  hypothetical protein SINV_09386                       48.9    3e-05   
gb|AAF28978.1|AF161418_1  HSPC300                                     49.7    3e-05   Homo sapiens [man]
ref|XP_006618314.1|  PREDICTED: probable protein BRICK1-B-like        49.3    3e-05   Apis dorsata [rock honeybee]
gb|EFN89139.1|  Probable protein BRICK1-B                             49.3    3e-05   Harpegnathos saltator
ref|XP_005063131.1|  PREDICTED: probable protein BRICK1-A-like        48.9    3e-05   Ficedula albicollis
gb|KFO38349.1|  Protein BRICK1                                        49.3    4e-05   Fukomys damarensis [Damara mole rat]
ref|XP_007888486.1|  PREDICTED: protein BRICK1                        48.9    4e-05   Callorhinchus milii [Australian ghost shark]
ref|XP_010336090.1|  PREDICTED: protein BRICK1                        49.3    4e-05   Saimiri boliviensis boliviensis
gb|KFM63396.1|  Hypothetical protein BRICK1-B                         48.9    4e-05   Stegodyphus mimosarum
ref|XP_001365620.1|  PREDICTED: probable protein BRICK1-like          48.9    4e-05   Monodelphis domestica
ref|XP_005987080.1|  PREDICTED: probable protein BRICK1-like          48.9    4e-05   Latimeria chalumnae
gb|ACM08703.1|  Probable protein BRICK1                               48.9    4e-05   Salmo salar
ref|XP_008980387.1|  PREDICTED: protein BRICK1                        49.3    4e-05   Callithrix jacchus [common marmoset]
ref|NP_001002097.1|  probable protein BRICK1                          48.9    4e-05   Danio rerio [leopard danio]
ref|NP_001165164.1|  probable protein BRICK1-A                        48.9    4e-05   Xenopus laevis [clawed frog]
ref|XP_006885337.1|  PREDICTED: probable protein BRICK1-like          48.9    4e-05   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010891397.1|  PREDICTED: probable protein BRICK1               48.9    4e-05   Esox lucius
gb|ELR48079.1|  Putative protein BRICK1                               48.5    4e-05   Bos mutus
ref|NP_060932.2|  protein BRICK1                                      48.9    4e-05   Homo sapiens [man]
ref|NP_001015994.1|  BRICK1, SCAR/WAVE actin-nucleating complex s...  48.5    4e-05   Xenopus tropicalis [western clawed frog]
ref|XP_004616074.1|  PREDICTED: probable protein BRICK1-like          48.5    5e-05   Sorex araneus [Eurasian shrew]
gb|ADV40371.1|  syntaxin interacting protein 1                        48.5    5e-05   Latrodectus hesperus [black widow]
ref|XP_006739075.1|  PREDICTED: probable protein BRICK1-like          48.9    5e-05   Leptonychotes weddellii
ref|XP_003464128.1|  PREDICTED: protein BRICK1                        48.5    5e-05   Cavia porcellus [guinea pig]
ref|XP_005145867.1|  PREDICTED: probable protein BRICK1-like          48.5    5e-05   Melopsittacus undulatus
ref|XP_003496909.2|  PREDICTED: protein BRICK1                        50.1    5e-05   
emb|CDQ98757.1|  unnamed protein product                              48.5    5e-05   Oncorhynchus mykiss
gb|EHB13886.1|  Putative protein BRICK1                               48.5    5e-05   Heterocephalus glaber [naked mole rat]
gb|EAW64060.1|  chromosome 3 open reading frame 10, isoform CRA_a     48.5    5e-05   Homo sapiens [man]
ref|NP_598698.1|  protein BRICK1                                      48.5    5e-05   Mus musculus [mouse]
ref|XP_004795606.1|  PREDICTED: probable protein BRICK1-like          48.5    5e-05   
ref|XP_005285695.1|  PREDICTED: protein BRICK1                        48.5    6e-05   Chrysemys picta bellii
dbj|BAE38874.1|  unnamed protein product                              48.5    6e-05   Mus musculus [mouse]
gb|ACO15218.1|  Probable protein BRICK1                               48.5    6e-05   Caligus clemensi
ref|XP_004651511.1|  PREDICTED: protein BRICK1                        48.1    6e-05   Jaculus jaculus
gb|ACO15298.1|  Probable protein BRICK1                               48.5    7e-05   Caligus clemensi
ref|XP_004901960.1|  PREDICTED: protein BRICK1 isoform X1             48.9    7e-05   
gb|ACM09764.1|  Probable protein BRICK1                               48.1    7e-05   Salmo salar
gb|ETE70885.1|  Protein BRICK1                                        48.5    8e-05   Ophiophagus hannah
gb|ERE66940.1|  protein BRICK1-like protein                           48.5    8e-05   Cricetulus griseus [Chinese hamsters]
ref|XP_002423101.1|  conserved hypothetical protein                   48.1    8e-05   Pediculus humanus corporis [human body lice]
ref|XP_007075535.1|  PREDICTED: probable protein BRICK1-like isof...  47.8    8e-05   Panthera tigris altaica
ref|XP_004738570.1|  PREDICTED: probable protein BRICK1-like          48.1    1e-04   
ref|XP_007075534.1|  PREDICTED: probable protein BRICK1-like isof...  48.1    1e-04   Panthera tigris altaica
gb|ELK34359.1|  Von Hippel-Lindau disease tumor suppressor            49.3    2e-04   Myotis davidii
gb|ELK07871.1|  Putative protein BRICK1                               48.1    2e-04   Pteropus alecto
ref|XP_005974063.1|  PREDICTED: probable protein BRICK1-like          47.0    2e-04   Pantholops hodgsonii [Tibetan antelope]
ref|XP_001582830.1|  hypothetical protein                             47.0    2e-04   Trichomonas vaginalis G3
ref|XP_007061833.1|  PREDICTED: probable protein BRICK1-like          47.0    2e-04   
ref|XP_004454805.1|  PREDICTED: probable protein BRICK1-like          47.0    2e-04   
ref|XP_003380890.1|  conserved domain protein                         47.8    2e-04   Trichinella spiralis
ref|XP_005870139.1|  PREDICTED: protein BRICK1                        47.0    2e-04   Myotis brandtii
ref|XP_001317031.1|  hypothetical protein                             46.6    2e-04   Trichomonas vaginalis G3
ref|XP_005093794.1|  PREDICTED: probable protein BRICK1-B-like is...  46.6    2e-04   Aplysia californica
ref|XP_004443656.1|  PREDICTED: von Hippel-Lindau disease tumor s...  49.3    3e-04   
ref|XP_004469821.1|  PREDICTED: probable protein BRICK1-like          46.6    3e-04   
emb|CBY18366.1|  unnamed protein product                              46.2    3e-04   Oikopleura dioica
gb|EMP33963.1|  Putative protein BRICK1                               46.2    3e-04   Chelonia mydas [green seaturtle]
gb|EMP33971.1|  Putative protein BRICK1                               46.6    3e-04   Chelonia mydas [green seaturtle]
ref|XP_006197993.1|  PREDICTED: probable protein BRICK1-like          46.2    3e-04   
ref|XP_007061829.1|  PREDICTED: probable protein BRICK1-like          46.2    4e-04   Chelonia mydas [green seaturtle]
ref|XP_005093792.1|  PREDICTED: probable protein BRICK1-B-like is...  46.2    5e-04   
ref|XP_003144523.1|  hypothetical protein LOAG_08945                  45.8    5e-04   Loa loa
ref|XP_005675174.1|  PREDICTED: probable protein BRICK1-like          45.8    6e-04   
emb|CEF70673.1|  Protein BRICK1                                       45.8    6e-04   Strongyloides ratti
ref|XP_006090498.1|  PREDICTED: protein BRICK1-like                   45.4    6e-04   
ref|XP_001893233.1|  zgc:86903                                        45.4    8e-04   Brugia malayi [agent of lymphatic filariasis]
ref|XP_006148834.1|  PREDICTED: probable protein BRICK1-like          45.1    9e-04   



>ref|XP_004234637.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_006364014.1| PREDICTED: protein BRICK 1-like [Solanum tuberosum]
 ref|XP_010317765.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317766.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317767.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317768.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317769.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
Length=85

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVR+LFDFLVQFE TTKSKLA+LNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRKLFDFLVQFEATTKSKLATLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
            TLERRLELLEVQVSTATANPALFN
Sbjct  61   TLERRLELLEVQVSTATANPALFN  84



>ref|XP_010105126.1| hypothetical protein L484_016117 [Morus notabilis]
 gb|EXC03911.1| hypothetical protein L484_016117 [Morus notabilis]
Length=85

 Score =   140 bits (354),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
            TLERRLELLEVQV TA+ANP+LFN+
Sbjct  61   TLERRLELLEVQVGTASANPSLFNS  85



>ref|XP_009772388.1| PREDICTED: protein BRICK 1 [Nicotiana sylvestris]
Length=85

 Score =   140 bits (354),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVR+LFDFLVQFE TTKSKLA+LNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRKLFDFLVQFEATTKSKLATLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
            TLERRLELLEVQV+TATANPALFN
Sbjct  61   TLERRLELLEVQVTTATANPALFN  84



>ref|XP_009605386.1| PREDICTED: protein BRICK 1 [Nicotiana tomentosiformis]
Length=85

 Score =   139 bits (349),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVR+LFDFLVQFE TTKSKLA+LNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRKLFDFLVQFEATTKSKLATLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
            TLERRLELLEVQV+TA ANPALFN
Sbjct  61   TLERRLELLEVQVTTAIANPALFN  84



>ref|XP_008236619.1| PREDICTED: protein BRICK 1 [Prunus mume]
Length=117

 Score =   139 bits (351),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    RSGKMARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLN  182
            R  KMARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLN
Sbjct  27   RQIKMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLN  86

Query  183  EKLDTlerrlelleVQVSTATANPALF  263
            EKLD LER+LELLEVQV TA+ANP+LF
Sbjct  87   EKLDVLERKLELLEVQVGTASANPSLF  113



>ref|XP_002527222.1| Protein BRICK1, putative [Ricinus communis]
 gb|EEF35148.1| Protein BRICK1, putative [Ricinus communis]
Length=85

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFL+QFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLLQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
            TLERRLELLEVQV TATANP LF T
Sbjct  61   TLERRLELLEVQVGTATANPNLFTT  85



>ref|XP_011466613.1| PREDICTED: protein BRICK 1 [Fragaria vesca subsp. vesca]
Length=87

 Score =   138 bits (348),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
            TLER+LELLEVQV TA+ANP+LF
Sbjct  61   TLERKLELLEVQVGTASANPSLF  83



>gb|KJB44025.1| hypothetical protein B456_007G230500 [Gossypium raimondii]
Length=85

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FL+QFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
            TLERRLELLEVQV TA+ANP+LF+T
Sbjct  61   TLERRLELLEVQVGTASANPSLFST  85



>gb|KDP32167.1| hypothetical protein JCGZ_12628 [Jatropha curcas]
Length=85

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FL+QFE TTKSKL+SLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQFEATTKSKLSSLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
            TLERRLELLEVQV TATANP+LF T
Sbjct  61   TLERRLELLEVQVGTATANPSLFTT  85



