BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028D22

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    234   5e-74   Nicotiana sylvestris
ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    232   4e-73   Nicotiana tomentosiformis
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    224   4e-70   Sesamum indicum [beniseed]
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    222   6e-69   Sesamum indicum [beniseed]
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    212   3e-65   Nicotiana tomentosiformis
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                211   1e-64   Erythranthe guttata [common monkey flower]
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                209   4e-64   Erythranthe guttata [common monkey flower]
emb|CDP14208.1|  unnamed protein product                                209   1e-63   Coffea canephora [robusta coffee]
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...    206   5e-63   Nicotiana sylvestris
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...    205   1e-62   Solanum lycopersicum
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...    203   1e-61   Solanum tuberosum [potatoes]
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...    193   1e-57   Solanum lycopersicum
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    191   6e-57   Vitis vinifera
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...    191   1e-56   Nicotiana tomentosiformis
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...    189   1e-56   Solanum tuberosum [potatoes]
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...    189   3e-56   Nicotiana sylvestris
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...    176   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...    174   4e-50   Prunus mume [ume]
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg             171   4e-49   Prunus persica
gb|KDP26218.1|  hypothetical protein JCGZ_22464                         167   1e-47   Jatropha curcas
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...    164   1e-46   Solanum tuberosum [potatoes]
emb|CBI30075.3|  unnamed protein product                                163   1e-46   Vitis vinifera
emb|CDY14768.1|  BnaC04g47650D                                          162   6e-46   Brassica napus [oilseed rape]
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...    162   8e-46   Fragaria vesca subsp. vesca
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    161   2e-45   
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...    160   3e-45   Brassica rapa
ref|NP_001265939.1|  Hop-interacting protein THI026                     160   4e-45   Solanum lycopersicum
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...    162   7e-45   
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    161   1e-44   
gb|KJB35924.1|  hypothetical protein B456_006G133800                    159   2e-44   Gossypium raimondii
emb|CDY06925.1|  BnaA04g23900D                                          157   8e-44   
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                  157   9e-44   Medicago truncatula
gb|AFK42347.1|  unknown                                                 155   5e-43   Medicago truncatula
gb|KJB16379.1|  hypothetical protein B456_002G227200                    155   5e-43   Gossypium raimondii
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...    155   5e-43   Tarenaya hassleriana [spider flower]
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative           153   2e-42   Ricinus communis
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...    151   6e-42   
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...    151   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg             150   5e-41   Citrus clementina [clementine]
emb|CDY23852.1|  BnaC04g01850D                                          150   5e-41   Brassica napus [oilseed rape]
ref|XP_002308908.1|  Calmodulin-like family protein                     149   6e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...    149   7e-41   Citrus sinensis [apfelsine]
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...    148   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194             147   3e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...    148   3e-40   Cicer arietinum [garbanzo]
ref|XP_002323262.1|  Calmodulin-like family protein                     147   7e-40   Populus trichocarpa [western balsam poplar]
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...    146   1e-39   Brassica rapa
emb|CDX79938.1|  BnaA05g02180D                                          146   1e-39   
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                    145   1e-39   Arabis alpina [alpine rockcress]
emb|CDY00910.1|  BnaC05g42900D                                          145   2e-39   
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...    145   2e-39   
ref|XP_010102734.1|  putative calcium-binding protein CML36             145   4e-39   
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg             144   9e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...    144   9e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg             144   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...    143   1e-38   Populus euphratica
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...    143   2e-38   Populus euphratica
ref|NP_187630.1|  putative calcium-binding protein CML36                143   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AGV22098.1|  calmodulin-like protein                                 142   2e-38   Brassica juncea [brown mustard]
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                   143   2e-38   Citrus sinensis [apfelsine]
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457             142   3e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...    142   3e-38   Phoenix dactylifera
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...    142   3e-38   Elaeis guineensis
emb|CDY60169.1|  BnaAnng16630D                                          142   4e-38   Brassica napus [oilseed rape]
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...    142   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg             140   2e-37   Capsella rubella
ref|NP_181672.1|  putative calcium-binding protein CML35                140   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61257.1|  calmodulin-like protein                                 140   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...    139   5e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...    140   6e-37   Brassica rapa
ref|XP_008800223.1|  PREDICTED: calmodulin-like                         139   6e-37   Phoenix dactylifera
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg             139   8e-37   Capsella rubella
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                   138   1e-36   Citrus sinensis [apfelsine]
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...    138   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3               137   3e-36   Elaeis guineensis
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                    137   4e-36   Arabis alpina [alpine rockcress]
emb|CAA48190.1|  calmodulin like protein                                136   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...    136   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...    135   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...    134   4e-35   Glycine max [soybeans]
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...    134   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...    134   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...    132   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...    129   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...    128   2e-32   Glycine max [soybeans]
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g             126   5e-32   Phaseolus vulgaris [French bean]
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...    125   1e-31   Eucalyptus grandis [rose gum]
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...    122   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010931583.1|  PREDICTED: probable calcium-binding protein ...    122   2e-30   Elaeis guineensis
ref|XP_008789596.1|  PREDICTED: probable calcium-binding protein ...    120   8e-30   Phoenix dactylifera
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg             119   2e-29   
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...    119   2e-29   Elaeis guineensis
ref|XP_008786895.1|  PREDICTED: probable calcium-binding protein ...    118   6e-29   Phoenix dactylifera
ref|XP_010672963.1|  PREDICTED: probable calcium-binding protein ...    117   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136671.1|  PREDICTED: probable calcium-binding protein ...    110   3e-26   
ref|XP_004159632.1|  PREDICTED: probable calcium-binding protein ...    110   3e-26   
ref|XP_008443339.1|  PREDICTED: probable calcium-binding protein ...    111   5e-26   
ref|XP_008457589.1|  PREDICTED: probable calcium-binding protein ...    109   9e-26   Cucumis melo [Oriental melon]
ref|XP_004151276.1|  PREDICTED: probable calcium-binding protein ...    105   4e-24   Cucumis sativus [cucumbers]
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like      104   6e-24   Eucalyptus grandis [rose gum]
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...    106   1e-23   
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...    103   1e-23   Sesamum indicum [beniseed]
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...    102   2e-23   Nicotiana tomentosiformis
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...    101   3e-23   Nicotiana sylvestris
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...    101   9e-23   Malus domestica [apple tree]
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg                100   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...    100   2e-22   Fragaria vesca subsp. vesca
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292            99.8    2e-22   
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...    102   2e-22   
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...  99.0    3e-22   Solanum lycopersicum
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501            99.0    4e-22   
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  99.8    4e-22   Cicer arietinum [garbanzo]
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like    98.6    5e-22   Solanum tuberosum [potatoes]
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...  99.4    5e-22   Pyrus x bretschneideri [bai li]
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...  97.8    7e-22   Solanum tuberosum [potatoes]
gb|EPS62655.1|  hypothetical protein M569_12136                       99.0    7e-22   Genlisea aurea
gb|ABK24059.1|  unknown                                                 100   8e-22   Picea sitchensis
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...  97.4    1e-21   Glycine max [soybeans]
ref|XP_007033045.1|  Calmodulin like 23, putative                     97.4    1e-21   
ref|XP_010104706.1|  putative calcium-binding protein CML25           98.2    2e-21   Morus notabilis
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...  98.2    2e-21   Cicer arietinum [garbanzo]
gb|KJB08532.1|  hypothetical protein B456_001G087100                  96.7    3e-21   Gossypium raimondii
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg           97.1    3e-21   Prunus persica
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         96.3    3e-21   Solanum lycopersicum
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like    96.3    4e-21   Nicotiana sylvestris
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...  96.7    4e-21   
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...  95.5    4e-21   Glycine max [soybeans]
gb|KHN40730.1|  Putative calcium-binding protein CML25                95.5    5e-21   Glycine soja [wild soybean]
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...  96.7    5e-21   Glycine max [soybeans]
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...  96.7    5e-21   Cucumis melo [Oriental melon]
ref|XP_011099473.1|  PREDICTED: probable calcium-binding protein ...  95.5    7e-21   Sesamum indicum [beniseed]
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...  95.9    7e-21   
gb|AFK34900.1|  unknown                                               96.3    8e-21   Lotus japonicus
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...  95.1    9e-21   Malus domestica [apple tree]
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...  95.9    9e-21   Prunus mume [ume]
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...  95.1    1e-20   Nicotiana tomentosiformis
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...  95.5    1e-20   Elaeis guineensis
gb|EPS63975.1|  hypothetical protein M569_10810                       95.1    1e-20   Genlisea aurea
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g           94.4    1e-20   Phaseolus vulgaris [French bean]
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...  95.1    1e-20   Phoenix dactylifera
ref|XP_003637661.1|  Calcium-binding pollen allergen                  95.5    2e-20   
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...  94.0    2e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006654163.1|  PREDICTED: probable calcium-binding protein ...  94.4    2e-20   
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...  94.0    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...  94.0    3e-20   Vitis vinifera
ref|XP_001765534.1|  predicted protein                                94.0    3e-20   
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  93.6    4e-20   Sesamum indicum [beniseed]
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                   93.2    4e-20   Eucalyptus grandis [rose gum]
gb|EAY97018.1|  hypothetical protein OsI_18939                        94.4    4e-20   Oryza sativa Indica Group [Indian rice]
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg              93.2    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...  93.6    5e-20   Sesamum indicum [beniseed]
ref|XP_010526084.1|  PREDICTED: calmodulin-like protein 4             94.4    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_003630938.1|  Calcium-binding pollen allergen                  94.0    6e-20   
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           93.6    6e-20   Phaseolus vulgaris [French bean]
gb|KJB50384.1|  hypothetical protein B456_008G168100                  94.0    6e-20   Gossypium raimondii
gb|AET05414.2|  EF hand calcium-binding family protein                93.6    7e-20   Medicago truncatula
ref|XP_006355093.1|  PREDICTED: probable calcium-binding protein ...  93.6    8e-20   Solanum tuberosum [potatoes]
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3             93.6    1e-19   Eucalyptus grandis [rose gum]
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...  92.4    1e-19   Malus domestica [apple tree]
ref|XP_004145834.1|  PREDICTED: probable calcium-binding protein ...  92.4    1e-19   Cucumis sativus [cucumbers]
ref|NP_173866.1|  putative calcium-binding protein CML25              92.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...  92.4    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_008457051.1|  PREDICTED: probable calcium-binding protein ...  92.0    1e-19   Cucumis melo [Oriental melon]
emb|CDY40786.1|  BnaAnng06490D                                        92.4    2e-19   Brassica napus [oilseed rape]
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg           92.8    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009770094.1|  PREDICTED: calmodulin-like                       91.3    2e-19   Nicotiana sylvestris
ref|XP_003616365.1|  Polcalcin Nic t                                  91.3    2e-19   Medicago truncatula
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...  91.3    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  92.0    2e-19   Eucalyptus grandis [rose gum]
ref|XP_010271345.1|  PREDICTED: probable calcium-binding protein ...  92.0    3e-19   Nelumbo nucifera [Indian lotus]
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836           92.0    3e-19   
ref|XP_011021780.1|  PREDICTED: probable calcium-binding protein ...  92.0    3e-19   Populus euphratica
ref|XP_006351748.1|  PREDICTED: calmodulin-5/6/7/8-like               90.9    3e-19   Solanum tuberosum [potatoes]
ref|XP_009392676.1|  PREDICTED: probable calcium-binding protein ...  91.7    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004230637.1|  PREDICTED: calmodulin-like                       90.9    3e-19   Solanum lycopersicum
gb|AAZ20284.1|  calcium-binding pollen allergen                       90.9    4e-19   Arachis hypogaea [goober]
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...  91.3    4e-19   Cucumis melo [Oriental melon]
gb|EYU40733.1|  hypothetical protein MIMGU_mgv1a014669mg              91.3    4e-19   Erythranthe guttata [common monkey flower]
ref|XP_001751654.1|  predicted protein                                90.9    4e-19   
ref|XP_010271280.1|  PREDICTED: probable calcium-binding protein ...  91.7    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_009413607.1|  PREDICTED: probable calcium-binding protein ...  91.3    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010531587.1|  PREDICTED: probable calcium-binding protein ...  91.7    5e-19   Tarenaya hassleriana [spider flower]
ref|XP_009379268.1|  PREDICTED: probable calcium-binding protein ...  91.7    5e-19   Pyrus x bretschneideri [bai li]
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...  91.3    5e-19   
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...  91.3    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...  91.3    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...  90.9    6e-19   Setaria italica
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg           90.9    6e-19   Capsella rubella
ref|XP_011467223.1|  PREDICTED: calcium-binding protein CML24-like    89.7    7e-19   Fragaria vesca subsp. vesca
ref|XP_007045260.1|  Polcalcin Jun o, putative                        90.9    7e-19   
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...  90.9    7e-19   Glycine max [soybeans]
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...  91.3    8e-19   Citrus sinensis [apfelsine]
ref|XP_007163392.1|  hypothetical protein PHAVU_001G231000g           89.4    8e-19   Phaseolus vulgaris [French bean]
gb|AFK37714.1|  unknown                                               89.4    8e-19   Medicago truncatula
emb|CDP16307.1|  unnamed protein product                              90.5    9e-19   Coffea canephora [robusta coffee]
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770        90.5    1e-18   Sorghum bicolor [broomcorn]
ref|XP_002279679.1|  PREDICTED: probable calcium-binding protein ...  90.5    1e-18   Vitis vinifera
ref|XP_002974189.1|  hypothetical protein SELMODRAFT_100711           90.1    1e-18   
ref|XP_002314786.2|  hypothetical protein POPTR_0010s11740g           90.5    1e-18   Populus trichocarpa [western balsam poplar]
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                 90.5    1e-18   Citrus sinensis [apfelsine]
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg           89.7    1e-18   Prunus persica
gb|AAM67124.1|  calmodulin-related protein                            89.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525994.1|  Polcalcin Jun o, putative                        90.1    1e-18   Ricinus communis
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg              89.7    1e-18   Erythranthe guttata [common monkey flower]
sp|Q0DJV6.1|CML18_ORYSJ  RecName: Full=Probable calcium-binding p...  89.7    1e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KEH26932.1|  EF hand calcium-binding family protein                89.7    1e-18   Medicago truncatula
ref|NP_564874.1|  calmodulin like 23                                  89.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EMT07142.1|  Putative calcium-binding protein CML10                90.1    1e-18   
ref|XP_008343178.1|  PREDICTED: probable calcium-binding protein ...  90.5    1e-18   Malus domestica [apple tree]
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg           89.4    1e-18   Citrus clementina [clementine]
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...  90.1    1e-18   Sesamum indicum [beniseed]
gb|AAV59327.1|  unknown protein                                       89.4    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...  90.9    1e-18   
gb|EEE62792.1|  hypothetical protein OsJ_17595                        90.1    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010925997.1|  PREDICTED: probable calcium-binding protein ...  89.4    2e-18   Elaeis guineensis
emb|CDX84967.1|  BnaC05g20880D                                        89.7    2e-18   
ref|XP_004241666.2|  PREDICTED: calcium-binding allergen Ole e 8-...  89.7    2e-18   Solanum lycopersicum
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg              89.0    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like    88.6    2e-18   Cicer arietinum [garbanzo]
ref|XP_009109853.1|  PREDICTED: probable calcium-binding protein ...  89.4    2e-18   Brassica rapa
ref|XP_001768906.1|  predicted protein                                88.2    2e-18   
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g           89.0    2e-18   
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...  89.4    2e-18   Populus euphratica
ref|XP_009113828.1|  PREDICTED: probable calcium-binding protein ...  89.4    3e-18   Brassica rapa
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8      88.6    3e-18   Vitis vinifera
gb|ABK26821.1|  unknown                                               89.4    3e-18   Picea sitchensis
ref|XP_010925995.1|  PREDICTED: probable calcium-binding protein ...  88.6    3e-18   Elaeis guineensis
ref|XP_001779680.1|  predicted protein                                88.6    3e-18   
ref|XP_009617304.1|  PREDICTED: calmodulin-like                       88.2    3e-18   Nicotiana tomentosiformis
ref|XP_010109033.1|  putative calcium-binding protein CML23           88.2    3e-18   Morus notabilis
ref|XP_002968790.1|  hypothetical protein SELMODRAFT_17991            87.8    3e-18   
ref|XP_003538397.1|  PREDICTED: probable calcium-binding protein ...  87.8    3e-18   
gb|KHM99973.1|  Putative calcium-binding protein CML25                88.2    3e-18   Glycine soja [wild soybean]
ref|XP_009403239.1|  PREDICTED: calmodulin-like protein 3             88.2    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002962635.1|  hypothetical protein SELMODRAFT_69135            87.8    4e-18   
ref|XP_003552973.1|  PREDICTED: calcium-binding protein CML24-lik...  87.8    4e-18   Glycine max [soybeans]
gb|ABK26031.1|  unknown                                               89.0    4e-18   Picea sitchensis
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...  88.6    4e-18   
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...  88.2    5e-18   Eucalyptus grandis [rose gum]
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...  87.8    5e-18   Prunus mume [ume]
gb|KFK44513.1|  hypothetical protein AALP_AA1G266400                  88.6    6e-18   Arabis alpina [alpine rockcress]
ref|XP_006402687.1|  hypothetical protein EUTSA_v10006367mg           88.6    6e-18   Eutrema salsugineum [saltwater cress]
ref|XP_006365410.1|  PREDICTED: calcium-binding allergen Ole e 8-...  87.4    6e-18   Solanum tuberosum [potatoes]
ref|XP_009797345.1|  PREDICTED: probable calcium-binding protein ...  88.2    7e-18   Nicotiana sylvestris
ref|XP_011079925.1|  PREDICTED: calmodulin-like                       87.0    7e-18   Sesamum indicum [beniseed]
emb|CDY24421.1|  BnaCnng04880D                                        89.4    7e-18   Brassica napus [oilseed rape]
ref|XP_002980456.1|  hypothetical protein SELMODRAFT_59198            87.0    7e-18   
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...  87.8    8e-18   Cucumis sativus [cucumbers]
gb|KJB15360.1|  hypothetical protein B456_002G172400                  88.2    8e-18   Gossypium raimondii
ref|XP_003580040.2|  PREDICTED: probable calcium-binding protein ...  89.0    9e-18   
ref|XP_002888497.1|  hypothetical protein ARALYDRAFT_475742           87.0    9e-18   
ref|XP_001768532.1|  predicted protein                                87.4    9e-18   
ref|XP_003568726.2|  PREDICTED: probable calcium-binding protein ...  87.4    1e-17   Brachypodium distachyon [annual false brome]
gb|EAY86614.1|  hypothetical protein OsI_07995                        87.0    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010231590.1|  PREDICTED: probable calcium-binding protein ...  87.4    1e-17   Brachypodium distachyon [annual false brome]
gb|KCW52116.1|  hypothetical protein EUGRSUZ_J01551                   87.0    1e-17   Eucalyptus grandis [rose gum]
ref|NP_001045400.1|  Os01g0949500                                     87.4    1e-17   
emb|CDM86427.1|  unnamed protein product                              87.4    1e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006372871.1|  hypothetical protein POPTR_0017s05860g           88.2    1e-17   
ref|XP_009411743.1|  PREDICTED: probable calcium-binding protein ...  87.8    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like       86.7    1e-17   Glycine max [soybeans]
ref|XP_006647478.1|  PREDICTED: probable calcium-binding protein ...  86.7    1e-17   Oryza brachyantha
gb|EYU41337.1|  hypothetical protein MIMGU_mgv1a015814mg              86.3    1e-17   Erythranthe guttata [common monkey flower]
emb|CDX67796.1|  BnaA07g18360D                                        87.4    1e-17   
gb|KDP38112.1|  hypothetical protein JCGZ_04755                       87.4    1e-17   Jatropha curcas
emb|CDX98375.1|  BnaC06g17360D                                        87.4    1e-17   
ref|XP_006301789.1|  hypothetical protein CARUB_v10022253mg           86.3    1e-17   Capsella rubella
ref|XP_010938627.1|  PREDICTED: probable calcium-binding protein ...  87.0    2e-17   Elaeis guineensis
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...  87.0    2e-17   Phoenix dactylifera
ref|XP_006574101.1|  PREDICTED: probable calcium-binding protein ...  87.0    2e-17   
ref|XP_009104207.1|  PREDICTED: calmodulin-like protein 4             87.4    2e-17   Brassica rapa
emb|CDM86445.1|  unnamed protein product                              87.0    2e-17   Triticum aestivum [Canadian hard winter wheat]
gb|ACH60077.1|  polcalcin                                             85.5    2e-17   Pseudotsuga menziesii
ref|XP_010097572.1|  putative calcium-binding protein CML27           86.7    2e-17   Morus notabilis
ref|XP_011082591.1|  PREDICTED: calmodulin-like                       86.3    2e-17   Sesamum indicum [beniseed]
emb|CDW53538.1|  Calmodulin                                           87.0    2e-17   Trichuris trichiura
ref|XP_009782225.1|  PREDICTED: calcium-binding allergen Ole e 8-...  86.3    2e-17   Nicotiana sylvestris
gb|KDP23917.1|  hypothetical protein JCGZ_27077                       86.3    2e-17   Jatropha curcas
ref|XP_004159084.1|  PREDICTED: probable calcium-binding protein ...  86.7    2e-17   
ref|XP_010511464.1|  PREDICTED: probable calcium-binding protein ...  85.9    2e-17   
ref|XP_009595960.1|  PREDICTED: calcium-binding allergen Ole e 8-...  85.9    2e-17   
ref|XP_001785090.1|  predicted protein                                86.7    2e-17   
ref|XP_011012929.1|  PREDICTED: calmodulin-like protein 3             87.0    2e-17   
gb|ACG37753.1|  calmodulin                                            87.0    3e-17   
ref|XP_001768907.1|  predicted protein                                86.3    3e-17   
ref|XP_011037098.1|  PREDICTED: calmodulin-like protein 3             87.0    3e-17   
gb|ACN35459.1|  unknown                                               87.0    3e-17   
ref|XP_009608299.1|  PREDICTED: probable calcium-binding protein ...  86.7    3e-17   
ref|XP_010032678.1|  PREDICTED: calcium-binding protein CML24         85.5    3e-17   
gb|KCW69357.1|  hypothetical protein EUGRSUZ_F02840                   85.9    3e-17   
gb|KFK40244.1|  hypothetical protein AALP_AA3G348900                  86.3    3e-17   
gb|EPS69688.1|  hypothetical protein M569_05080                       85.1    4e-17   
gb|EYU40667.1|  hypothetical protein MIMGU_mgv1a015381mg              85.5    4e-17   
ref|XP_010908206.1|  PREDICTED: probable calcium-binding protein ...  85.9    4e-17   
ref|XP_004962216.1|  PREDICTED: probable calcium-binding protein ...  86.3    4e-17   
ref|XP_011427007.1|  PREDICTED: calmodulin-A-like                     85.1    4e-17   
ref|XP_004236933.1|  PREDICTED: probable calcium-binding protein ...  85.9    4e-17   
ref|XP_007219711.1|  hypothetical protein PRUPE_ppa025855mg           85.9    4e-17   
ref|XP_007295339.1|  calmodulin                                       85.5    4e-17   
ref|XP_006843397.1|  hypothetical protein AMTR_s00053p00122010        86.7    4e-17   
emb|CDO98355.1|  unnamed protein product                              86.3    5e-17   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g           85.5    6e-17   
ref|XP_011034524.1|  PREDICTED: probable calcium-binding protein ...  85.9    6e-17   
ref|XP_002440821.1|  hypothetical protein SORBIDRAFT_09g007360        85.5    6e-17   
ref|NP_001152603.1|  polcalcin Jun o 2                                85.5    6e-17   
ref|XP_008673745.1|  PREDICTED: probable calcium-binding protein ...  85.5    6e-17   
ref|XP_002892987.1|  hypothetical protein ARALYDRAFT_889234           85.1    6e-17   
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                     84.3    7e-17   
ref|XP_006303188.1|  hypothetical protein CARUB_v10010474mg           85.1    7e-17   
ref|NP_001147205.1|  calmodulin                                       85.9    7e-17   
ref|XP_002310432.2|  hypothetical protein POPTR_0007s01960g           85.9    7e-17   
gb|ACG44451.1|  polcalcin Jun o 2                                     85.5    7e-17   
ref|XP_006416628.1|  hypothetical protein EUTSA_v10008945mg           84.7    7e-17   
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1          85.5    7e-17   
gb|KHN04934.1|  Calmodulin-like protein 8                             84.3    7e-17   
dbj|BAK01430.1|  predicted protein                                    85.1    7e-17   
gb|KFK43984.1|  hypothetical protein AALP_AA1G199600                  84.7    7e-17   
ref|XP_009370750.1|  PREDICTED: calmodulin-like protein 11            84.3    8e-17   
gb|KJB60897.1|  hypothetical protein B456_009G330300                  85.1    8e-17   
ref|XP_011078048.1|  PREDICTED: calmodulin-like protein 1             84.7    8e-17   