>ref|NP_179849.2| protein BRICK 1 [Arabidopsis thaliana]
 ref|XP_006295338.1| hypothetical protein CARUB_v10024428mg [Capsella rubella]
 ref|XP_006404726.1| hypothetical protein EUTSA_v10000402mg [Eutrema salsugineum]
 ref|XP_010417024.1| PREDICTED: protein BRICK 1 [Camelina sativa]
 ref|XP_010472257.1| PREDICTED: protein BRICK 1 [Camelina sativa]
 sp|Q94JY4.1|BRK1_ARATH RecName: Full=Protein BRICK 1; Short=AtBRK1 [Arabidopsis thaliana]
 gb|AAK48957.1|AF370530_1 Unknown protein [Arabidopsis thaliana]
 gb|AAM62865.1| unknown [Arabidopsis thaliana]
 gb|AAN15336.1| Unknown protein [Arabidopsis thaliana]
 gb|AEC07332.1| protein BRICK 1 [Arabidopsis thaliana]
 gb|EOA28236.1| hypothetical protein CARUB_v10024428mg [Capsella rubella]
 gb|ESQ46179.1| hypothetical protein EUTSA_v10000402mg [Eutrema salsugineum]
Length=85

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKLASLNEKLD
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFESTTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
             LERRLE+LEVQVSTATANP+LF T
Sbjct  61   LLERRLEMLEVQVSTATANPSLFAT  85



>gb|KCW54648.1| hypothetical protein EUGRSUZ_I00598, partial [Eucalyptus grandis]
Length=130

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  9    GKMARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEK  188
              MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEK
Sbjct  44   APMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEK  103

Query  189  LDTlerrlelleVQVSTATANPALFNT  269
            LD LE RLELLEVQV TA+ANPALFNT
Sbjct  104  LDLLEHRLELLEVQVGTASANPALFNT  130



>emb|CDP02686.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   137 bits (344),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLA+LN+KLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLATLNQKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
            TLERRLE+LEVQV +ATANPALF
Sbjct  61   TLERRLEMLEVQVGSATANPALF  83



>ref|XP_007207525.1| hypothetical protein PRUPE_ppa014091mg [Prunus persica]
 ref|XP_009364792.1| PREDICTED: protein BRICK 1 [Pyrus x bretschneideri]
 ref|XP_009371348.1| PREDICTED: protein BRICK 1 [Pyrus x bretschneideri]
 ref|XP_009345859.1| PREDICTED: protein BRICK 1 [Pyrus x bretschneideri]
 gb|EMJ08724.1| hypothetical protein PRUPE_ppa014091mg [Prunus persica]
Length=87

 Score =   137 bits (344),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
             LER+LELLEVQV TA+ANP+LF
Sbjct  61   VLERKLELLEVQVGTASANPSLF  83



>ref|XP_010254626.1| PREDICTED: protein BRICK 1 [Nelumbo nucifera]
 ref|XP_010254627.1| PREDICTED: protein BRICK 1 [Nelumbo nucifera]
Length=84

 Score =   136 bits (343),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
             LERRLELLEVQVSTA+ANP+LF
Sbjct  61   MLERRLELLEVQVSTASANPSLF  83



>ref|XP_004143434.1| PREDICTED: protein BRICK 1-like isoform 1 [Cucumis sativus]
 ref|XP_004160120.1| PREDICTED: protein BRICK 1-like isoform 1 [Cucumis sativus]
 ref|XP_008440511.1| PREDICTED: protein BRICK 1 [Cucumis melo]
 gb|KGN48680.1| Protein BRICK1 [Cucumis sativus]
Length=85

 Score =   136 bits (342),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+IS+NVRRLFDFLV FE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISINVRRLFDFLVHFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
            TLERRLE+LEVQVSTA+AN +LF T
Sbjct  61   TLERRLEMLEVQVSTASANSSLFTT  85



>ref|XP_010646397.1| PREDICTED: protein BRICK 1 [Vitis vinifera]
 emb|CAN62795.1| hypothetical protein VITISV_026838 [Vitis vinifera]
Length=85

 Score =   136 bits (342),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLN+RRLF+FLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNIRRLFEFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
            TLERRLELLEVQV TA++NP+LF T
Sbjct  61   TLERRLELLEVQVGTASSNPSLFAT  85



>ref|XP_008385246.1| PREDICTED: protein BRICK 1 [Malus domestica]
Length=111

 Score =   137 bits (344),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  12   KMARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEKL
Sbjct  24   EMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEKL  83

Query  192  DTlerrlelleVQVSTATANPALF  263
            D LER+LELLEVQV TA+ANP+LF
Sbjct  84   DVLERKLELLEVQVGTASANPSLF  107



>ref|XP_010027986.1| PREDICTED: protein BRICK 1 [Eucalyptus grandis]
 ref|XP_010027987.1| PREDICTED: protein BRICK 1 [Eucalyptus grandis]
 gb|KCW54649.1| hypothetical protein EUGRSUZ_I00599 [Eucalyptus grandis]
Length=85

 Score =   135 bits (341),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
             LE RLELLEVQV TA+ANPALFNT
Sbjct  61   LLEHRLELLEVQVGTASANPALFNT  85



>gb|KJB44024.1| hypothetical protein B456_007G230500 [Gossypium raimondii]
Length=89

 Score =   135 bits (341),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FL+QFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
            TLERRLELLEVQV TA+ANP+LF+
Sbjct  61   TLERRLELLEVQVGTASANPSLFS  84



>ref|XP_011073637.1| PREDICTED: protein BRICK 1 [Sesamum indicum]
Length=86

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS ISLNVRRLFDFLVQFE TTK+KLA LNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISQISLNVRRLFDFLVQFESTTKNKLAKLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
            TLERRLELLEVQVS ATANPALF
Sbjct  61   TLERRLELLEVQVSNATANPALF  83



>ref|XP_003517200.1| PREDICTED: protein BRICK 1 isoformX1 [Glycine max]
 ref|XP_004512552.1| PREDICTED: protein BRICK 1-like [Cicer arietinum]
 ref|XP_006572988.1| PREDICTED: protein BRICK 1 isoform X2 [Glycine max]
 ref|XP_006572989.1| PREDICTED: protein BRICK 1 isoform X3 [Glycine max]
 ref|XP_007158330.1| hypothetical protein PHAVU_002G143500g [Phaseolus vulgaris]
 gb|ABY48140.1| BRICK1 [Medicago truncatula]
 gb|AFK43675.1| unknown [Medicago truncatula]
 gb|ESW30324.1| hypothetical protein PHAVU_002G143500g [Phaseolus vulgaris]
 gb|KEH27724.1| BRICK1, putative [Medicago truncatula]
 gb|KHN04897.1| Protein BRICK 1 [Glycine soja]
 gb|KHN38903.1| Protein BRICK 1 [Glycine soja]
Length=85

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
             LERRLELLEVQV  A+ANP+LF T
Sbjct  61   VLERRLELLEVQVGNASANPSLFAT  85



>ref|XP_006426215.1| hypothetical protein CICLE_v10027006mg [Citrus clementina]
 ref|XP_006466356.1| PREDICTED: protein BRICK 1-like [Citrus sinensis]
 gb|ESR39455.1| hypothetical protein CICLE_v10027006mg [Citrus clementina]
 gb|KDO78697.1| hypothetical protein CISIN_1g034753mg [Citrus sinensis]
Length=85

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKLA LNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFEATTKSKLALLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
            TLERRLELLEVQV TA+ANP LF T
Sbjct  61   TLERRLELLEVQVGTASANPHLFTT  85



>ref|XP_008803777.1| PREDICTED: protein BRICK 1 [Phoenix dactylifera]
Length=84

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            M+RAGGITNAVNVGIAVQADWENREFISNISLNVRRLF+FL+QFE TTKSKLA+LNEKLD
Sbjct  1    MSRAGGITNAVNVGIAVQADWENREFISNISLNVRRLFEFLLQFEATTKSKLAALNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
             LE RLE+LEVQVSTATANP++F
Sbjct  61   ILEHRLEVLEVQVSTATANPSVF  83



>gb|KHG01536.1| Protein BRICK 1 -like protein [Gossypium arboreum]
Length=154

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FL+QFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
            TLERRLELLEVQV TA+ANP+LF
Sbjct  61   TLERRLELLEVQVGTASANPSLF  83



>ref|XP_010683051.1| PREDICTED: protein BRICK 1 [Beta vulgaris subsp. vulgaris]
Length=84

 Score =   133 bits (335),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA+AGGITNAVNVGIAVQADWENREFIS+ISLN+RRLFDFLVQFE TTKSKLA+LNEKLD
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNIRRLFDFLVQFESTTKSKLAALNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
            TLERRLELLEVQV+TA+ANP++F
Sbjct  61   TLERRLELLEVQVNTASANPSVF  83



>ref|XP_003534258.1| PREDICTED: protein BRICK 1 [Glycine max]
 gb|ACU15650.1| unknown [Glycine max]
Length=85

 Score =   133 bits (335),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNV RLFDFLVQFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVHRLFDFLVQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
             LERRLELLEVQV  A+ANP+LF T
Sbjct  61   VLERRLELLEVQVGNASANPSLFAT  85



>ref|XP_010555424.1| PREDICTED: protein BRICK 1-like [Tarenaya hassleriana]
Length=85

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TT+SKL +LNEKLD
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFEATTRSKLGTLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
             LERRLE+LEVQV TATANP+LF+T
Sbjct  61   LLERRLEMLEVQVGTATANPSLFST  85



>ref|XP_007047707.1| Brick 1 [Theobroma cacao]
 gb|EOX91864.1| Brick 1 [Theobroma cacao]
Length=101

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  12   KMARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +MARAGGITNAVNVGIAVQADW NREFIS+ISLNVRRLF+FL+QFE TTKSKLASLNEKL
Sbjct  13   EMARAGGITNAVNVGIAVQADWGNREFISHISLNVRRLFEFLLQFEATTKSKLASLNEKL  72

Query  192  DTlerrlelleVQVSTATANPALFNT  269
            DTLERRLELLEVQV TA+ANP+LF+ 
Sbjct  73   DTLERRLELLEVQVGTASANPSLFSC  98



>ref|XP_009396152.1| PREDICTED: protein BRICK 1 [Musa acuminata subsp. malaccensis]
Length=84

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFL+QFE TTKSKLA+LNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLLQFEATTKSKLAALNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
             LE RLE+LEV+VS+AT NP++F
Sbjct  61   ILEHRLEVLEVEVSSATTNPSVF  83



>ref|XP_009140374.1| PREDICTED: protein BRICK 1 [Brassica rapa]
 emb|CDY25614.1| BnaA04g13060D [Brassica napus]
 emb|CDX89497.1| BnaC04g35160D [Brassica napus]
Length=86

 Score =   132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 1/86 (1%)
 Frame = +3

Query  15   MARAGG-ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            MA+AGG ITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKLASLNEKL
Sbjct  1    MAKAGGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFESTTKSKLASLNEKL  60

Query  192  DTlerrlelleVQVSTATANPALFNT  269
            D LERRLE+LEVQVSTATANP+LF T
Sbjct  61   DLLERRLEMLEVQVSTATANPSLFAT  86



>ref|XP_010935480.1| PREDICTED: protein BRICK 1 [Elaeis guineensis]
Length=84

 Score =   132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            M+RAGGITNAVNVGIAVQADWENREFISNISLNVRRLF+FL+QFE TTKSKLA+LNEKLD
Sbjct  1    MSRAGGITNAVNVGIAVQADWENREFISNISLNVRRLFEFLLQFEATTKSKLAALNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
             LERRLE+LEVQVSTAT NP++F
Sbjct  61   ILERRLEVLEVQVSTATTNPSVF  83



>gb|EYU41348.1| hypothetical protein MIMGU_mgv1a017260mg [Erythranthe guttata]
Length=86

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MAR GGIT+AVNVGIAVQADWENREF+S+ISLNVRRLFDFLVQFE TTK+KLA LNEKLD
Sbjct  1    MARVGGITSAVNVGIAVQADWENREFVSHISLNVRRLFDFLVQFESTTKNKLAKLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
            TLERRLELLEVQVS ATANPALF
Sbjct  61   TLERRLELLEVQVSNATANPALF  83



>ref|XP_010531342.1| PREDICTED: protein BRICK 1 [Tarenaya hassleriana]
Length=85

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKL +LNEKLD
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFEATTKSKLGTLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
             LERRLE+LEVQV TATANP+LF
Sbjct  61   LLERRLEMLEVQVGTATANPSLF  83



>ref|XP_010429193.1| PREDICTED: protein BRICK 1-like [Camelina sativa]
Length=85

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKLASLNEKLD
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFESTTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFNT  269
             LERRLELLEVQVSTATANP+LF T
Sbjct  61   LLERRLELLEVQVSTATANPSLFAT  85



>ref|XP_009418655.1| PREDICTED: protein BRICK1-like [Musa acuminata subsp. malaccensis]
Length=84

 Score =   129 bits (325),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGG+TNAVNVGIAVQADWENREFI+NISLN+RRLFDFL+QFE TTK KLA+LNEKLD
Sbjct  1    MARAGGMTNAVNVGIAVQADWENREFIANISLNIRRLFDFLLQFEATTKGKLAALNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
             LE RL++LEVQVS+ T NP++FN
Sbjct  61   VLEHRLQVLEVQVSSVTTNPSVFN  84



>ref|XP_010244689.1| PREDICTED: protein BRICK 1-like [Nelumbo nucifera]
Length=84

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FL+QFE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLIQFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALF  263
             LERRLELLEVQVSTA+ANP LF
Sbjct  61   LLERRLELLEVQVSTASANPFLF  83



>ref|XP_004954506.1| PREDICTED: protein BRICK1-like [Setaria italica]
Length=84

 Score =   127 bits (318),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            M R GG+ N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNEKLD
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
             LER+LE+LEVQVS+AT NP++FN
Sbjct  61   ILERKLEVLEVQVSSATTNPSVFN  84



>ref|XP_003563735.1| PREDICTED: probable protein BRICK1 [Brachypodium distachyon]
 ref|XP_010227729.1| PREDICTED: probable protein BRICK1 [Brachypodium distachyon]
Length=85

 Score =   126 bits (316),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +3

Query  15   MARAGG-ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            MARAGG + +AVNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNEKL
Sbjct  1    MARAGGGMGSAVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNEKL  60

Query  192  DTlerrlelleVQVSTATANPALFN  266
            D+LER+LE+LEVQVS+AT NP++FN
Sbjct  61   DSLERKLEVLEVQVSSATTNPSVFN  85



>ref|XP_002454840.1| hypothetical protein SORBIDRAFT_04g038300 [Sorghum bicolor]
 gb|EES07816.1| hypothetical protein SORBIDRAFT_04g038300 [Sorghum bicolor]
Length=84

 Score =   125 bits (315),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            M R GG+ N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLA+LNEKLD
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLATLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
             LER+LE+LEVQVS+AT NP++FN
Sbjct  61   ILERKLEVLEVQVSSATTNPSVFN  84



>ref|NP_001105190.1| protein BRICK1 [Zea mays]
 sp|Q8RW98.1|BRK1_MAIZE RecName: Full=Protein BRICK1 [Zea mays]
 gb|AAM18794.1| BRICK1 [Zea mays]
 gb|ACG24817.1| protein BRICK1 [Zea mays]
 gb|ACG32442.1| protein BRICK1 [Zea mays]
 gb|ACG33165.1| protein BRICK1 [Zea mays]
 gb|ACG37453.1| protein BRICK1 [Zea mays]
 gb|ACG45161.1| protein BRICK1 [Zea mays]
 gb|AFW74145.1| brick1 [Zea mays]
Length=84

 Score =   125 bits (314),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            M R GG+ N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNEKLD
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATANPALFN  266
             LER+LE+LEVQV +AT NP++FN
Sbjct  61   ILERKLEVLEVQVGSATTNPSVFN  84



>gb|EMS63713.1| hypothetical protein TRIUR3_10832 [Triticum urartu]
Length=88

 Score =   125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 81/87 (93%), Gaps = 3/87 (3%)
 Frame = +3

Query  15   MARAG---GITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNE  185
            MARAG   G+ +AVNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNE
Sbjct  1    MARAGQGGGMGSAVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNE  60

Query  186  KLDTlerrlelleVQVSTATANPALFN  266
            KLD+LER+LE+LEVQVS+AT NP++FN
Sbjct  61   KLDSLERKLEVLEVQVSSATTNPSVFN  87



>ref|NP_001048610.1| Os02g0829900 [Oryza sativa Japonica Group]
 sp|Q84VA7.1|BRK1_ORYSJ RecName: Full=Probable protein BRICK1 [Oryza sativa Japonica 
Group]
 gb|AAO72702.1| unknown [Oryza sativa Japonica Group]
 dbj|BAD22945.1| putative BRICK1 [Oryza sativa Japonica Group]
 dbj|BAF10524.1| Os02g0829900 [Oryza sativa Japonica Group]
 gb|EEC74297.1| hypothetical protein OsI_09549 [Oryza sativa Indica Group]
Length=86

 Score =   125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 2/86 (2%)
 Frame = +3

Query  15   MARAGG--ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEK  188
            MARAGG  + N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNEK
Sbjct  1    MARAGGHGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNEK  60

Query  189  LDTlerrlelleVQVSTATANPALFN  266
            LD LER+LE+LEVQVS+AT NP++FN
Sbjct  61   LDILERKLEVLEVQVSSATTNPSVFN  86



>ref|XP_003612953.1| Oligopeptidase A [Medicago truncatula]
Length=971

 Score =   135 bits (340),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQFE TTKSKLASLNEKLD
Sbjct  887  MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFEATTKSKLASLNEKLD  946

Query  195  TlerrlelleVQVSTATANPALFNT  269
             LERRLELLEVQV  A+ANP+LF T
Sbjct  947  VLERRLELLEVQVGNASANPSLFAT  971



>dbj|BAJ92386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=88

 Score =   124 bits (310),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 3/87 (3%)
 Frame = +3

Query  15   MARAG---GITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNE  185
            MARAG   G+ +AVNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNE
Sbjct  1    MARAGQGGGMGSAVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNE  60

Query  186  KLDTlerrlelleVQVSTATANPALFN  266
            KLD LER+LE+LEVQVS+AT NP++FN
Sbjct  61   KLDGLERKLEVLEVQVSSATTNPSVFN  87



>ref|XP_006648169.1| PREDICTED: probable protein BRICK1-like [Oryza brachyantha]
Length=86

 Score =   124 bits (310),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 2/86 (2%)
 Frame = +3

Query  15   MARAGG--ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEK  188
            MARAGG  + N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLA+LNEK
Sbjct  1    MARAGGHGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLATLNEK  60

Query  189  LDTlerrlelleVQVSTATANPALFN  266
            LD LER+LE+LEVQVS+AT NP++FN
Sbjct  61   LDILERKLEVLEVQVSSATTNPSVFN  86



>ref|XP_006856618.1| hypothetical protein AMTR_s00046p00225220 [Amborella trichopoda]
 gb|ERN18085.1| hypothetical protein AMTR_s00046p00225220 [Amborella trichopoda]
Length=91

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLF+FL++FE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFEFLIKFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQVSTATA  248
            TLERRLEL+E Q S  +A
Sbjct  61   TLERRLELIEAQPSMRSA  78



>ref|XP_004143435.1| PREDICTED: protein BRICK 1-like isoform 2 [Cucumis sativus]
 ref|XP_004160121.1| PREDICTED: protein BRICK 1-like isoform 2 [Cucumis sativus]
Length=76

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MARAGGITNAVNVGIAVQADWENREFIS+IS+NVRRLFDFLV FE TTKSKLASLNEKLD
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISINVRRLFDFLVHFEATTKSKLASLNEKLD  60

Query  195  TlerrlelleVQ  230
            TLERRLE+LEVQ
Sbjct  61   TLERRLEMLEVQ  72



>ref|XP_002319999.2| hypothetical protein POPTR_0014s01030g [Populus trichocarpa]
 ref|XP_011011725.1| PREDICTED: protein BRICK 1 [Populus euphratica]
 gb|ABK96282.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE98314.2| hypothetical protein POPTR_0014s01030g [Populus trichocarpa]
Length=98

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 81/90 (90%), Gaps = 7/90 (8%)
 Frame = +3

Query  15   MARAGG-------ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLA  173
            MARAGG       ITNAVNVGIAVQADWENREFIS+ISLN+RRLFDFL+QFE TTKSKL+
Sbjct  1    MARAGGGGGGGGGITNAVNVGIAVQADWENREFISHISLNIRRLFDFLIQFESTTKSKLS  60

Query  174  SLNEKLDTlerrlelleVQVSTATANPALF  263
            SLN KLDTLERRL+LLE+QVSTAT+NP+LF
Sbjct  61   SLNLKLDTLERRLQLLELQVSTATSNPSLF  90



>emb|CDY13739.1| BnaA09g42410D [Brassica napus]
Length=80

 Score =   112 bits (281),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 9/87 (10%)
 Frame = +3

Query  15   MARAGG--ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEK  188
            MA+AGG  ITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FL+QFE TTKSKL  L  +
Sbjct  1    MAKAGGGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQFESTTKSKLDVLERR  60

Query  189  LDTlerrlelleVQVSTATANPALFNT  269
            L+       +LEVQVSTA ANP+LF T
Sbjct  61   LE-------MLEVQVSTAAANPSLFAT  80



>ref|XP_002878627.1| hypothetical protein ARALYDRAFT_343817 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54886.1| hypothetical protein ARALYDRAFT_343817 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKLASLNEKLD
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFESTTKSKLASLNEKLD  60

Query  195  TlerrlelleVQV  233
             LERRLE+LEVQV
Sbjct  61   LLERRLEMLEVQV  73