emb|CAD41532.1|  OSJNBb0091E11.1                                      85.5    8e-17   
gb|KEQ77625.1|  calmodulin-like protein                               84.3    8e-17   
emb|CAC34625.1|  putative calmodulin-related protein                  84.7    8e-17   
emb|CAH67730.1|  H0522A01.1                                           85.5    8e-17   
gb|KEQ79382.1|  putative calmodulin                                   84.3    8e-17   
ref|NP_001173067.1|  Os02g0606501                                     84.7    8e-17   
ref|XP_002322096.1|  calcium binding family protein                   84.7    8e-17   
gb|KEQ67258.1|  putative calmodulin                                   84.3    9e-17   
gb|EYU46104.1|  hypothetical protein MIMGU_mgv1a022077mg              84.3    9e-17   
ref|XP_011026425.1|  PREDICTED: calmodulin-like protein 3             85.5    9e-17   
gb|KDP33161.1|  hypothetical protein JCGZ_13426                       84.3    9e-17   
gb|KEH30330.1|  EF hand calcium-binding family protein                84.3    9e-17   
gb|EMS57491.1|  putative calcium-binding protein CML18                85.9    9e-17   
gb|KEH41241.1|  EF hand calcium-binding family protein                84.0    1e-16   
ref|XP_009596484.1|  PREDICTED: probable calcium-binding protein ...  84.7    1e-16   
ref|XP_001779716.1|  predicted protein                                83.6    1e-16   
ref|NP_191503.1|  calmodulin-like protein 4                           84.7    1e-16   
dbj|BAJ88405.1|  predicted protein                                    84.7    1e-16   
gb|KEH41232.1|  EF hand calcium-binding family protein                83.6    1e-16   
gb|KFD49502.1|  hypothetical protein M513_09613                       85.5    1e-16   
ref|NP_173259.1|  putative calcium-binding protein CML27              84.3    1e-16   
ref|NP_001053179.1|  Os04g0492800                                     85.5    1e-16   
ref|XP_003556466.1|  PREDICTED: calmodulin-like protein 8-like is...  83.6    1e-16   
emb|CDP19328.1|  unnamed protein product                              84.0    1e-16   
ref|XP_010506196.1|  PREDICTED: calmodulin-like protein 5             85.1    1e-16   
gb|KHN17940.1|  Putative calcium-binding protein CML27                83.6    1e-16   
ref|XP_004517285.1|  PREDICTED: probable calcium-binding protein ...  83.2    1e-16   
ref|XP_002671503.1|  predicted protein                                83.6    2e-16   
gb|KFK41060.1|  hypothetical protein AALP_AA2G080200                  83.6    2e-16   
ref|XP_010038682.1|  PREDICTED: calmodulin-like protein 11            83.2    2e-16   
ref|NP_565996.1|  calmodulin-like protein MSS3                        84.7    2e-16   
ref|XP_004299534.1|  PREDICTED: probable calcium-binding protein ...  83.6    2e-16   
ref|XP_008237262.1|  PREDICTED: calmodulin-like protein 3             84.7    2e-16   
ref|XP_010557084.1|  PREDICTED: calmodulin-like protein 7             83.2    2e-16   
ref|XP_010520850.1|  PREDICTED: calmodulin-like protein 2             83.2    2e-16   
gb|AFK83800.1|  calmodulin                                            83.2    2e-16   
gb|KJB17907.1|  hypothetical protein B456_003G023100                  84.0    2e-16   
ref|XP_003631098.1|  SLR1/LCR-like protein                            83.6    2e-16   
emb|CDP10060.1|  unnamed protein product                              84.3    2e-16   
gb|EMT17394.1|  Putative calcium-binding protein CML18                83.6    2e-16   
emb|CDY19196.1|  BnaC05g13970D                                        83.6    2e-16   
ref|XP_010692608.1|  PREDICTED: probable calcium-binding protein ...  84.0    2e-16   
gb|KFK37167.1|  hypothetical protein AALP_AA4G222400                  83.6    2e-16   
ref|XP_001326924.1|  calmodulin                                       83.2    2e-16   
ref|XP_009356047.1|  PREDICTED: probable calcium-binding protein ...  83.6    2e-16   
gb|ADC80752.1|  calmodulin 24-like protein                            82.0    2e-16   
ref|XP_011008803.1|  PREDICTED: probable calcium-binding protein ...  83.6    3e-16   
ref|XP_006291828.1|  hypothetical protein CARUB_v10018003mg           84.3    3e-16   
ref|XP_001785095.1|  predicted protein                                82.8    3e-16   
gb|KGG50401.1|  calmodulin                                            83.2    3e-16   
gb|ELU13700.1|  hypothetical protein CAPTEDRAFT_169155                83.6    3e-16   
ref|XP_008787648.1|  PREDICTED: probable calcium-binding protein ...  83.6    3e-16   
emb|CAC43238.1|  calcium binding protein                              83.2    3e-16   
ref|XP_010459434.1|  PREDICTED: probable calcium-binding protein ...  83.2    3e-16   
ref|XP_002266359.1|  PREDICTED: calmodulin-like protein 3             84.0    3e-16   
ref|XP_011073627.1|  PREDICTED: probable calcium-binding protein ...  82.4    3e-16   
ref|XP_006366822.1|  PREDICTED: calmodulin-like protein 3-like        82.4    3e-16   
ref|XP_006367611.1|  PREDICTED: probable calcium-binding protein ...  83.2    3e-16   
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       82.4    3e-16   
gb|KCW58109.1|  hypothetical protein EUGRSUZ_H00832                   82.8    3e-16   
ref|XP_010476999.1|  PREDICTED: probable calcium-binding protein ...  83.2    3e-16   
ref|XP_009123945.1|  PREDICTED: calmodulin-like protein 5             82.8    4e-16   
gb|ADC80730.1|  calmodulin 24-like protein                            81.6    4e-16   
gb|KJB30167.1|  hypothetical protein B456_005G131800                  82.8    4e-16   
gb|ACH60082.1|  polcalcin                                             82.0    4e-16   
ref|XP_011084127.1|  PREDICTED: calmodulin-like protein 3             83.6    4e-16   
ref|XP_010097540.1|  Calmodulin-like protein 5                        83.2    4e-16   
ref|XP_009607745.1|  PREDICTED: calmodulin-like protein 3             82.4    4e-16   
ref|XP_008356663.1|  PREDICTED: probable calcium-binding protein ...  82.8    4e-16   
ref|XP_008374843.1|  PREDICTED: probable calcium-binding protein ...  82.8    4e-16   
ref|XP_009110358.1|  PREDICTED: probable calcium-binding protein ...  82.8    4e-16   
ref|XP_002881895.1|  hypothetical protein ARALYDRAFT_903714           83.6    5e-16   
gb|KEQ93845.1|  hypothetical protein AUEXF2481DRAFT_6419              82.4    5e-16   
emb|CDO97169.1|  unnamed protein product                              82.8    5e-16   
ref|NP_001150713.1|  LOC100284346                                     83.2    5e-16   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...  82.8    5e-16   
ref|NP_001241810.1|  polcalcin Jun o 2                                83.2    5e-16   
ref|XP_006397493.1|  hypothetical protein EUTSA_v10001753mg           84.0    5e-16   
ref|XP_010530885.1|  PREDICTED: calmodulin-like protein 1             82.8    5e-16   
ref|XP_007160530.1|  hypothetical protein PHAVU_002G329300g           82.4    5e-16   
ref|XP_008240158.1|  PREDICTED: probable calcium-binding protein ...  82.4    5e-16   
ref|XP_008351927.1|  PREDICTED: probable calcium-binding protein ...  82.4    5e-16   
gb|KJB30717.1|  hypothetical protein B456_005G156600                  82.4    5e-16   
ref|XP_010508448.1|  PREDICTED: calmodulin-like protein 5             83.2    5e-16   
ref|XP_008369144.1|  PREDICTED: calmodulin-like protein 3             83.2    5e-16   
ref|XP_010277405.1|  PREDICTED: probable calcium-binding protein ...  83.2    6e-16   
ref|XP_004486916.1|  PREDICTED: calmodulin-like protein 5-like        82.8    6e-16   
ref|XP_006296176.1|  hypothetical protein CARUB_v10025336mg           83.2    6e-16   
ref|XP_007227575.1|  hypothetical protein PRUPE_ppa011029mg           83.2    6e-16   
emb|CDX96729.1|  BnaA08g22720D                                        82.4    6e-16   
ref|XP_009347665.1|  PREDICTED: calmodulin-like protein 7             83.2    6e-16   
ref|XP_007144825.1|  hypothetical protein PHAVU_007G187200g           82.0    6e-16   
emb|CDY23356.1|  BnaC04g48840D                                        82.8    6e-16   
ref|XP_009360087.1|  PREDICTED: probable calcium-binding protein ...  82.0    6e-16   
ref|XP_003530955.1|  PREDICTED: calcium-binding allergen Ole e 8      82.4    6e-16   
ref|XP_009121939.1|  PREDICTED: calmodulin-like protein 6             82.0    6e-16   
gb|ADC80731.1|  calmodulin 24-like protein                            80.9    6e-16   
gb|ADD38579.1|  Calmodulin                                            82.0    7e-16   
ref|XP_007209701.1|  hypothetical protein PRUPE_ppa012426mg           82.0    7e-16   
ref|XP_009142186.1|  PREDICTED: calmodulin-like protein 5             82.8    7e-16   
ref|XP_003372739.1|  EF hand domain containing protein                83.2    7e-16   
ref|XP_007052033.1|  EF hand calcium-binding family protein, puta...  82.8    7e-16   
ref|XP_008368689.1|  PREDICTED: calmodulin-like protein 11            81.6    7e-16   
ref|XP_010922191.1|  PREDICTED: probable calcium-binding protein ...  82.4    7e-16   
emb|CDY70127.1|  BnaA06g38470D                                        82.0    7e-16   
ref|XP_011080544.1|  PREDICTED: calmodulin-like protein 3             81.6    7e-16   
gb|ESW97557.1|  calmodulin                                            81.6    7e-16   
ref|XP_004228711.1|  PREDICTED: probable calcium-binding protein ...  82.0    8e-16   
ref|XP_011002781.1|  PREDICTED: calcium-binding protein CML24-like    81.6    8e-16   
emb|CDY21953.1|  BnaC09g00590D                                        81.6    8e-16   
ref|XP_009149267.1|  PREDICTED: probable calcium-binding protein ...  82.0    8e-16   
emb|CDY30399.1|  BnaA04g25000D                                        82.8    8e-16   
gb|KJB24793.1|  hypothetical protein B456_004G160800                  82.8    8e-16   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       81.6    8e-16   
gb|KEH27392.1|  EF hand calcium-binding family protein                81.3    8e-16   
ref|XP_004235822.1|  PREDICTED: calcium-binding allergen Ole e 8-...  82.0    8e-16   
gb|ACO12252.1|  Calmodulin                                            81.6    8e-16   
gb|KJB42986.1|  hypothetical protein B456_007G178400                  81.6    8e-16   
ref|XP_002532464.1|  Calcium-binding allergen Ole e, putative         81.6    8e-16   
ref|XP_007910199.1|  PREDICTED: calmodulin-A-like                     82.4    9e-16   
ref|XP_010517888.1|  PREDICTED: calmodulin-like protein 5             82.8    9e-16   
ref|XP_004166667.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-l...  82.0    9e-16   
ref|XP_005717351.1|  Calmodulin                                       81.3    9e-16   
ref|XP_011090880.1|  PREDICTED: probable calcium-binding protein ...  82.4    9e-16   
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   81.3    9e-16   
ref|XP_010525867.1|  PREDICTED: calmodulin-like protein 7             82.4    1e-15   
ref|XP_006014812.1|  PREDICTED: calmodulin                            82.4    1e-15   
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg           81.3    1e-15   
ref|XP_504759.1|  YALI0E34111p                                        81.3    1e-15   
ref|NP_001041950.2|  Os01g0135700                                     82.0    1e-15   
gb|KJB43703.1|  hypothetical protein B456_007G212400                  82.0    1e-15   
ref|XP_006852110.1|  hypothetical protein AMTR_s00049p00017460        85.9    1e-15   
emb|CDY72611.1|  BnaCnng78560D                                        82.0    1e-15   
ref|XP_001752530.1|  predicted protein                                81.6    1e-15   
gb|AHA51383.1|  EF-hand_1 domain-containing protein                   81.6    1e-15   
emb|CDY06002.1|  BnaA09g37780D                                        82.0    1e-15   
ref|XP_002520954.1|  calmodulin, putative                             80.9    1e-15   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      81.3    1e-15   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             80.9    1e-15   
gb|KFK41806.1|  hypothetical protein AALP_AA2G174300                  81.3    1e-15   
ref|XP_009604908.1|  PREDICTED: probable calcium-binding protein ...  82.0    1e-15   
ref|XP_010026030.1|  PREDICTED: probable calcium-binding protein ...  82.8    1e-15   
ref|XP_002305867.1|  putative calmodulin-related family protein       81.3    1e-15   
gb|KFK30924.1|  hypothetical protein AALP_AA6G043700                  80.9    1e-15   
ref|XP_010036949.1|  PREDICTED: probable calcium-binding protein ...  81.3    1e-15   
ref|XP_010422477.1|  PREDICTED: calmodulin-like protein 6             80.9    1e-15   
ref|XP_002721725.1|  PREDICTED: calmodulin-like protein 3             80.9    1e-15   
ref|XP_009116605.1|  PREDICTED: calmodulin-like protein 4             81.6    1e-15   
gb|KFO18269.1|  Calmodulin                                            81.3    1e-15   
ref|XP_011008351.1|  PREDICTED: probable calcium-binding protein ...  81.3    1e-15   
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11            80.9    1e-15   
ref|XP_002320065.2|  hypothetical protein POPTR_0014s06640g           82.0    2e-15   
ref|XP_008808789.1|  PREDICTED: probable calcium-binding protein ...  80.9    2e-15   
ref|XP_008472657.1|  PREDICTED: calmodulin-like                       81.6    2e-15   
gb|KJB39254.1|  hypothetical protein B456_007G004000                  80.5    2e-15   
gb|AAB41135.1|  calmodulin                                            80.5    2e-15   
ref|XP_010512205.1|  PREDICTED: calmodulin-like protein 4             81.6    2e-15   
gb|EPS64880.1|  hypothetical protein M569_09899                       80.9    2e-15   
ref|XP_009134364.1|  PREDICTED: calmodulin-like protein 6             80.9    2e-15   
ref|XP_008454944.1|  PREDICTED: calmodulin-like protein 1             81.3    2e-15   
gb|KGN43936.1|  hypothetical protein Csa_7G073720                     81.3    2e-15   
ref|XP_011066820.1|  PREDICTED: neo-calmodulin-like                   82.0    2e-15   
gb|EFN67816.1|  Calmodulin                                            82.0    2e-15   
ref|XP_010469361.1|  PREDICTED: calmodulin-like protein 4             81.6    2e-15   
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11            80.5    2e-15   
ref|XP_006286433.1|  hypothetical protein CARUB_v10003659mg           80.5    2e-15   
ref|XP_010522183.1|  PREDICTED: calmodulin-like protein 7             80.5    2e-15   
ref|XP_005704341.1|  calmodulin isoform 1                             80.5    2e-15   
gb|EZA54087.1|  Calmodulin                                            81.6    2e-15   
gb|ACH60100.1|  polcalcin                                             79.7    2e-15   
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11            80.5    2e-15   
ref|XP_004308823.1|  PREDICTED: calmodulin-5/6/7/8-like               81.3    2e-15   
ref|XP_006663916.1|  PREDICTED: probable calcium-binding protein ...  80.5    2e-15   
emb|CEL63589.1|  Calmodulin OS=Agaricus bisporus PE=1 SV=2            80.1    2e-15   
ref|XP_009405944.1|  PREDICTED: neo-calmodulin-like                   80.5    2e-15   
gb|KFK42930.1|  hypothetical protein AALP_AA1G057000                  80.5    2e-15   
ref|NP_001237178.1|  uncharacterized protein LOC100527005             80.1    2e-15   
ref|XP_001766863.1|  predicted protein                                80.1    2e-15   
ref|XP_011150176.1|  PREDICTED: neo-calmodulin-like isoform X3        81.6    2e-15   
emb|CDX90890.1|  BnaA03g25700D                                        80.5    2e-15   