>gb|EEE58106.1| hypothetical protein OsJ_08984 [Oryza sativa Japonica Group]
Length=336

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 2/77 (3%)
 Frame = +3

Query  15   MARAGG--ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEK  188
            MARAGG  + N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNEK
Sbjct  1    MARAGGHGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNEK  60

Query  189  LDTlerrlelleVQVST  239
            LD LER+LE+LEVQ S+
Sbjct  61   LDILERKLEVLEVQPSS  77



>gb|ABR17532.1| unknown [Picea sitchensis]
Length=83

 Score =   102 bits (255),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA++GGI+NAVNVGIAVQ DW+NREF S ++LNVRRLF+FL+QFE +TKSKLA+LN+KL 
Sbjct  1    MAKSGGISNAVNVGIAVQTDWDNREFSSALALNVRRLFEFLLQFEASTKSKLATLNDKLS  60

Query  195  TlerrlelleVQVSTATANPAL  260
            TLER+LELLE +VS A+    L
Sbjct  61   TLERQLELLEAKVSIASGTSGL  82



>ref|XP_008342688.1| PREDICTED: protein BRICK 1-like [Malus domestica]
Length=109

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  12   KMARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQF  146
            +MARAGGITNAVNVGIAVQADWENREFIS+ISLNVRRLFDFLVQF
Sbjct  24   EMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  68



>ref|XP_001759003.1| predicted protein [Physcomitrella patens]
 gb|ABF67493.1| BRICK1/HSPC300 [Physcomitrella patens]
 gb|EDQ76072.1| predicted protein [Physcomitrella patens]
Length=79

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            MA+  GI N+V VGIAVQ+DW+NR F S++SLNVRRLF+FL+QFE +T+SKLA+LNEKL 
Sbjct  1    MAK-NGINNSVAVGIAVQSDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKLT  59

Query  195  TlerrlelleVQVSTATANP  254
             LER+LE LE Q STA  NP
Sbjct  60   VLERQLEFLEAQFSTAI-NP  78



>gb|AAD15572.1| unknown protein [Arabidopsis thaliana]
Length=61

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQF  146
            MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQF
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44



>gb|AGW80641.1| BRK1, partial [Physcomitrium pyriforme]
Length=53

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  51   VGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            VGIAVQ+DW+NR F S++SLNVRRLF+FL+QFE +T+SKLA+LNEKL
Sbjct  1    VGIAVQSDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKL  47



>gb|AGW80631.1| BRK1, partial [Physcomitrium collenchymatum]
 gb|AGW80632.1| BRK1, partial [Physcomitrium collenchymatum]
 gb|AGW80633.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80634.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80635.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80640.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80642.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80643.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80644.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80646.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80647.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80648.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80650.1| BRK1, partial [Physcomitrium collenchymatum]
 gb|AGW80652.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80653.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80654.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80655.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80656.1| BRK1, partial [Physcomitrium pyriforme]
Length=54

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  51   VGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            VGIAVQ+DW+NR F S++SLNVRRLF+FL+QFE +T+SKLA+LNEKL
Sbjct  1    VGIAVQSDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKL  47



>gb|AGW80649.1| BRK1, partial [Physcomitrium collenchymatum]
Length=53

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  54   GIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            GIAVQ+DW+NR F S++SLNVRRLF+FL+QFE +T+SKLA+LNEKL
Sbjct  1    GIAVQSDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKL  46



>ref|XP_002973853.1| hypothetical protein SELMODRAFT_9224, partial [Selaginella moellendorffii]
 ref|XP_002983539.1| hypothetical protein SELMODRAFT_9227, partial [Selaginella moellendorffii]
 gb|EFJ15440.1| hypothetical protein SELMODRAFT_9227, partial [Selaginella moellendorffii]
 gb|EFJ24808.1| hypothetical protein SELMODRAFT_9224, partial [Selaginella moellendorffii]
Length=74

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  30   GITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerr  209
            G   + N+G AVQADWENR+F   ++LNVR+LF+F++QFE TT++K+A LN+KL  LER+
Sbjct  1    GGGGSANLGAAVQADWENRQFTGALALNVRKLFEFVLQFESTTRNKIAILNDKLTALERK  60

Query  210  lelleVQVSTATA  248
            LE LE Q S+ TA
Sbjct  61   LEFLEAQHSSVTA  73



>gb|ACG38184.1| hypothetical protein [Zea mays]
 gb|ACG39111.1| hypothetical protein [Zea mays]
Length=65

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            M R GG+ N VNVGIAVQADWENREFISNISLNVRR   F        +  LA     L 
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRPSFFHPWCRFFLRGCLAYRRPPLQ  60



>gb|AGW80637.1| BRK1, partial [Physcomitrella readeri]
 gb|AGW80638.1| BRK1, partial [Physcomitrella readeri]
Length=43

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  69   ADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +DW+NR F S++SLNVRRLF+FL+QFE +T+SKLASLNEKL
Sbjct  1    SDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLASLNEKL  41



>gb|AGW80651.1| BRK1, partial [Physcomitrella magdalenae]
Length=42

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  69   ADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +DW+NR F S++SLNVRRLF+FL+QFE +T+SKLA+LNEKL
Sbjct  1    SDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKL  41



>gb|AGW80627.1| BRK1, partial [Funaria flavicans]
 gb|AGW80629.1| BRK1, partial [Physcomitrella patens]
 gb|AGW80630.1| BRK1, partial [Physcomitrella patens]
 gb|AGW80645.1| BRK1, partial [Funaria americana]
Length=43

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  69   ADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +DW+NR F S++SLNVRRLF+FL+QFE +T+SKLA+LNEKL
Sbjct  1    SDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKL  41



>dbj|GAM17110.1| hypothetical protein SAMD00019534_002850, partial [Acytostelium 
subglobosum LB1]
Length=75

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  60   AVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            A+Q DWE REFI  I++N++++ DFL +FE++T++KLA++NEKL
Sbjct  13   AIQRDWEEREFIEGITINIQKIIDFLNKFELSTRNKLATVNEKL  56



>ref|XP_003288931.1| component of scar regulatory complex [Dictyostelium purpureum]
 gb|EGC34555.1| component of scar regulatory complex [Dictyostelium purpureum]
Length=68

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DWE REF+ ++S+N++++ DFL +F++ TK+KLA LNEKL T
Sbjct  6    IQKDWEQREFVEDMSINIQKIIDFLNKFDLATKNKLAELNEKLTT  50



>gb|EFA80526.1| component of SCAR regulatory complex [Polysphondylium pallidum 
PN500]
Length=67

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  60   AVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
             +Q DWE REFI +++LN++++ DFL +FE++T++KLA++NEK+ T
Sbjct  5    PIQKDWEEREFIESVTLNIQKIIDFLNKFELSTRNKLATVNEKILT  50



>pdb|3PP5|A Chain A, High-Resolution Structure Of The Trimeric ScarWAVE COMPLEX 
PRECURSOR Brk1
Length=73

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  30   GITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            G   +++    +Q DWE REFI ++S+N++++ +FL +FE++T++KL+ LNEKL
Sbjct  1    GPLGSMSTKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKL  54



>ref|XP_008352566.1| PREDICTED: protein BRICK 1-like [Malus domestica]
Length=64

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +3

Query  129  DFLVQFEVTTKSKLASLNEKLDTlerrlelleVQVSTATANPALF  263
            +FL++FE +TKSKLASLNEKLD LER+LELLEVQV TA+ANP+LF
Sbjct  16   EFLIRFEASTKSKLASLNEKLDVLERKLELLEVQVGTASANPSLF  60



>ref|XP_641829.1| component of SCAR regulatory complex [Dictyostelium discoideum 
AX4]
 sp|Q54X65.1|BRK1_DICDI RecName: Full=Protein BRICK1 [Dictyostelium discoideum]
 gb|EAL67856.1| component of SCAR regulatory complex [Dictyostelium discoideum 
AX4]
Length=68

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DWE REFI ++S+N++++ +FL +FE++T++KL+ LNEKL
Sbjct  7    IQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKL  49



>ref|XP_004360471.1| component of SCAR regulatory complex [Dictyostelium fasciculatum]
 gb|EGG22620.1| component of SCAR regulatory complex [Dictyostelium fasciculatum]
Length=67

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DWE REF   ISLN++++ DFL +F+++T++KLA++NEKL
Sbjct  6    IQRDWEQREFNEEISLNIQKIIDFLNKFDLSTRNKLATVNEKL  48



>gb|AGW80639.1| BRK1, partial [Physcomitrella readeri]
Length=34

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  96   SNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            S++SLNVRRLF+FL+QFE +T+SKLASLNEKL
Sbjct  1    SSLSLNVRRLFEFLLQFESSTRSKLASLNEKL  32



>ref|XP_974722.3| PREDICTED: probable protein BRICK1-B [Tribolium castaneum]
Length=76

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  48   NVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
             V   +Q DW NRE+I  I+++++++ DFL  F+++ +SKLA LNEKL T
Sbjct  8    TVPKPIQQDWVNREYIEVITVSIKKITDFLNSFDLSCRSKLAVLNEKLTT  57



>ref|XP_004352072.1| hypothetical protein ACA1_036220 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22933.1| hypothetical protein ACA1_036220 [Acanthamoeba castellanii str. 
Neff]
Length=78

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DWE REFI ++++N++++ +FL +F+++T+ KLA +NEKL
Sbjct  8    IQRDWEQREFIEDVTVNIKKVTEFLNRFDISTRYKLARINEKL  50



>ref|XP_004992386.1| BRICK 1 protein [Salpingoeca rosetta]
 gb|EGD75333.1| BRICK 1 protein [Salpingoeca rosetta]
Length=133

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  60   AVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            A+QADW+ REF+  IS  +RR+ +FL  F+ +T+ +LA LNEKL
Sbjct  68   AIQADWQTREFVETISSGIRRITEFLNDFDNSTRYRLAVLNEKL  111



>ref|XP_003746479.1| PREDICTED: probable protein BRICK1-A-like [Metaseiulus occidentalis]
Length=73

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  51   VGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            V   +Q DW NRE+I  IS +++++ DFL  F+++ +++LA+LNEKL
Sbjct  6    VARGIQQDWSNREYIEIISGSIKKIADFLTSFDMSCRARLATLNEKL  52



>gb|EGW06212.1| putative protein BRICK1 [Cricetulus griseus]
Length=89

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrlelleVQVSTA  242
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL  LERR+E +E +VS  
Sbjct  12   IHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVSMV  71

Query  243  TANP  254
            T+ P
Sbjct  72   TSYP  75



>ref|XP_005777074.1| hypothetical protein EMIHUDRAFT_206700 [Emiliania huxleyi CCMP1516]
 gb|EOD24645.1| hypothetical protein EMIHUDRAFT_206700 [Emiliania huxleyi CCMP1516]
Length=81

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            VQ DWE REF  +I L ++ L  FL +FE TT++KLASLN K+
Sbjct  14   VQRDWEEREFAQSIQLGIKSLAQFLNEFENTTRTKLASLNSKI  56



>emb|CDW58344.1| hypothetical protein TTRE_0000665301 [Trichuris trichiura]
Length=64