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 130/156 (83%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  341
            G+KKP G +TPTSVLP L++EIS DE S +    YAELVQAF +ID D DGKIRKEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADEWSEISAEVYAELVQAFHVIDTDGDGKIRKEELEA  103

Query  342  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  521
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLEEF  + SAF PPSCD ELRDAFDFFD 
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAIRSAFGPPSCDGELRDAFDFFDA  163

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DHDG I+AEELFNVF+TIGD RCTLEDCRRMI  VD
Sbjct  164  DHDGMITAEELFNVFRTIGDGRCTLEDCRRMIRGVD  199



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 130/156 (83%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  341
            G+KKP G +TPTSVLP L++EIS D+ S +    YAELVQAF +ID D DGKI KEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADKWSEISAEVYAELVQAFHMIDTDGDGKIMKEELEA  103

Query  342  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  521
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLEEF  +SSAF PPSCD ELRD FDFFD 
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAISSAFGPPSCDGELRDVFDFFDA  163

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DHDGKI+AE+LFNVF+TIGD RCTLEDCRRMI  VD
Sbjct  164  DHDGKITAEKLFNVFRTIGDGRCTLEDCRRMIRGVD  199



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  341
            G KKP G STPTSVLP L+ +IS +E S +    Y EL QAF++IDRD DGKI+KEELEA
Sbjct  44   GSKKPNGLSTPTSVLPTLSADISAEEWSEISADVYFELKQAFEMIDRDGDGKIKKEELEA  103

Query  342  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  521
            LL ++GAEPP++EEL+LMLS+VDRDGDGCI+LEEF  + SAFAPP+CD ELRD FDFFD+
Sbjct  104  LLCRLGAEPPNQEELQLMLSDVDRDGDGCITLEEFYAIGSAFAPPTCDMELRDTFDFFDS  163

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            D DGKI+AEELFNVFKTIGDS+CTLEDCRRMI  VD
Sbjct  164  DRDGKITAEELFNVFKTIGDSQCTLEDCRRMISGVD  199



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   222 bits (565),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 131/156 (84%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDEL----SGLYAELVQAFKLIDRDDDGKIRKEELEA  341
            G+KKP G STPTSVLP+L+ EISP+E     + +Y EL QAF++IDRD DGKI+KEELE 
Sbjct  44   GFKKPTGLSTPTSVLPSLSAEISPNEWPEIPADIYFELKQAFEMIDRDGDGKIKKEELEG  103

Query  342  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  521
            LL ++G EPP +EEL+LML+EVDRDGDGCISLEEF  + SAFAPP+ D ELRDAFDFFD+
Sbjct  104  LLCRLGPEPPCQEELKLMLTEVDRDGDGCISLEEFYAIGSAFAPPARDGELRDAFDFFDS  163

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            D DGKI+AEEL NVFKTIGD+RCTLEDCRRMI  V+
Sbjct  164  DRDGKITAEELLNVFKTIGDARCTLEDCRRMIRGVN  199



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 6/152 (4%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G+KKP G +TPTSVLP    EIS DE    ++E++QAF +ID D DGKIRKE+LEA+L++
Sbjct  44   GFKKPNGLATPTSVLPP--SEISADE----WSEILQAFHMIDSDGDGKIRKEQLEAILTR  97

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            VG +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD DHDG
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDADHDG  157

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KI+AEELFNVF+TIGD RCTL+DCRRMI  VD
Sbjct  158  KITAEELFNVFRTIGDGRCTLDDCRRMIRGVD  189



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 128/156 (82%), Gaps = 5/156 (3%)
 Frame = +3

Query  177  YKKPGGESTPTSVLP-ALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  341
            +KKP G STPTSVLP A + EIS +E S +    Y +L QAF++IDRD DGK+ K ELE 
Sbjct  47   FKKPNGLSTPTSVLPTASSAEISTEEWSEISADVYFDLKQAFEMIDRDGDGKVTKAELED  106

Query  342  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  521
            LL  +GA+PPSREELRLMLSEVDRDGDGCI+LEEF  + SAFAPP+CD+E+R+ FDFFD+
Sbjct  107  LLCGLGADPPSREELRLMLSEVDRDGDGCITLEEFHSIGSAFAPPTCDTEMRETFDFFDS  166

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            D DGKI+AEELF VF+TIGD++CTLEDCRRMI  VD
Sbjct  167  DRDGKITAEELFGVFRTIGDAKCTLEDCRRMIRGVD  202


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             E+ + F   D D DGKI  EEL  +   +G    + E+ R M+  VDR+GDG +  E+F
Sbjct  155  TEMRETFDFFDSDRDGKITAEELFGVFRTIGDAKCTLEDCRRMIRGVDRNGDGFVCFEDF  214

Query  447  SVL  455
            S++
Sbjct  215  SLM  217



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 9/147 (6%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG STPTSVLP+ +D         L +EL QAF++IDRD DGKI+KEELE LLS++GAEP
Sbjct  44   GGLSTPTSVLPSADD---------LCSELKQAFEMIDRDGDGKIKKEELEGLLSRLGAEP  94

Query  369  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  548
            PS+EEL+LM+SEVDRDGDGCISLEEF  + SAFAPP+CD ELR  FDFFD+D DGKI+AE
Sbjct  95   PSQEELKLMVSEVDRDGDGCISLEEFYAIGSAFAPPTCDGELRSTFDFFDSDRDGKITAE  154

Query  549  ELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ELF VF+TIGD+RCTLEDCRRMI  VD
Sbjct  155  ELFRVFETIGDARCTLEDCRRMIKGVD  181



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 126/151 (83%), Gaps = 5/151 (3%)
 Frame = +3

Query  189  GGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  +TPTSVLP  L+ EI+ DE S    G+Y ++ +AFK+IDRD DGKI ++ELEALLS+
Sbjct  66   GSPATPTSVLPPTLSSEITSDEWSEISGGVYEDVKEAFKMIDRDGDGKITRDELEALLSR  125

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            VGAEPPS EEL ++LSEVDRDGDGCISLEEF  + SAF PPSCDSE+RDAFDFFDTDHDG
Sbjct  126  VGAEPPSAEELNMLLSEVDRDGDGCISLEEFEAIGSAFGPPSCDSEMRDAFDFFDTDHDG  185

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
            +I+AEEL+NVF+ IGD +CTL++C+RMI  V
Sbjct  186  RITAEELYNVFRVIGDGQCTLDECQRMISGV  216



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 125/152 (82%), Gaps = 6/152 (4%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G++KP G +TPTSVLP   ++IS DE    ++E++QAF +ID   DGKIRKE+LEA+L++
Sbjct  44   GFQKPNGLATPTSVLPP--NDISADE----WSEILQAFHMIDSGGDGKIRKEQLEAILTR  97

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            VG +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD +HDG
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDANHDG  157

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KI+AEELFNVF+TIGD RCTLEDCR MI  VD
Sbjct  158  KITAEELFNVFRTIGDGRCTLEDCRHMIRGVD  189



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 5/152 (3%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G++KP G STPTSVLP   +EIS  E+  +YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  41   GFRKPTGSSTPTSVLP---NEISAAEV--VYAELIHAFHMMDTDGDGKIRKEELEAILSR  95

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            VG EPPS+EEL L+L EVD DGDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHDG
Sbjct  96   VGTEPPSKEELMLLLEEVDVDGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHDG  155

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KI+A+ELF+VF+ IGDSRCTLE+CRRMI  VD
Sbjct  156  KITADELFSVFRQIGDSRCTLEECRRMIRGVD  187


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +  E+F
Sbjct  140  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDF  199

Query  447  SVL  455
             ++
Sbjct  200  CIM  202



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 5/152 (3%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G+ KP G STPTSVLP   +EIS  E+   YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  43   GFSKPTGSSTPTSVLP---NEISAAEVG--YAELIHAFHMMDTDGDGKIRKEELEAILSR  97

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            VG EPPS+EEL L+L EVD +GDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHDG
Sbjct  98   VGTEPPSKEELMLLLEEVDVNGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHDG  157

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KI+A+ELF+VF+ IGDSRCTLE+CRRMI  VD
Sbjct  158  KITADELFSVFRQIGDSRCTLEECRRMIRGVD  189


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +  E+F
Sbjct  142  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDF  201

Query  447  SVL  455
             V+
Sbjct  202  CVM  204



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = +3

Query  213  VLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  389
            VLP+ N +  P E+S  +Y+ELVQAF++ID D DGKI KEEL A+L++VG++PP+ EEL 
Sbjct  81   VLPSTNTQW-PSEISAEVYSELVQAFQMIDGDGDGKIHKEELSAILTRVGSDPPTEEELV  139

Query  390  LMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  569
             +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+
Sbjct  140  QLLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFR  199

Query  570  TIGDSRCTLEDCRRMILWVD  629
            TIGD RCTLE+CRRMI  VD
Sbjct  200  TIGDGRCTLEECRRMIRGVD  219



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +3

Query  204  PTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  374
            PTSVLP  + EIS D     S +  ELV AFK+IDRD DGKI K ELEALLS+VG EPPS
Sbjct  59   PTSVLPMHSYEISGDWSDFSSDIQTELVHAFKMIDRDGDGKITKRELEALLSRVGVEPPS  118

Query  375  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  554
             EE+ +MLSEVDRDGDGCISLEEF  +SSAF  P+CD+ELRDAF FFDTD DGKI+AEEL
Sbjct  119  EEEIMMMLSEVDRDGDGCISLEEFGAISSAFG-PACDTELRDAFCFFDTDRDGKITAEEL  177

Query  555  FNVFKTIGDSRCTLEDCRRMILWVD  629
              VF  IGD RCTLEDC+RMI  VD
Sbjct  178  NQVFAAIGDDRCTLEDCQRMIAGVD  202



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 127/166 (77%), Gaps = 15/166 (9%)
 Frame = +3

Query  177  YKKPGGESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEE  332
            +K   G STPTSVLP  L++EIS ++ S       G+Y++LVQAF LID D DGKIRKE+
Sbjct  40   HKPYNGLSTPTSVLPTTLSNEISAEDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQ  99

Query  333  LEALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS------E  491
            LEA+LS+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF      +      E
Sbjct  100  LEAILSRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELTEATTAEDGGDE  159

Query  492  LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            +RDAFDFFDTDHDGKI+AEELFNVF+ IGD+RCTLEDCRRMI  VD
Sbjct  160  MRDAFDFFDTDHDGKITAEELFNVFRMIGDARCTLEDCRRMIRSVD  205



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  213  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  392
            VLP+   +   +  + +Y+ELVQAF++ID D DGKI KEE+ A+L++VG++PP+ EEL  
Sbjct  47   VLPSTTTQWPSEIPAEVYSELVQAFQMIDVDGDGKIHKEEISAILTRVGSDPPTEEELVQ  106

Query  393  MLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKT  572
            +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+T
Sbjct  107  LLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRT  166

Query  573  IGDSRCTLEDCRRMILWVD  629
            IGD RCTLE+CRRMI  VD
Sbjct  167  IGDGRCTLEECRRMIRGVD  185



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 124/161 (77%), Gaps = 15/161 (9%)
 Frame = +3

Query  192  GESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEELEALL  347
            G STPTSVLP  L++EIS D+ S       G+Y++LVQAF LID D DGKIRKE+LEA+L
Sbjct  45   GISTPTSVLPTTLSNEISADDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQLEAIL  104

Query  348  SQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS------CDSELRDAF  506
            S+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF  P          E+RDAF
Sbjct  105  SRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELPEEMTAEDGGDEMRDAF  164

Query  507  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DFFD DHDGKI+AEELFNVF+ IGD+RCTLEDCRRMI  VD
Sbjct  165  DFFDADHDGKITAEELFNVFRMIGDARCTLEDCRRMIRSVD  205



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPD----ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  350
            K GG +TP SVL + + EIS D      +  + E +QAFKLIDRD DGK+   ELE LLS
Sbjct  47   KGGGGATPKSVLRSCSQEISGDWSDLSAANTHLEHLQAFKLIDRDGDGKVTIHELEGLLS  106

Query  351  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  530
            ++G EPPS+EE+ LML+E+D+DGDGCISLEEF  +SS+  P +  S+LR+AF+ FD D D
Sbjct  107  RIGGEPPSKEEMLLMLTEIDQDGDGCISLEEFEAISSSLVPAAL-SDLREAFNVFDADRD  165

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            GKISAEEL  VF  IGD RCTLEDCRRMI  VD
Sbjct  166  GKISAEELLGVFSAIGDDRCTLEDCRRMIRSVD  198


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +3

Query  237  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  416
            IS   +    ++L +AF + D D DGKI  EEL  + S +G +  + E+ R M+  VD +
Sbjct  141  ISSSLVPAALSDLREAFNVFDADRDGKISAEELLGVFSAIGDDRCTLEDCRRMIRSVDTN  200

Query  417  GDGCISLEEFS  449
            GDG +  E+FS
Sbjct  201  GDGFVCFEDFS  211



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIRTPTSVLPERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  369  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  548
            PS+EE+ LMLSEVDR+G+G I+L+           P+ DSELRDAF  FD+DHDGKISAE
Sbjct  123  PSQEEVMLMLSEVDREGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAE  182

Query  549  ELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ELFNVF  IGD RCTLEDCRRMI  VD
Sbjct  183  ELFNVFTAIGDDRCTLEDCRRMIAGVD  209


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = +3

Query  195  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  374
            E   +  L AL + + P       +EL  AFK+ D D DGKI  EEL  + + +G +  +
Sbjct  138  EGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAEELFNVFTAIGDDRCT  197

Query  375  REELRLMLSEVDRDGDGCISLEEFSVL  455
             E+ R M++ VD++GDG +  E+F+ +
Sbjct  198  LEDCRRMIAGVDKNGDGFVCFEDFARM  224



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            + GG  TPTSVL   + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA
Sbjct  62   EAGGIGTPTSVLLERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGA  120

Query  363  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  542
            +PPS+EE+ LMLSEVDR+G+G ISLE           P+ DSELRDAF+ FD+DHDGKIS
Sbjct  121  DPPSQEEVMLMLSEVDREGNGSISLEALLSRVGPVCGPAADSELRDAFEVFDSDHDGKIS  180