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            +Q DW NREFI+  S+NV+++ DFL  FE++ + K A +NEKL+
Sbjct  1    MQEDWNNREFINVFSVNVKKIADFLTSFELSCRHKFALMNEKLN  44



>ref|XP_009011910.1| hypothetical protein HELRODRAFT_156389 [Helobdella robusta]
 gb|ESO10096.1| hypothetical protein HELRODRAFT_156389 [Helobdella robusta]
Length=71

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  ++ +++++ DFL  F+++ +SKLA+LNEKL T
Sbjct  8    IQQDWVNREYIELMTCSIKKVTDFLNSFDMSCRSKLATLNEKLTT  52



>ref|XP_009055596.1| hypothetical protein LOTGIDRAFT_105126 [Lottia gigantea]
 gb|ESO93986.1| hypothetical protein LOTGIDRAFT_105126 [Lottia gigantea]
Length=78

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  60   AVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             +Q DW NRE++  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  14   PIQQDWANREYVEVITCSIKKISDFLNSFDMSCRSRLATLNEKL  57



>ref|XP_004345416.1| hypothetical protein CAOG_05826 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95373.1| hypothetical protein CAOG_005826 [Capsaspora owczarzaki ATCC 
30864]
Length=72

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            VQ DWENRE +  IS  V+R+  FL  F+ +T+ +LA+LNEKL
Sbjct  8    VQRDWENRELVEEISSAVKRIASFLTTFDSSTRYRLAALNEKL  50



>ref|XP_002406594.1| conserved hypothetical protein [Ixodes scapularis]
 gb|AAY66861.1| unknown [Ixodes scapularis]
 gb|EEC01654.1| conserved hypothetical protein [Ixodes scapularis]
Length=76

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW NRE+I  IS +++++ DFL  F+++ +++LA+LNEKL
Sbjct  13   IQQDWANREYIEIISGSIKKIADFLTSFDMSCRARLATLNEKL  55



>gb|AGW80636.1| BRK1, partial [Aphanorrhegma serratum]
Length=32

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  102  ISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +SLNVRRLF+FL+QFE +T+SKLA+LNEKL
Sbjct  1    LSLNVRRLFEFLLQFESSTRSKLATLNEKL  30



>gb|ELT90738.1| hypothetical protein CAPTEDRAFT_167653 [Capitella teleta]
Length=80

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            MA     T    V   +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  1    MASRDPQTQMTLVQRQIQQDWANREYIEVITGSIKKISDFLNSFDLSCRSRLATLNEKL  59



>ref|XP_004536815.1| PREDICTED: probable protein BRICK1-B-like isoform X1 [Ceratitis 
capitata]
Length=76

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLST  57



>ref|XP_005632227.1| PREDICTED: probable protein BRICK1-like [Canis lupus familiaris]
Length=112

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    RSGKMARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLN  182
            RSG +  A        V   +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LN
Sbjct  29   RSGSLQAAAMAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLN  88

Query  183  EKL  191
            EKL
Sbjct  89   EKL  91



>ref|XP_003910378.1| PREDICTED: protein BRICK1 [Papio anubis]
Length=75

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ N++++ DFL  F ++ +S+LA+LNEKL
Sbjct  12   IHQDWPNREYIEIITSNIKKIADFLNSFHMSCRSRLATLNEKL  54



>ref|XP_005182216.1| PREDICTED: probable protein BRICK1-B [Musca domestica]
Length=76

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTT  57



>ref|XP_002063473.1| GK21927 [Drosophila willistoni]
 gb|EDW74459.1| GK21927 [Drosophila willistoni]
Length=76

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTT  57



>gb|KFD63622.1| hypothetical protein M514_09673 [Trichuris suis]
Length=484

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  48   NVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            +V   +Q DW NREFI+  SLNV+++ DFL  FE++ + K A +NE+L+
Sbjct  12   DVETQLQEDWNNREFINVFSLNVKKIADFLTSFELSCRYKFALMNEQLN  60



>ref|XP_001176942.1| PREDICTED: protein BRICK1 [Strongylocentrotus purpuratus]
Length=77

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW NRE+I  I+ N++++ DFL  F+ + +S+LA LNEKL
Sbjct  14   IQEDWANREYIEIITTNIKKIADFLNSFDTSCRSRLAILNEKL  56



>ref|XP_002737834.1| PREDICTED: probable protein BRICK1-B-like [Saccoglossus kowalevskii]
Length=78

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +3

Query  15   MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            MA  G   ++V   I  Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  1    MAPIGSRESSVQRQI--QQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  57



>ref|XP_308258.2| AGAP007614-PA [Anopheles gambiae str. PEST]
 ref|XP_001653570.1| AAEL001544-PA [Aedes aegypti]
 ref|XP_001647599.1| AAEL015617-PA [Aedes aegypti]
 ref|XP_001841820.1| syntaxin Interacting protein 1 [Culex quinquefasciatus]
 gb|EAA04587.2| AGAP007614-PA [Anopheles gambiae str. PEST]
 gb|EAT32267.1| AAEL015617-PA [Aedes aegypti]
 gb|EAT47308.1| AAEL001544-PA [Aedes aegypti]
 gb|EDS31673.1| syntaxin Interacting protein 1 [Culex quinquefasciatus]
 gb|ETN61415.1| syntaxin Interacting protein 1 [Anopheles darlingi]
Length=75

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL T
Sbjct  12   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTT  56



>ref|XP_011426774.1| PREDICTED: protein BRICK1-like [Crassostrea gigas]
Length=85

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  60   AVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             +Q DW NRE+I  I+ +++++ DFL  F+ + +S+LA+LNEKL
Sbjct  21   PIQQDWANREYIEVITGSIKKISDFLNSFDTSCRSRLATLNEKL  64



>ref|XP_005578995.1| PREDICTED: protein BRICK1-like [Macaca fascicularis]
Length=75

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ N++++ DFL  F ++ +S+LA+LNEKL
Sbjct  12   IHQDWPNREYIEIITSNIKKIADFLNSFNMSCRSRLATLNEKL  54



>gb|AGW80628.1| BRK1, partial [Funaria hygrometrica]
Length=31

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  105  SLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            SLNVRRLF+FL+QFE +T+SKLA+LNEKL
Sbjct  1    SLNVRRLFEFLLQFESSTRSKLATLNEKL  29



>ref|XP_004926995.1| PREDICTED: probable protein BRICK1-B-like [Bombyx mori]
Length=76

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLATLNEKL  55



>ref|XP_007631517.1| PREDICTED: LOW QUALITY PROTEIN: protein BRICK1 [Cricetulus griseus]
Length=158

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  54   GIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            GI    DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  92   GIHPAQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKL  137



>gb|EHJ65206.1| putative syntaxin interacting protein 1 [Danaus plexippus]
Length=76

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLATLNEKL  55



>ref|XP_002806005.1| PREDICTED: probable protein BRICK1-like [Macaca mulatta]
Length=75

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ N++++ DFL  F ++ +S+LA+LNEKL
Sbjct  12   IHQDWPNREYIEIITSNIKKIADFLNSFNMSCRSRLATLNEKL  54



>ref|XP_001601160.1| PREDICTED: protein BRICK1 [Nasonia vitripennis]
Length=76

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLAVLNEKLTT  57



>ref|XP_011299974.1| PREDICTED: probable protein BRICK1-B [Fopius arisanus]
Length=76

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLAVLNEKLTT  57



>ref|XP_008556779.1| PREDICTED: probable protein BRICK1-B [Microplitis demolitor]
Length=76

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLAVLNEKLST  57



>gb|ABR27847.1| syntaxin interacting protein 1 [Triatoma infestans]
Length=76

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLAVLNEKLTT  57



>gb|KFD49406.1| hypothetical protein M513_09673 [Trichuris suis]
Length=420

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  48   NVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            +V   +Q DW NREFI+  SLNV+++ DFL  FE++ + K A +NE+L+
Sbjct  12   DVETQLQEDWNNREFINVFSLNVKKIADFLTSFELSCRYKFALMNEQLN  60



>gb|KHJ45139.1| hypothetical protein D918_04443 [Trichuris suis]
Length=463

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  48   NVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD  194
            +V   +Q DW NREFI+  SLNV+++ DFL  FE++ + K A +NE+L+
Sbjct  12   DVETQLQEDWNNREFINVFSLNVKKIADFLTSFELSCRYKFALMNEQLN  60



>ref|XP_011496641.1| PREDICTED: probable protein BRICK1-B isoform X1 [Ceratosolen 
solmsi marchali]
Length=76

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLAVLNEKLTT  57



>ref|XP_002132174.2| PREDICTED: probable protein BRICK1-A [Ciona intestinalis]
Length=98

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW NRE+I  IS +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  35   IQRDWANREYIEVISSSIKKIADFLNGFDLSCRSRLATLNEKL  77



>ref|XP_003217597.2| PREDICTED: protein BRICK1 [Anolis carolinensis]
Length=110

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +3

Query  24   AGGITNAVNVGIAVQ---------ADWENREFISNISLNVRRLFDFLVQFEVTTKSKLAS  176
            AG ++ A +  ++VQ          DW NRE+I  I+ +++++ DFL  F+++ +S+LA+
Sbjct  25   AGVVSGAGDAAMSVQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLAT  84

Query  177  LNEKL  191
            LNEKL
Sbjct  85   LNEKL  89



>ref|XP_011347559.1| PREDICTED: probable protein BRICK1-B isoform X2 [Cerapachys biroi]
Length=76

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S++A LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRIAGLNEKLTT  57



>gb|ACO11207.1| Probable protein BRICK1 [Caligus rogercresseyi]
Length=87

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             QADW NRE+I  I+ +++R+ DFL  F+ + +S+L++LNEKL
Sbjct  19   TQADWANREYIELITGSIKRIADFLNSFDTSCRSRLSNLNEKL  61



>ref|XP_002799727.1| PREDICTED: probable protein BRICK1-like [Macaca mulatta]
Length=75

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ N++++ DFL  F ++ +S+LA+LNEKL
Sbjct  12   IHQDWPNREYIEIITSNIKKIADFLNSFNMSCRSRLATLNEKL  54



>gb|ACO12543.1| Probable protein BRICK1 [Lepeophtheirus salmonis]
 gb|ADD38825.1| Probable protein BRICK1 [Lepeophtheirus salmonis]
Length=86

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             QADW NRE+I  I+ +++R+ DFL  F+ + +S+L++LNEKL
Sbjct  19   TQADWANREYIELITGSIKRIADFLNSFDTSCRSRLSNLNEKL  61



>ref|NP_001165171.1| probable protein BRICK1-B [Xenopus laevis]
 sp|A2BD66.1|BRK1B_XENLA RecName: Full=Probable protein BRICK1-B [Xenopus laevis]
 gb|AAI28953.1| LOC100037105 protein [Xenopus laevis]
Length=75

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL T
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTT  56



>gb|ACO10920.1| Probable protein BRICK1 [Caligus rogercresseyi]
Length=87

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             QADW NRE+I  I+ +++R+ DFL  F+ + +S+L++LNEKL
Sbjct  19   TQADWANREYIELITGSIKRIADFLNSFDTSCRSRLSNLNEKL  61



>ref|XP_008483290.1| PREDICTED: probable protein BRICK1-B isoform X1 [Diaphorina citri]
 ref|XP_008483291.1| PREDICTED: probable protein BRICK1-B isoform X1 [Diaphorina citri]
 ref|XP_008483292.1| PREDICTED: probable protein BRICK1-B isoform X2 [Diaphorina citri]
Length=76

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEIITGSIKKITDFLNSFDMSCRSRLAVLNEKLTT  57



>ref|NP_726400.1| HSPC300, isoform A [Drosophila melanogaster]
 ref|NP_001286810.1| HSPC300, isoform B [Drosophila melanogaster]
 ref|XP_001360881.1| GA15698 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001959469.1| GF12040 [Drosophila ananassae]
 ref|XP_001976528.1| GG19964 [Drosophila erecta]
 ref|XP_002016566.1| GL10432 [Drosophila persimilis]
 ref|XP_002037487.1| GM18284 [Drosophila sechellia]
 ref|XP_002092746.1| GE11496 [Drosophila yakuba]
 gb|AAM68291.1| HSPC300, isoform A [Drosophila melanogaster]
 gb|EAL25456.1| GA15698 [Drosophila pseudoobscura pseudoobscura]
 gb|EDV36291.1| GF12040 [Drosophila ananassae]
 gb|EDV56928.1| GG19964 [Drosophila erecta]
 gb|EDW32456.1| GL10432 [Drosophila persimilis]
 gb|EDW53905.1| GM18284 [Drosophila sechellia]
 gb|EDW92458.1| GE11496 [Drosophila yakuba]
 gb|ADE10186.2| FI14118p [Drosophila melanogaster]
 gb|AHN56605.1| HSPC300, isoform B [Drosophila melanogaster]
Length=76

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL
Sbjct  13   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKL  55



>gb|KDR08993.1| putative protein BRICK1-B, partial [Zootermopsis nevadensis]
Length=70

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLAVLNEKLTT  57



>ref|XP_001987077.1| GH20169 [Drosophila grimshawi]
 gb|EDW01944.1| GH20169 [Drosophila grimshawi]
Length=76

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL
Sbjct  13   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKL  55



>ref|XP_002005836.1| GI20687 [Drosophila mojavensis]
 gb|EDW09771.1| GI20687 [Drosophila mojavensis]
Length=76

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL
Sbjct  13   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKL  55



>dbj|BAN21323.1| conserved hypothetical protein [Riptortus pedestris]
Length=76

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S+LA LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRLAVLNEKLTT  57



>ref|XP_002050000.1| GJ21896 [Drosophila virilis]
 gb|EDW61193.1| GJ21896 [Drosophila virilis]
Length=76

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL
Sbjct  13   IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKL  55



>ref|XP_008284280.1| PREDICTED: protein BRICK1 isoform X1 [Stegastes partitus]
Length=102

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  39   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  81



>ref|XP_001631572.1| predicted protein [Nematostella vectensis]
 gb|EDO39509.1| predicted protein [Nematostella vectensis]
Length=71

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW+NREF+  +S  ++++ +FL  F+++ +SKLA LNEK+
Sbjct  8    IQEDWQNREFVEVVSEGIKKIAEFLNDFDISCRSKLAKLNEKV  50



>ref|XP_011347558.1| PREDICTED: probable protein BRICK1-B isoform X1 [Cerapachys biroi]
 gb|EZA48785.1| putative protein BRICK1-B [Cerapachys biroi]
Length=77

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S++A LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRIAGLNEKLTT  57



>ref|XP_003132409.3| PREDICTED: probable protein BRICK1-like isoform 1 [Sus scrofa]
Length=103

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  40   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  82



>ref|XP_001750252.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84911.1| predicted protein [Monosiga brevicollis MX1]
Length=1203

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 11/79 (14%)
 Frame = +3

Query  12    KMARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             KMA+AG           +QADWE REFI  +S +V R+ +FL  F+ +T+ +LA LN++L
Sbjct  1133  KMAQAG-----------IQADWEAREFIQTVSASVGRIAEFLNAFDSSTRYRLAELNQRL  1181

Query  192   DTlerrlelleVQVSTATA  248
              +LER LE +E +V+ A +
Sbjct  1182  TSLERSLEFVEAKVAKAKS  1200



>ref|XP_004402293.1| PREDICTED: probable protein BRICK1-like [Odobenus rosmarus divergens]
Length=75

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +  DW NRE+I  I+ +++++ DFL  F+++  S+LA+LNEKL T
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCHSRLATLNEKLTT  56



>ref|XP_008696116.1| PREDICTED: protein BRICK1 [Ursus maritimus]
Length=112

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  49   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  91



>ref|XP_003399198.1| PREDICTED: probable protein BRICK1-B-like [Bombus terrestris]
 ref|XP_003487934.1| PREDICTED: probable protein BRICK1-B-like [Bombus impatiens]
 ref|XP_003698127.1| PREDICTED: probable protein BRICK1-B-like [Apis florea]
 ref|XP_003705312.1| PREDICTED: probable protein BRICK1-B-like [Megachile rotundata]
Length=76

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S++A LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRIAVLNEKLTT  57



>gb|EFZ16776.1| hypothetical protein SINV_09386 [Solenopsis invicta]
Length=70

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S++A LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRIAVLNEKLTT  57



>gb|AAF28978.1|AF161418_1 HSPC300 [Homo sapiens]
Length=110

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  16   IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL  58



>ref|XP_006618314.1| PREDICTED: probable protein BRICK1-B-like [Apis dorsata]
 ref|XP_011061598.1| PREDICTED: probable protein BRICK1-B [Acromyrmex echinatior]
 ref|XP_011145562.1| PREDICTED: probable protein BRICK1-B [Harpegnathos saltator]
 ref|XP_011161946.1| PREDICTED: probable protein BRICK1-B [Solenopsis invicta]
 gb|EGI61116.1| Putative protein BRICK1-B [Acromyrmex echinatior]
Length=76

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S++A LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRIAVLNEKLTT  57



>gb|EFN89139.1| Probable protein BRICK1-B [Harpegnathos saltator]
Length=77

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +Q DW NRE+I  I+ +++++ DFL  F+++ +S++A LNEKL T
Sbjct  13   IQQDWANREYIEVITGSIKKITDFLNSFDMSCRSRIAVLNEKLTT  57



>ref|XP_005063131.1| PREDICTED: probable protein BRICK1-A-like, partial [Ficedula 
albicollis]
Length=66

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  2    IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  44



>gb|KFO38349.1| Protein BRICK1 [Fukomys damarensis]
Length=95

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_007888486.1| PREDICTED: protein BRICK1 [Callorhinchus milii]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_010336090.1| PREDICTED: protein BRICK1 [Saimiri boliviensis boliviensis]
Length=103

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  40   IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL  82



>gb|KFM63396.1| Hypothetical protein BRICK1-B, partial [Stegodyphus mimosarum]
Length=76

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW NRE++  I+ +++++ DFL  F+++ +++LA+LNEKL
Sbjct  13   IQQDWANREYVEIITASIKKIADFLNSFDMSCRARLATLNEKL  55



>ref|XP_001365620.1| PREDICTED: probable protein BRICK1-like [Monodelphis domestica]
 ref|XP_004702302.1| PREDICTED: probable protein BRICK1-like [Echinops telfairi]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKITDFLNSFDMSCRSRLATLNEKL  54



>ref|XP_005987080.1| PREDICTED: probable protein BRICK1-like [Latimeria chalumnae]
Length=76

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  13   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  55



>gb|ACM08703.1| Probable protein BRICK1 [Salmo salar]
 gb|ACQ58316.1| Probable protein BRICK1 [Anoplopoma fimbria]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_008980387.1| PREDICTED: protein BRICK1 [Callithrix jacchus]
Length=103

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  40   IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL  82