Query  543  AEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            AEEL NVF  IGD RCTLEDCRRMI  VD
Sbjct  181  AEELLNVFTAIGDDRCTLEDCRRMIAGVD  209


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +3

Query  195  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  374
            E   +  L AL   + P       +EL  AF++ D D DGKI  EEL  + + +G +  +
Sbjct  138  EGNGSISLEALLSRVGPVCGPAADSELRDAFEVFDSDHDGKISAEELLNVFTAIGDDRCT  197

Query  375  REELRLMLSEVDRDGDGCISLEEFSVL  455
             E+ R M++ VD++GDG +  E+F+ +
Sbjct  198  LEDCRRMIAGVDKNGDGFVCFEDFARM  224



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = +3

Query  201  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            TPTSVLP ++ + S D  +  Y++LVQAFKLIDRD+DG + + ELEALLS++GAEPPS+E
Sbjct  58   TPTSVLPEISGDWS-DISTDFYSDLVQAFKLIDRDNDGIVSRRELEALLSRLGAEPPSQE  116

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  560
            E+  MLSEVD  GDGCIS+E       +   P+ D ELR AF+FFD D DGKI+AEELF 
Sbjct  117  EVATMLSEVDHVGDGCISVEALMNRIGSACEPAGDDELRVAFEFFDADQDGKITAEELFG  176

Query  561  VFKTIGDSRCTLEDCRRMILWVD  629
            V+K IGD RCT EDC RMI  VD
Sbjct  177  VYKAIGDERCTFEDCMRMIASVD  199



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 12/154 (8%)
 Frame = +3

Query  201  TPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  365
            TPTSVLP L++EIS D+ S     G+Y++LVQAF +ID + DGKIRKE+LEA+LS+VG +
Sbjct  44   TPTSVLPTLSNEISADDWSEISTAGVYSDLVQAFSVID-NGDGKIRKEQLEAILSRVGGK  102

Query  366  -PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSCD---SELRDAFDFFDTDH  527
             PP+ EEL L+L E+D++GDGCISLE F  ++SAF   PPS      E+RDAFDFFD DH
Sbjct  103  SPPTEEELVLLLDELDKNGDGCISLENFETITSAFEPTPPSAAEDAGEMRDAFDFFDEDH  162

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DGKI+ EELFNVF+ IGD RCTLE+C+RMI  VD
Sbjct  163  DGKITGEELFNVFRMIGDERCTLEECKRMITSVD  196


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD++GDG +  E+F
Sbjct  149  GEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFEDF  208

Query  447  SVL  455
             ++
Sbjct  209  CLM  211



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  303  DDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC  482
            D DGKI K ELEALLS+VG EPPS EE+ +MLSEVDRDGDGCISLEEF  +SSAF  P+C
Sbjct  48   DGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLEEFGAISSAFG-PAC  106

Query  483  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            D+ELRDAF FFDTD DGKI+AEEL  VF  IGD RCTLEDC+RMI  VD
Sbjct  107  DTELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVD  155


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             EL  AF   D D DGKI  EEL  + + +G +  + E+ + M++ VD++GDG +  E+F
Sbjct  108  TELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDF  167

Query  447  SVL  455
            S +
Sbjct  168  SRM  170



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score =   162 bits (411),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 16/154 (10%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            KPG  +TP SVLP  +D        G Y+EL+QAFKLIDRDDDG + + +L ALLS++  
Sbjct  51   KPGPAATPISVLPGDHD--------GFYSELIQAFKLIDRDDDGVVSRRDLAALLSRLSP  102

Query  363  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  527
            EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ F+FFD DH
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREVFEFFDVDH  159

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DG+ISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  160  DGRISAEELHRVFGVIGDERCTLEECVRMIATVD  193



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score =   162 bits (410),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 110/154 (71%), Gaps = 15/154 (10%)
 Frame = +3

Query  183  KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV-  356
            KPGG  +TPTSVLP    E S         ++ QAF+LIDRD+DG + + ELEALL ++ 
Sbjct  47   KPGGPAATPTSVLPGDWSEFS-------SVDMAQAFRLIDRDNDGVVSRTELEALLKRLL  99

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP---PSCDSELRDAFDFFDTDH  527
            GAEPP++EE+ +MLSEVD DGDGCI LE    L   F P   P+ DSELR+AF+ FDTDH
Sbjct  100  GAEPPTQEEVAMMLSEVDGDGDGCIPLE---ALLHRFGPGCEPAADSELREAFEVFDTDH  156

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DGKISAEEL +VF  IGD RCTLE+CRRMI  VD
Sbjct  157  DGKISAEELLSVFTAIGDERCTLEECRRMIAEVD  190


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +EL +AF++ D D DGKI  EEL ++ + +G E  + EE R M++EVD++GDG +  ++F
Sbjct  143  SELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFQDF  202

Query  447  SVL  455
            + +
Sbjct  203  ARM  205



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 109/153 (71%), Gaps = 15/153 (10%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAE------LVQAFKLIDRDDDGKIRKEELEALLS  350
            GG +TPTSVLP         E SG +++      + QAFKLIDRD+DG + ++ELEALLS
Sbjct  57   GGIATPTSVLP---------EKSGDWSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLS  107

Query  351  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  530
            ++G +PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+  DTD+D
Sbjct  108  RLGNDPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVXDTDND  167

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            GKISAEEL  VF  IGD RCTLE+CRRMI  VD
Sbjct  168  GKISAEELLRVFTAIGDERCTLEECRRMIDGVD  200


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  213  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  392
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  135  TLEALLNQVGPVSGPAADSELRDAFEVXDTDNDGKISAEELLRVFTAIGDERCTLEECRR  194

Query  393  MLSEVDRDGDGCISLEEF  446
            M+  VD+DGDG +  EEF
Sbjct  195  MIDGVDKDGDGFVCFEEF  212



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 105/154 (68%), Gaps = 17/154 (11%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            KPG  +TP SVLP   D          Y+EL+QAFKLIDRDDDG + ++EL ALLS +  
Sbjct  50   KPGPAATPVSVLPGEQD---------FYSELIQAFKLIDRDDDGVVSRKELAALLSGLSP  100

Query  363  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  527
            EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ F+FFD DH
Sbjct  101  EPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREVFEFFDLDH  157

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DG+ISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  158  DGRISAEELHRVFGVIGDERCTLEECVRMIATVD  191



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 119/155 (77%), Gaps = 12/155 (8%)
 Frame = +3

Query  198  STPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            STPTSVLP L++EIS DE S     G+Y++LV+AF +ID + DGKI+KE+LEA+LS+VG 
Sbjct  41   STPTSVLPTLSNEISADEWSDISTAGVYSDLVRAFSVID-NGDGKIKKEKLEAILSRVGG  99

Query  363  E-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSCDS---ELRDAFDFFDTD  524
            + PPS EEL L+L E+D +GDGCISLE F  ++SAF   P S      E+RDAFDFFD D
Sbjct  100  KSPPSEEELVLLLDELDENGDGCISLENFETITSAFESTPTSAAGDAGEMRDAFDFFDED  159

Query  525  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            HDGKI+ EELFNVF+ IGD RCTLE+C+RMI  VD
Sbjct  160  HDGKITGEELFNVFRMIGDERCTLEECKRMITSVD  194


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +3

Query  234  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  413
            E +P   +G   E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD+
Sbjct  136  ESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDK  195

Query  414  DGDGCISLEEFSVL  455
            +GDG +  ++F ++
Sbjct  196  NGDGFVCFDDFCLM  209



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  365
            GG +TPTSVL   + + S  E S  L  ++ +AFKLIDRD+DG + ++ELEALL Q+G  
Sbjct  116  GGVTTPTSVLAERSGDWS--EFSADLQLDMAKAFKLIDRDNDGVVSRKELEALLCQLGNN  173

Query  366  PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  545
            PPS+EE+ LMLSEVDRDG G I+LE         + P  DSELRDAF+ FDTD+DGKISA
Sbjct  174  PPSQEEVTLMLSEVDRDGSGSITLEALLNQVGPVSGPPADSELRDAFEVFDTDNDGKISA  233

Query  546  EELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EEL  VF  IGD RCTLE+CRRMI  VD
Sbjct  234  EELLRVFTAIGDERCTLEECRRMIAEVD  261


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  213  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  392
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  196  TLEALLNQVGPVSGPPADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  255

Query  393  MLSEVDRDGDGCISLEEF  446
            M++EVD++GDG +  EEF
Sbjct  256  MIAEVDKNGDGFVCFEEF  273



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 108/153 (71%), Gaps = 15/153 (10%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAE------LVQAFKLIDRDDDGKIRKEELEALLS  350
            GG +TPTSVLP         E SG +++      + QAFKLIDRD+DG + ++ELEALL 
Sbjct  128  GGITTPTSVLP---------EKSGDWSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLC  178

Query  351  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  530
            ++G  PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+ FDTD+D
Sbjct  179  RLGNAPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVFDTDND  238

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            GKISAEEL  VF  IGD RCTLE+CRRMI  VD
Sbjct  239  GKISAEELLRVFTAIGDERCTLEECRRMIDGVD  271


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  213  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  392
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  206  TLEALLNQVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  265

Query  393  MLSEVDRDGDGCISLEEF  446
            M+  VD+DGDG +  EEF
Sbjct  266  MIDGVDKDGDGFVCFEEF  283



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 109/159 (69%), Gaps = 8/159 (5%)
 Frame = +3

Query  174  GYKKP----GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEA  341
            G++ P     G  TPTSVLP  + + S D  +  Y EL QAFK++D+D+DG I + ELEA
Sbjct  52   GHQYPSAATAGFVTPTSVLPQTSGDWS-DFPANFYLELCQAFKMLDKDNDGVISRSELEA  110

Query  342  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF--SVLSSAFAPPSCDSELRDAFDFF  515
            LL +V  +PPSR E+ LMLSEVD DGDG I+LE     V+  A   P+C+ ELR+ FD F
Sbjct  111  LLGKVARQPPSRIEVSLMLSEVDGDGDGYINLETLMNQVVGPACDEPACEPELRETFDIF  170

Query  516  DTDHDGKISAEELFNVFK-TIGDSRCTLEDCRRMILWVD  629
            DTDHDGKI+AEEL   FK  IGD RCTLEDCRRMI  VD
Sbjct  171  DTDHDGKITAEELMAFFKDKIGDERCTLEDCRRMIASVD  209



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 10/151 (7%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            KPG  +TP SVLP  + +         Y+EL+QAFKLIDRDDDG + ++EL ALLS++  
Sbjct  51   KPGPAATPVSVLPGGDQD--------FYSELIQAFKLIDRDDDGVVSRKELAALLSRLSP  102

Query  363  EPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
            EPPS+EE+ LML EVD  GDGCISLEE +  V  S+        E+R+ F+FFD DHDG+
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLEELASRVAGSSSDSDESSVEMREVFEFFDVDHDGR  162

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  163  ISAEELHRVFGVIGDERCTLEECVRMIATVD  193



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 5/151 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  369  PSREELRLMLSEVDRDGDGCISLE----EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
            P+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+AF+ FDTD DG+
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRDGR  165

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ISAEEL  VF+ IGD RCTLE+C+RMI  VD
Sbjct  166  ISAEELLRVFRAIGDERCTLEECKRMIAGVD  196


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL +AF++ D D DG+I  EEL  +   +G E  + EE + M++ VD++GDG +  +EFS
Sbjct  150  ELREAFEVFDTDRDGRISAEELLRVFRAIGDERCTLEECKRMIAGVDKNGDGFVCFQEFS  209

Query  450  VL  455
            ++
Sbjct  210  LM  211



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 5/151 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  369  PSREELRLMLSEVDRDGDGCISLE----EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
            P+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+AF+ FDTD DG+
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRDGR  165

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ISAEEL  VF+ IGD RC LE+C+RMI  VD
Sbjct  166  ISAEELLRVFRAIGDERCALEECKRMIAGVD  196


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL +AF++ D D DG+I  EEL  +   +G E  + EE + M++ VD++GDG +  +EFS
Sbjct  150  ELREAFEVFDTDRDGRISAEELLRVFRAIGDERCALEECKRMIAGVDKNGDGFVCFQEFS  209

Query  450  VL  455
            ++
Sbjct  210  LM  211



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 103/150 (69%), Gaps = 11/150 (7%)
 Frame = +3

Query  192  GESTPTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            G  TPTSVLP    E S D L   +  Y EL QAFK +D+D+DG I + E+EALLS+   
Sbjct  61   GTGTPTSVLP----ETSVDWLDFSANFYVELCQAFKTMDKDNDGVITRSEVEALLSKFAR  116

Query  363  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  542
            +PPS+EE+  ML EVD DGDGCISLE    L +  A P+C+ ELR+ FD FDTDHDGKI+
Sbjct  117  QPPSQEEISSMLGEVDGDGDGCISLE---TLINQVAGPACEPELRETFDIFDTDHDGKIT  173

Query  543  AEELFNVFK-TIGDSRCTLEDCRRMILWVD  629
            AEEL   +K  +GD RCTLEDCR MI  VD
Sbjct  174  AEELMAFYKEKLGDERCTLEDCRLMIASVD  203


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQ-VGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL + F + D D DGKI  EEL A   + +G E  + E+ RLM++ VD++GDG +  ++F
Sbjct  156  ELRETFDIFDTDHDGKITAEELMAFYKEKLGDERCTLEDCRLMIASVDKNGDGFVCFDDF  215

Query  447  S  449
            S
Sbjct  216  S  216



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 105/159 (66%), Gaps = 17/159 (11%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEA  341
            G +KP   STPTSV+P         E+SG     Y ELVQAFKLIDRDDDG + + EL A
Sbjct  50   GDRKPSPASTPTSVIP---------EISGGDRDFYTELVQAFKLIDRDDDGVVSRNELAA  100

Query  342  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS---VLSSAFAPPSCDSELRDAFDF  512
            +L ++  EPPS EE+R+ML EVD  GDGCISLEE +     +SA        ELR+ F+F
Sbjct  101  VLRRLSPEPPSEEEVRMMLREVD-GGDGCISLEELASRVAGTSATGSSVEKGELREVFEF  159

Query  513  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            FD D DG+ISAEEL  VF  IGD RCTL++CRRMI  VD
Sbjct  160  FDADRDGRISAEELLRVFGVIGDDRCTLDECRRMIATVD  198



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 106/147 (72%), Gaps = 12/147 (8%)
 Frame = +3

Query  201  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            TP SVLP L+ + S D  S  ++ELVQAFKL+D D+DG + + +LE+LL ++GAE    E
Sbjct  53   TPPSVLPDLSGDWS-DVSSDFFSELVQAFKLMDNDNDGIVSRTQLESLLIRLGAE----E  107

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC----DSELRDAFDFFDTDHDGKISAE  548
            E+  MLSEVDRDGDGCIS+E    L S    P+C    D ELR AF+FFDTDHDGKI+AE
Sbjct  108  EVATMLSEVDRDGDGCISVE---ALMSRIGGPACEPAGDDELRVAFEFFDTDHDGKITAE  164

Query  549  ELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EL  V+K IGD RCTL+DCRRMI  VD
Sbjct  165  ELMGVYKAIGDERCTLDDCRRMIAGVD  191



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +EL QAFK+ID+D+DG I + ELEALLS+V  +PPSREE+ LMLSEV  DG GCISL+  
Sbjct  35   SELCQAFKIIDKDNDGVITRSELEALLSKVARQPPSREEVSLMLSEVYGDGVGCISLDTL  94

Query  447  --SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK-TIGDSRCTLEDCRRMI  617
               V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK TIGD RCTLEDCRRMI
Sbjct  95   MTQVVVPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMI  154

Query  618  LWVD  629
              VD
Sbjct  155  ASVD  158


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQ-VGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL + F + D D DGKI  EEL A   + +G E  + E+ R M++ VD++GDG +  E+F
Sbjct  111  ELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMIASVDKNGDGFVCFEDF  170

Query  447  S  449
            +
Sbjct  171  A  171



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 106/156 (68%), Gaps = 8/156 (5%)
 Frame = +3

Query  180  KKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALL  347
            +KP   STP SVLP ++ + S  ++S      YAELVQAFKLIDRDDDG + + EL ALL
Sbjct  51   RKPDPASTPISVLPEISGDWS--QISAGDRDFYAELVQAFKLIDRDDDGMVSRSELAALL  108

Query  348  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDT  521
            S++  +PPS+EE+ +ML  VD   DGCISLEE +  V  S+ A      ELR+ F FFD 
Sbjct  109  SRLSPDPPSQEEVSMMLRVVDGGDDGCISLEELANRVAGSSAAGSMEAGELREVFGFFDA  168

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            D DG+ISAEEL  VF  IGD RCTLE+C+RMI  VD
Sbjct  169  DRDGRISAEELHRVFAVIGDERCTLEECQRMIATVD  204



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +3

Query  186  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            GA+PP++EE++ MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDFFD DHDG
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDFFDADHDG  169

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KI+AEELF VF  +GD  CTL+DCR MI  VD
Sbjct  170  KITAEELFGVFTKLGDELCTLDDCRGMIALVD  201



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 105/155 (68%), Gaps = 13/155 (8%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + ++EL ALLS+
Sbjct  42   GNLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKELAALLSR  93

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTD  524
            +  EPPS+EE+ +ML EV  D DGCISLEE  S ++ + +   C    E+R+ F+FFD D
Sbjct  94   LSPEPPSQEEVSMMLREV--DADGCISLEELASRVAGSTSGEGCVETEEMREVFEFFDAD  151

Query  525  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             DG+ISAEEL  VF  IGD RCTLEDC RMI  VD
Sbjct  152  RDGRISAEELHRVFGVIGDERCTLEDCVRMIATVD  186



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 6/146 (4%)
 Frame = +3

Query  192  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  371
            G  TPTS+LP ++ + + D  + LY EL QAFKLIDRD+DG + + ELEALL+++GAEPP
Sbjct  54   GFRTPTSILPQVSGDWT-DISADLYFELTQAFKLIDRDNDGLVSRNELEALLTRLGAEPP  112

Query  372  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  551
            S EE+ ++L EVD      IS+E  +        P+ D ELRDAF FFD+D DGKI+A+E
Sbjct  113  SSEEMAVILGEVDH-----ISVEALASRLGTACEPAGDDELRDAFVFFDSDRDGKITADE  167

Query  552  LFNVFKTIGDSRCTLEDCRRMILWVD  629
            L NV+K  GD +CTLEDCRRMI  VD
Sbjct  168  LLNVYKAFGDEKCTLEDCRRMIAVVD  193



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 107/152 (70%), Gaps = 4/152 (3%)
 Frame = +3

Query  186  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            P    TPTSVL  ++    ++S D    L  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            GA+PP++EE+  MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDFFD DHDG
Sbjct  110  GADPPTQEEVSSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDFFDADHDG  169

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KI+AEELF VF  +GD  CTL+DCR MI  VD
Sbjct  170  KITAEELFGVFTKLGDELCTLDDCRGMIALVD  201



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYA--ELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
             G  TPTSVLP ++ + +  + S  Y+  ELVQAFKLID+D+DG + +++LEALLS++G 
Sbjct  46   AGTVTPTSVLPEVSGDFAAVDASYPYSYLELVQAFKLIDKDNDGAVSRQDLEALLSRLGP  105

Query  363  EPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  539
            +P S+EE+ +ML ++DRDGDG I LE   S + SA       +ELR+ F+FFD D DG I
Sbjct  106  DPLSQEEIDVMLGDLDRDGDGAIRLEALASRVVSAGDLSRHSAELRETFEFFDADRDGLI  165

Query  540  SAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            SAEEL  VF +IGD +CTLEDCRRMI  VD
Sbjct  166  SAEELLRVFASIGDEQCTLEDCRRMIAAVD  195


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +3

Query  237  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  416
            +S  +LS   AEL + F+  D D DG I  EEL  + + +G E  + E+ R M++ VD D
Sbjct  138  VSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIAAVDED  197

Query  417  GDGCISLEEFS  449
            GDG +   EFS
Sbjct  198  GDGFVCFGEFS  208



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G EP
Sbjct  47   GGSVTPTSILPEVPSPYS-------YIEILQAFKLIDRDNDGAVSRHDLESLLSRLGPEP  99

Query  369  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  548
             + EE+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FFD D DG ISA+
Sbjct  100  LTEEEINVMIKEVDGDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISAD  159

Query  549  ELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EL  VF TIGD RCTL+DC+RMI  VD
Sbjct  160  ELLRVFSTIGDERCTLDDCKRMIADVD  186



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTSVLP ++ + S D    +  EL QAF+LIDRD+DG + +EELE +L+++GA  
Sbjct  52   GGSQTPTSVLPEISGDWS-DVTVDVQWELSQAFRLIDRDNDGVVSREELELVLTRLGARA  110

Query  369  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  548
               EE+ +ML+EVD DG GCIS+E         + P+ + ELR+AF+ FDTD DG+ISAE
Sbjct  111  ---EEIAIMLTEVDGDGRGCISVEAIMNRVGTGSDPNPEEELREAFEVFDTDRDGRISAE  167

Query  549  ELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EL  VFK IGD RCTLE+CRRMI  VD
Sbjct  168  ELLRVFKAIGDERCTLEECRRMIEGVD  194



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 6/147 (4%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  369  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  548
            PS +E+ +ML EVD      IS+EE +    +   P+   ELRDAF FFD+D DGKI+AE
Sbjct  115  PSSQEMAVMLGEVD-----LISVEELASRLGSACEPAGGDELRDAFVFFDSDRDGKITAE  169

Query  549  ELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EL NV+K  GD +CTLEDC+ MI  VD
Sbjct  170  ELLNVYKAFGDEKCTLEDCKGMIAVVD  196



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 103/155 (66%), Gaps = 13/155 (8%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTD  524
            +  EPPS EE+ +ML EV  D DGCISLEE  S ++   +   C    E+R+ F+FFD D
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDAD  151

Query  525  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             DG+ISAEEL  VF  IGD RCTLEDC RMI  VD
Sbjct  152  RDGRISAEELHRVFGVIGDERCTLEDCVRMIATVD  186