>ref|NP_001002097.1| probable protein BRICK1 [Danio rerio]
 ref|NP_001107982.1| protein BRICK1 [Bos taurus]
 ref|NP_001187555.1| probable protein brick1 [Ictalurus punctatus]
 ref|XP_001493938.1| PREDICTED: probable protein BRICK1-like [Equus caballus]
 ref|XP_002722494.1| PREDICTED: protein BRICK1 [Oryctolagus cuniculus]
 ref|XP_002925069.1| PREDICTED: protein BRICK1 [Ailuropoda melanoleuca]
 ref|XP_003409808.1| PREDICTED: protein BRICK1 [Loxodonta africana]
 ref|XP_003448382.1| PREDICTED: probable protein BRICK1-like [Oreochromis niloticus]
 ref|XP_003973371.1| PREDICTED: probable protein BRICK1-like [Takifugu rubripes]
 ref|XP_003982515.1| PREDICTED: protein BRICK1 [Felis catus]
 ref|XP_004018320.1| PREDICTED: probable protein BRICK1-like isoform 1 [Ovis aries]
 ref|XP_004018321.1| PREDICTED: probable protein BRICK1-like isoform 2 [Ovis aries]
 ref|XP_004068656.1| PREDICTED: protein BRICK1 [Oryzias latipes]
 ref|XP_004274874.1| PREDICTED: probable protein BRICK1-like [Orcinus orca]
 ref|XP_004311998.1| PREDICTED: probable protein BRICK1-like [Tursiops truncatus]
 ref|XP_004368377.1| PREDICTED: probable protein BRICK1-like [Trichechus manatus latirostris]
 ref|XP_004392744.1| PREDICTED: probable protein BRICK1-like [Odobenus rosmarus divergens]
 ref|XP_004452747.1| PREDICTED: probable protein BRICK1-like [Dasypus novemcinctus]
 ref|XP_004453005.1| PREDICTED: probable protein BRICK1-like [Dasypus novemcinctus]
 ref|XP_004476063.1| PREDICTED: probable protein BRICK1-like [Dasypus novemcinctus]
 ref|XP_004548765.1| PREDICTED: probable protein BRICK1-like [Maylandia zebra]
 ref|XP_004581356.1| PREDICTED: probable protein BRICK1-like [Ochotona princeps]
 ref|XP_004692436.1| PREDICTED: probable protein BRICK1-like [Condylura cristata]
 ref|XP_004793366.1| PREDICTED: probable protein BRICK1-like [Mustela putorius furo]
 ref|XP_005172960.1| PREDICTED: probable protein BRICK1 isoform X1 [Danio rerio]
 ref|XP_005333864.1| PREDICTED: probable protein BRICK1-like [Ictidomys tridecemlineatus]
 ref|XP_005724571.1| PREDICTED: probable protein BRICK1-like [Pundamilia nyererei]
 ref|XP_005695669.1| PREDICTED: probable protein BRICK1-like [Capra hircus]
 ref|XP_005796970.1| PREDICTED: probable protein BRICK1-like [Xiphophorus maculatus]
 ref|XP_005927538.1| PREDICTED: probable protein BRICK1-like [Haplochromis burtoni]
 ref|XP_005907120.1| PREDICTED: probable protein BRICK1-like [Bos mutus]
 ref|XP_005984346.1| PREDICTED: probable protein BRICK1-like [Pantholops hodgsonii]
 ref|XP_006173393.1| PREDICTED: probable protein BRICK1-like [Camelus ferus]
 ref|XP_006206877.1| PREDICTED: probable protein BRICK1-like [Vicugna pacos]
 ref|XP_006152063.1| PREDICTED: probable protein BRICK1-like isoform X1 [Tupaia chinensis]
 ref|XP_006152064.1| PREDICTED: probable protein BRICK1-like isoform X2 [Tupaia chinensis]
 ref|XP_006630743.1| PREDICTED: probable protein BRICK1-like [Lepisosteus oculatus]
 ref|XP_006783195.1| PREDICTED: probable protein BRICK1-like [Neolamprologus brichardi]
 ref|XP_006887740.1| PREDICTED: probable protein BRICK1-like [Elephantulus edwardii]
 ref|XP_006917675.1| PREDICTED: probable protein BRICK1-like [Pteropus alecto]
 ref|XP_007113785.1| PREDICTED: probable protein BRICK1-like [Physeter catodon]
 ref|XP_006070758.1| PREDICTED: probable protein BRICK1-like [Bubalus bubalis]
 ref|XP_007192623.1| PREDICTED: probable protein BRICK1-like [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007254613.1| PREDICTED: probable protein BRICK1-like [Astyanax mexicanus]
 ref|XP_007451606.1| PREDICTED: probable protein BRICK1-like [Lipotes vexillifer]
 ref|XP_007551087.1| PREDICTED: protein BRICK1 [Poecilia formosa]
 ref|XP_007517166.1| PREDICTED: protein BRICK1 [Erinaceus europaeus]
 ref|XP_007944010.1| PREDICTED: protein BRICK1 [Orycteropus afer afer]
 ref|XP_008066527.1| PREDICTED: probable protein BRICK1 [Tarsius syrichta]
 ref|XP_008057841.1| PREDICTED: protein BRICK1 [Tarsius syrichta]
 ref|XP_008284288.1| PREDICTED: protein BRICK1 isoform X2 [Stegastes partitus]
 ref|XP_008317912.1| PREDICTED: protein BRICK1 [Cynoglossus semilaevis]
 ref|XP_008406940.1| PREDICTED: protein BRICK1 [Poecilia reticulata]
 ref|XP_008534297.1| PREDICTED: protein BRICK1 [Equus przewalskii]
 ref|XP_008590060.1| PREDICTED: protein BRICK1 [Galeopterus variegatus]
 ref|XP_010731093.1| PREDICTED: protein BRICK1 [Larimichthys crocea]
 ref|XP_010792913.1| PREDICTED: protein BRICK1 [Notothenia coriiceps]
 ref|XP_010840413.1| PREDICTED: protein BRICK1 [Bison bison bison]
 ref|XP_010879866.1| PREDICTED: probable protein BRICK1 [Esox lucius]
 ref|XP_010951338.1| PREDICTED: protein BRICK1 [Camelus bactrianus]
 ref|XP_010983244.1| PREDICTED: protein BRICK1 [Camelus dromedarius]
 ref|XP_011368873.1| PREDICTED: protein BRICK1 [Pteropus vampyrus]
 sp|Q6IQ86.1|BRK1_DANRE RecName: Full=Probable protein BRICK1 [Danio rerio]
 gb|AAH71524.1| Zgc:86903 [Danio rerio]
 gb|AAI02223.1| C22H3ORF10 protein [Bos taurus]
 gb|AAI54587.1| Zgc:86903 [Danio rerio]
 gb|ACI69530.1| Probable protein BRICK1 [Salmo salar]
 gb|ACI69711.1| Probable protein BRICK1 [Salmo salar]
 gb|ACI69865.1| Probable protein BRICK1 [Salmo salar]
 gb|ACM08464.1| Probable protein BRICK1 [Salmo salar]
 gb|ACM08902.1| Probable protein BRICK1 [Salmo salar]
 gb|ACM09036.1| Probable protein BRICK1 [Salmo salar]
 gb|ACM09135.1| Probable protein BRICK1 [Salmo salar]
 gb|ACM09254.1| Probable protein BRICK1 [Salmo salar]
 gb|ACM09350.1| Probable protein BRICK1 [Salmo salar]
 gb|ACM09749.1| Probable protein BRICK1 [Salmo salar]
 gb|ACQ58640.1| Probable protein BRICK1 [Anoplopoma fimbria]
 gb|ACQ59067.1| Probable protein BRICK1 [Anoplopoma fimbria]
 tpg|DAA17182.1| TPA: chromosome 3 open reading frame 10 ortholog [Bos taurus]
 gb|ADM16222.1| Probable protein BRICK1 [Salmo salar]
 gb|ADO28809.1| probable protein brick1 [Ictalurus punctatus]
 emb|CBN80580.1| Probable protein BRICK1 [Dicentrarchus labrax]
 emb|CDQ64247.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ61011.1| unnamed protein product [Oncorhynchus mykiss]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|NP_001165164.1| probable protein BRICK1-A [Xenopus laevis]
 sp|Q6P7G6.1|BRK1A_XENLA RecName: Full=Probable protein BRICK1-A [Xenopus laevis]
 gb|AAH61677.1| MGC68812 protein [Xenopus laevis]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_006885337.1| PREDICTED: probable protein BRICK1-like [Elephantulus edwardii]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_010891397.1| PREDICTED: probable protein BRICK1 [Esox lucius]
 gb|ACI68212.1| Probable protein BRICK1 [Salmo salar]
 gb|ACI68790.1| Probable protein BRICK1 [Salmo salar]
 gb|ACO14378.1| Probable protein BRICK1 [Esox lucius]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>gb|ELR48079.1| Putative protein BRICK1, partial [Bos mutus]
Length=69

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|NP_060932.2| protein BRICK1 [Homo sapiens]
 ref|XP_003785493.1| PREDICTED: protein BRICK1 [Otolemur garnettii]
 ref|XP_003826340.1| PREDICTED: protein BRICK1 [Pan paniscus]
 ref|XP_003950077.1| PREDICTED: protein BRICK1 [Pan troglodytes]
 ref|XP_004033635.1| PREDICTED: protein BRICK1 [Gorilla gorilla gorilla]
 ref|XP_004033636.1| PREDICTED: protein BRICK1 [Gorilla gorilla gorilla]
 ref|XP_006083910.1| PREDICTED: protein BRICK1 [Myotis lucifugus]
 ref|XP_006758322.1| PREDICTED: protein BRICK1 [Myotis davidii]
 ref|XP_007983400.1| PREDICTED: protein BRICK1 [Chlorocebus sabaeus]
 ref|XP_008150225.1| PREDICTED: protein BRICK1 [Eptesicus fuscus]
 ref|XP_010367686.1| PREDICTED: protein BRICK1 [Rhinopithecus roxellana]
 sp|Q8WUW1.1|BRK1_HUMAN RecName: Full=Protein BRICK1; Short=BRK1 [Homo sapiens]
 pdb|3P8C|E Chain E, Structure And Control Of The Actin Regulatory Wave Complex
 pdb|4N78|E Chain E, The Wave Regulatory Complex Links Diverse Receptors 
To The Actin Cytoskeleton
 gb|AAH19303.1| Chromosome 3 open reading frame 10 [Homo sapiens]
 gb|AAN60161.1| Brk1-like protein [Homo sapiens]
 gb|AAN60162.1| Brk1-like protein [Homo sapiens]
 gb|AAH01067.1| Chromosome 3 open reading frame 10 [Homo sapiens]
 gb|AAH07929.1| Chromosome 3 open reading frame 10 [Homo sapiens]
 dbj|BAE88127.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE89605.1| unnamed protein product [Macaca fascicularis]
 gb|EAW64061.1| chromosome 3 open reading frame 10, isoform CRA_b [Homo sapiens]
 gb|ABM83882.1| chromosome 3 open reading frame 10 [synthetic construct]
 gb|ABM87202.1| chromosome 3 open reading frame 10 [synthetic construct]
 gb|ABW03861.1| chromosome 3 open reading frame 10 [synthetic construct]
 dbj|BAG35089.1| unnamed protein product [Homo sapiens]
 gb|AIC51852.1| BRK1, partial [synthetic construct]
Length=75

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|NP_001015994.1| BRICK1, SCAR/WAVE actin-nucleating complex subunit [Xenopus (Silurana) 
tropicalis]
 gb|AAI67873.1| hypothetical protein LOC548748 [Xenopus (Silurana) tropicalis]
Length=75

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_004616074.1| PREDICTED: probable protein BRICK1-like [Sorex araneus]
Length=69

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>gb|ADV40371.1| syntaxin interacting protein 1 [Latrodectus hesperus]
Length=73

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +Q DW NRE++  I+ +V+++ DFL  F+++ +++LA+LNEKL
Sbjct  10   IQQDWANREYVDIITSSVKKIADFLNSFDMSCRARLATLNEKL  52



>ref|XP_006739075.1| PREDICTED: probable protein BRICK1-like [Leptonychotes weddellii]
Length=87

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_003464128.1| PREDICTED: protein BRICK1 [Cavia porcellus]
 ref|XP_004625089.1| PREDICTED: protein BRICK1 [Octodon degus]
 ref|XP_004901961.1| PREDICTED: protein BRICK1 isoform X2 [Heterocephalus glaber]
 ref|XP_004835384.1| PREDICTED: protein BRICK1 [Heterocephalus glaber]
 ref|XP_010617492.1| PREDICTED: protein BRICK1 [Fukomys damarensis]
Length=75

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_005145867.1| PREDICTED: probable protein BRICK1-like [Melopsittacus undulatus]
 ref|XP_005522188.1| PREDICTED: probable protein BRICK1-like [Pseudopodoces humilis]
 ref|XP_006258255.1| PREDICTED: probable protein BRICK1-like isoform X1 [Alligator 
mississippiensis]
 ref|XP_006258256.1| PREDICTED: probable protein BRICK1-like isoform X2 [Alligator 
mississippiensis]
Length=75

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_003496909.2| PREDICTED: protein BRICK1 [Cricetulus griseus]
Length=155

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  92   IHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKL  134



>emb|CDQ98757.1| unnamed protein product [Oncorhynchus mykiss]
Length=75

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>gb|EHB13886.1| Putative protein BRICK1, partial [Heterocephalus glaber]
Length=69

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>gb|EAW64060.1| chromosome 3 open reading frame 10, isoform CRA_a [Homo sapiens]
Length=73

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|NP_598698.1| protein BRICK1 [Mus musculus]
 ref|NP_001182405.1| protein BRICK1 [Rattus norvegicus]
 ref|XP_005066194.1| PREDICTED: protein BRICK1 isoform X1 [Mesocricetus auratus]
 ref|XP_005365075.1| PREDICTED: protein BRICK1 [Microtus ochrogaster]
 ref|XP_006994761.1| PREDICTED: protein BRICK1 [Peromyscus maniculatus bairdii]
 ref|XP_008853091.1| PREDICTED: protein BRICK1 [Nannospalax galili]
 sp|Q91VR8.1|BRK1_MOUSE RecName: Full=Protein BRICK1; Short=BRK1 [Mus musculus]
 gb|AAH10582.1| RIKEN cDNA 6720456B07 gene [Mus musculus]
 dbj|BAC25616.1| unnamed protein product [Mus musculus]
 dbj|BAE29768.1| unnamed protein product [Mus musculus]
 dbj|BAE37248.1| unnamed protein product [Mus musculus]
 gb|EDK99488.1| RIKEN cDNA 6720456B07, isoform CRA_a [Mus musculus]
 gb|EDL91549.1| rCG56448, isoform CRA_a [Rattus norvegicus]
 gb|EDL91550.1| rCG56448, isoform CRA_a [Rattus norvegicus]
Length=75

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKL  54



>ref|XP_004795606.1| PREDICTED: probable protein BRICK1-like [Mustela putorius furo]
Length=75

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_005285695.1| PREDICTED: protein BRICK1 [Chrysemys picta bellii]
Length=75

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>dbj|BAE38874.1| unnamed protein product [Mus musculus]
Length=75

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKL  54



>gb|ACO15218.1| Probable protein BRICK1 [Caligus clemensi]
Length=97

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrlelleVQVSTA  242
             Q DW NRE+I  ++ +++R+ DFL  F+ + +S+L+SL++KL  LERR++ LE  V++ 
Sbjct  15   TQGDWSNREYIELMTGSIKRISDFLNSFDTSCRSRLSSLDQKLSCLERRVDYLEASVTST  74

Query  243  TANP  254
             ++P
Sbjct  75   ASSP  78



>ref|XP_004651511.1| PREDICTED: protein BRICK1 [Jaculus jaculus]
Length=75

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            ++ DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IRQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKL  54



>gb|ACO15298.1| Probable protein BRICK1 [Caligus clemensi]
Length=97

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrlelleVQVSTA  242
             Q DW NRE+I  ++ +++R+ DFL  F+ + +S+L+SL++KL  LERR++ LE  V++ 
Sbjct  15   TQGDWSNREYIELMTGSIKRISDFLNSFDTSCRSRLSSLDQKLSCLERRVDYLEASVTST  74

Query  243  TANP  254
             ++P
Sbjct  75   ASSP  78



>ref|XP_004901960.1| PREDICTED: protein BRICK1 isoform X1 [Heterocephalus glaber]
Length=114

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>gb|ACM09764.1| Probable protein BRICK1 [Salmo salar]
Length=75

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITNSIKKIADFLNSFDMSCRSRLATLNEKL  54



>gb|ETE70885.1| Protein BRICK1, partial [Ophiophagus hannah]
Length=110

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  46   IHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKL  88



>gb|ERE66940.1| protein BRICK1-like protein [Cricetulus griseus]
Length=94

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKL  54



>ref|XP_002423101.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB10363.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=76

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            ++ DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL
Sbjct  13   IEQDWANREYIELITGSIKRITDFLNSFDMSCRSRLAVLNEKL  55



>ref|XP_007075535.1| PREDICTED: probable protein BRICK1-like isoform X2 [Panthera 
tigris altaica]
Length=75

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IDQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_004738570.1| PREDICTED: probable protein BRICK1-like [Mustela putorius furo]
Length=99

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_007075534.1| PREDICTED: probable protein BRICK1-like isoform X1 [Panthera 
tigris altaica]
Length=112

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IDQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>gb|ELK34359.1| Von Hippel-Lindau disease tumor suppressor [Myotis davidii]
Length=206

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrlelleVQVSTA  242
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL  LERR+E +E +V+  
Sbjct  12   IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG  71

Query  243  TANPA  257
               PA
Sbjct  72   ETLPA  76



>gb|ELK07871.1| Putative protein BRICK1 [Pteropus alecto]
Length=147

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_005974063.1| PREDICTED: probable protein BRICK1-like [Pantholops hodgsonii]
Length=75

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+L +LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLTTLNEKL  54



>ref|XP_001582830.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAY21844.1| conserved hypothetical protein [Trichomonas vaginalis G3]
Length=79

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +3

Query  39   NAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrlel  218
            ++ +V  +V+ D++NREF  NISL + R+  FL  F    + +LA LN+KL  LERRL  
Sbjct  4    DSTSVRTSVEKDFKNREFAQNISLGMMRVVRFLNTFHSNVRGRLADLNQKLTQLERRLVF  63

Query  219  leVQVSTATANPA  257
            +E Q+   T  PA
Sbjct  64   IENQLKCCTEQPA  76



>ref|XP_007061833.1| PREDICTED: probable protein BRICK1-like [Chelonia mydas]
Length=75

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+   +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDSPCRSRLATLNEKL  54



>ref|XP_004454805.1| PREDICTED: probable protein BRICK1-like [Dasypus novemcinctus]
Length=75

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I  +++++ DFL  F+++  S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVIMSSIKKIADFLNSFDMSCHSRLATLNEKL  54



>ref|XP_003380890.1| conserved domain protein [Trichinella spiralis]
 gb|EFV59497.1| conserved domain protein [Trichinella spiralis]
Length=127

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  48   NVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDT  197
            +V + +Q DW+NR+  + IS NV+++ DFL  FE++ K K+  +NE+L++
Sbjct  12   DVKLELQEDWDNRDIAALISHNVKKISDFLCNFELSCKYKINLVNERLNS  61



>ref|XP_005870139.1| PREDICTED: protein BRICK1 [Myotis brandtii]
Length=75

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW N+E+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANQEYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_001317031.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAY04808.1| conserved hypothetical protein [Trichomonas vaginalis G3]
Length=79

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +3

Query  39   NAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrlel  218
            ++ +V  +V+ D++NREF  NISL + R+  FL  F    + +LA LN+KL  LERRL  
Sbjct  4    DSTSVRTSVEKDFKNREFAQNISLGMMRVVRFLNTFHSNVRGRLADLNQKLTQLERRLVF  63

Query  219  leVQVSTATANPA  257
            +E Q+   T  PA
Sbjct  64   IENQLKCCTDQPA  76



>ref|XP_005093794.1| PREDICTED: probable protein BRICK1-B-like isoform X4 [Aplysia 
californica]
Length=78

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  60   AVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             +Q DW NRE+I  I+ +++++ DFL  F+ + +S+LA LN+KL
Sbjct  14   PLQQDWANREYIEVITGSIKKITDFLNSFDTSCRSRLAVLNQKL  57



>ref|XP_004443656.1| PREDICTED: von Hippel-Lindau disease tumor suppressor-like [Ceratotherium 
simum simum]
Length=309

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL  54



>ref|XP_004469821.1| PREDICTED: probable protein BRICK1-like [Dasypus novemcinctus]
Length=75

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DF   F++  +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKITDFFNSFDMPCRSRLATLNEKL  54



>emb|CBY18366.1| unnamed protein product [Oikopleura dioica]
Length=76

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  33   ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrl  212
            I +A +    +Q DW NRE++  I+  ++++ DFL  F+ + + + A ++EKL TLERR+
Sbjct  2    IKDANHAQRQIQEDWNNREYVEVITTQIKKISDFLNSFDSSCRGRFAQMDEKLTTLERRI  61

Query  213  elleVQVSTATAN  251
            + LE ++S + AN
Sbjct  62   DFLEARISRSLAN  74



>gb|EMP33963.1| Putative protein BRICK1 [Chelonia mydas]
Length=68

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW N E+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  14   IHQDWANCEYIKVITSSIKKIADFLSSFDMSCRSRLATLNEKL  56



>gb|EMP33971.1| Putative protein BRICK1 [Chelonia mydas]
Length=100

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+   +S+LA+LNEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDSPCRSRLATLNEKL  54



>ref|XP_006197993.1| PREDICTED: probable protein BRICK1-like [Vicugna pacos]
Length=75

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ DFL  F+ + +S+LA+LNE L
Sbjct  12   IHQDWANREYIEVITSSIKKIADFLNSFDTSCRSRLATLNETL  54



>ref|XP_007061829.1| PREDICTED: probable protein BRICK1-like [Chelonia mydas]
Length=75

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW N E+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct  12   IHQDWANCEYIKVITSSIKKIADFLSSFDMSCRSRLATLNEKL  54



>ref|XP_005093792.1| PREDICTED: probable protein BRICK1-B-like isoform X2 [Aplysia 
californica]
 ref|XP_005093793.1| PREDICTED: probable protein BRICK1-B-like isoform X3 [Aplysia 
californica]
Length=95

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  60   AVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
             +Q DW NRE+I  I+ +++++ DFL  F+ + +S+LA LN+KL
Sbjct  14   PLQQDWANREYIEVITGSIKKITDFLNSFDTSCRSRLAVLNQKL  57



>ref|XP_003144523.1| hypothetical protein LOAG_08945 [Loa loa]
 gb|EFO19549.1| hypothetical protein LOAG_08945 [Loa loa]
Length=83

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTlerrlelleVQVSTA  242
            ++ DW NRE+   +S N+R + DFL  FE++ +S++A+L++K+  LER++E LE +VS+ 
Sbjct  15   LREDWNNREYAQVVSDNIRHIADFLCNFELSCRSRIATLSDKVSLLERKVEFLEARVSSY  74

Query  243  TA  248
             A
Sbjct  75   PA  76



>ref|XP_005675174.1| PREDICTED: probable protein BRICK1-like [Capra hircus]
Length=75

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW NRE+I  I+ +++++ +FL  F+++ +S+LA++NEKL
Sbjct  12   IHQDWANREYIEVITSSIKKIANFLNSFDMSCRSRLATINEKL  54



>emb|CEF70673.1| Protein BRICK1 [Strongyloides ratti]
Length=77

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  42   AVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
              +V   ++ DW+NR FI  +S N++ +  FL +FE++ +SKLA LN+K+
Sbjct  7    PTSVQKQLKEDWDNRLFIQVVSDNIKSISSFLAKFELSCRSKLADLNDKI  56



>ref|XP_006090498.1| PREDICTED: protein BRICK1-like [Myotis lucifugus]
 ref|XP_006108741.1| PREDICTED: protein BRICK1-like [Myotis lucifugus]
Length=75

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            +  DW N+E+I  I+ +++++ DFL  F+++  S+LA+LNEKL
Sbjct  12   IHQDWANQEYIEIITSSIKKIADFLNSFDMSCCSRLATLNEKL  54



>ref|XP_001893233.1| zgc:86903 [Brugia malayi]
Length=82

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL  191
            ++ DW NRE+   +S N+R + DFL  FE++ +S++A+L++K+
Sbjct  15   LREDWNNREYAQVVSDNIRHIADFLCNFELSCRSRIAALSDKV  57



>ref|XP_006148834.1| PREDICTED: probable protein BRICK1-like [Tupaia chinensis]
Length=75

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  51   VGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEK  188
            V   +  DWE  E+I  I+ N++++ DFL  F ++  S+LA+LNEK
Sbjct  8    VSWEIHQDWEKWEYIEVIARNIKKIMDFLNSFNMSCCSRLATLNEK  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180