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 103/155 (66%), Gaps = 13/155 (8%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTD  524
            +  EPPS EE+ +ML EV  D DGCISLEE  S ++   +   C    E+R+ F+FFD D
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDAD  151

Query  525  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             DG+ISAEEL  VF  IGD RCTLEDC RMI  VD
Sbjct  152  RDGRISAEELHRVFGVIGDERCTLEDCVRMIATVD  186



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 6/142 (4%)
 Frame = +3

Query  204  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  383
            PTS+LP    EISP   S  Y E++++F LIDR++DG I K +LE+LLS++G EP + EE
Sbjct  41   PTSILP----EISPSPYS--YVEILKSFSLIDRNNDGAISKHDLESLLSKLGPEPLTEEE  94

Query  384  LRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNV  563
            + +M+ EVDRDGDG I LEE +    +  P    +EL++ F+FFD D DG ISAEEL  V
Sbjct  95   IDVMIKEVDRDGDGTIRLEELASRVVSLDPCRDSTELKETFEFFDADRDGMISAEELLRV  154

Query  564  FKTIGDSRCTLEDCRRMILWVD  629
            F+TIGD RCTL+DC+RMI  VD
Sbjct  155  FETIGDERCTLDDCKRMIADVD  176



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  50   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  105

Query  369  PSREELRLMLSEVDRDGDGCISLEEFS----VLSSAFAPPS--CDSELRDAFDFFDTDHD  530
            P+ EE+ +ML EVD DGDG I LEE +    V+SS     S     EL++ F+FFD D D
Sbjct  106  PTEEEIDVMLKEVDCDGDGTIRLEELASRCVVVSSEDDNKSRGGSDELKETFEFFDADRD  165

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            GKISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  166  GKISAEELLRVFSAIGDERCTLEECERMIAAVD  198



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 3/141 (2%)
 Frame = +3

Query  210  SVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  386
            SVLP  + E S  E S  L  ++ QAFK IDRD+DG + ++ELEALL ++G +P SREE+
Sbjct  65   SVLPERSGEWS--EFSADLQLDMAQAFKXIDRDNDGVVSRKELEALLCRLGNDPQSREEV  122

Query  387  RLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  566
             LMLSEVDRDG+G ISLE         + P+ DSELRDAF+ FDTD+DGKISAEEL + F
Sbjct  123  TLMLSEVDRDGNGSISLEAVLNRVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLSFF  182

Query  567  KTIGDSRCTLEDCRRMILWVD  629
            + IGD  CTLE+C RMI   D
Sbjct  183  RAIGDEGCTLEECGRMIAGAD  203


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +3

Query  216  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  395
            L A+ + + P       +EL  AF++ D D+DGKI  EEL +    +G E  + EE   M
Sbjct  139  LEAVLNRVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLSFFRAIGDEGCTLEECGRM  198

Query  396  LSEVDRDGDGCISLEEFSVL  455
            ++  D++GDG +  EEF+ +
Sbjct  199  IAGADKNGDGFVCFEEFAHM  218



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 111/152 (73%), Gaps = 7/152 (5%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ---VG  359
            GG  TPTSVLP ++ ++S D  + +++EL +AFKLIDRD+DG + ++ELEALLS+   VG
Sbjct  58   GGSVTPTSVLPEISGDLS-DFSADIHSELAEAFKLIDRDNDGIVSRKELEALLSRLGGVG  116

Query  360  AEPPSREELRLMLSEVDR-DGDGCISLEEF--SVLSSAFAPPSCDSELRDAFDFFDTDHD  530
            +   S + +  MLSEVD  DG+GCIS+E     V S+A   P+ DSELR+AFDFFDTD D
Sbjct  117  SISESEDFVASMLSEVDGGDGEGCISVEALMSRVGSAAACEPAGDSELREAFDFFDTDRD  176

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
            G+I+A+EL + F  IGD RCTL+DCRRMI  V
Sbjct  177  GRITADELHSFFTAIGDERCTLQDCRRMIDGV  208



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score =   144 bits (363),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 110/155 (71%), Gaps = 9/155 (6%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            KPG  +TP SVLP  + + S  ++SG    Y++L+QAFKLIDRDDDG + + +L ALLS+
Sbjct  50   KPGPAATPVSVLPENSGDWS--QISGDRDFYSDLIQAFKLIDRDDDGVVSRGDLAALLSR  107

Query  354  VGAEPPSREELRLMLSEVDR-DGDGCISLEEFS--VLSSAFAPPSCDSE-LRDAFDFFDT  521
            +  +PPS+EE+ LML EVD  +  GCISLEE +  V  S+    S ++E +R+ F+FFD 
Sbjct  108  LSPDPPSQEEVSLMLREVDGGEESGCISLEELASRVAGSSSGEGSVETEEMREVFEFFDA  167

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
            D DGKISAEEL+ VF  IGD RCT+++CRRMI  V
Sbjct  168  DRDGKISAEELYRVFGVIGDERCTIDECRRMIATV  202


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEI---SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  359
            GGE +    L  L   +   S  E S    E+ + F+  D D DGKI  EEL  +   +G
Sbjct  127  GGEESGCISLEELASRVAGSSSGEGSVETEEMREVFEFFDADRDGKISAEELYRVFGVIG  186

Query  360  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP  473
             E  + +E R M++ V R+GDG +  E+FS +    AP
Sbjct  187  DERCTIDECRRMIATVGRNGDGFVCFEDFSRMMELQAP  224



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score =   144 bits (363),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 104/154 (68%), Gaps = 6/154 (4%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            K GG +TP SVL + + EIS D     +  + +LV+AFK IDRD DGKI + ELE +LS+
Sbjct  48   KEGGATTPRSVLHSHSHEISGDWSDLQADFHFQLVEAFKFIDRDGDGKITRRELENILSR  107

Query  354  VGAEPPSREELRLMLSE--VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  527
            +GA+ PS E   +++    VDRDGDGCI+L+E    S AF P    SELRDAFDFFD   
Sbjct  108  LGADTPSEEMQMMLMELMEVDRDGDGCINLKETGATSPAFGPYD-GSELRDAFDFFDAGR  166

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            DGKISA+EL  VF  +GD RCT+EDCR MI  VD
Sbjct  167  DGKISADELHRVFTALGDDRCTIEDCRLMIGGVD  200



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++ + SP      Y E++ AF+LIDRD+DG + + +L +LLS++G +P
Sbjct  49   GGSVTPTSILPEVSGDPSPYS----YVEILHAFQLIDRDNDGAVTRRDLSSLLSRLGPDP  104

Query  369  PSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  542
            PS EE+ +ML EVD DG+G I +EE +  V+SS  +  S  +EL++ F+FFD D DG IS
Sbjct  105  PSEEEIDVMLREVDCDGEGTIRIEELASRVVSSDQSRDS--TELKETFEFFDADRDGFIS  162

Query  543  AEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            AEEL  VF  IGD RCTLEDC+RMI  VD
Sbjct  163  AEELLRVFSAIGDERCTLEDCKRMIAAVD  191



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = +3

Query  192  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  371
            G  TPTS+LP ++ + + D  + LY EL QAFKLID D+DG + + ELEALL+++GAEPP
Sbjct  49   GFRTPTSILPQVSGDWT-DISNDLYFELTQAFKLIDGDNDGLVSRSELEALLTRLGAEPP  107

Query  372  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  551
            S EE+ ++L EVD      IS+E  +        P+ + ELRDAF FFD+D DGKI+A+E
Sbjct  108  SSEEMAVILGEVDH-----ISVEALASRLGTACEPAGNDELRDAFVFFDSDRDGKITADE  162

Query  552  LFNVFKTIGDSRCTLEDCRRMILWVD  629
            L NV+K  GD +CTL+DCRRMI  VD
Sbjct  163  LLNVYKAFGDEKCTLDDCRRMIAVVD  188



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 100/147 (68%), Gaps = 6/147 (4%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  369  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  548
            PS EE+ +ML E D      +S+E  +    +   P+ D ELRDAF FFD+D DG+I+AE
Sbjct  115  PSSEEMAVMLGERDH-----VSVEALASRLGSACEPAGDDELRDAFVFFDSDRDGRITAE  169

Query  549  ELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EL NV+K  GD +CTLEDC  MI  VD
Sbjct  170  ELLNVYKAFGDEKCTLEDCAGMIAVVD  196



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = +3

Query  201  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + E
Sbjct  54   TPTSILPEVPSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEE  106

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  560
            E+ +ML EVD DGDG I LEE +    +  P    +EL++ F+FFD D DG ISA+EL  
Sbjct  107  EINVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISADELLR  166

Query  561  VFKTIGDSRCTLEDCRRMILWVD  629
            VF TIGD RCTL+DC+RMI  VD
Sbjct  167  VFSTIGDERCTLDDCKRMIADVD  189



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 5/148 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  369  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  545
            P+ EE+ +ML EVD DGDG + LEE  S             EL++ F+FFD D DGKISA
Sbjct  101  PTEEEIDVMLREVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRDGKISA  160

Query  546  EELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EEL  VF  IGD RCTLE+C RMI  VD
Sbjct  161  EELLRVFSAIGDERCTLEECERMIAAVD  188


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +3

Query  237  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  416
            +  D+  G   EL + F+  D D DGKI  EEL  + S +G E  + EE   M++ VD D
Sbjct  131  VDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDD  190

Query  417  GDGCISLEEFSVL  455
            G+G +   EFS +
Sbjct  191  GNGFVCFTEFSRM  203



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 104/151 (69%), Gaps = 11/151 (7%)
 Frame = +3

Query  186  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
            GA+PP++EE++ MLSEVDR+GDG +         ++   P+C+ EL++ FDFFD DHDGK
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGRVG--------NSSCEPACEPELKETFDFFDADHDGK  161

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            I+AEELF VF  +GD  CTL+DCR MI  VD
Sbjct  162  ITAEELFGVFTKLGDELCTLDDCRGMIALVD  192



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 101/157 (64%), Gaps = 16/157 (10%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  K G  +TP SVLP  + +         YAEL+QAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYAELIQAFKLIDRDDDGVVSRGDLAALISR  97

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  518
            +  EPPS+EE+ LML EVD    GCISLEE   L+S  A  S +      ELR+ F+ FD
Sbjct  98   LSPEPPSQEEVSLMLREVDGGDGGCISLEE---LASRVAGTSGEGSVETEELREVFEIFD  154

Query  519  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             D +GKISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  155  VDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVD  191



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = +3

Query  285  FKLIDRDDDGKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS  461
            F + DRD DGKI + EL+A+L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + S
Sbjct  82   FAVFDRDGDGKITRHELQAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGS  141

Query  462  AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            AF PP+  ++LR+AF  FD D DGKISAEEL  VF T+GD  CTLEDCRRMI  VD
Sbjct  142  AFGPPA-GADLREAFAVFDADGDGKISAEELLGVFITLGDEGCTLEDCRRMIGGVD  196


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            A+L +AF + D D DGKI  EEL  +   +G E  + E+ R M+  VD DGDG +  E+F
Sbjct  149  ADLREAFAVFDADGDGKISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGDGFVCFEDF  208



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +3

Query  198  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            STP SVLP    +            LS   + +   F + DRD DGKI   ELEA+L ++
Sbjct  48   STPRSVLPPPAGKTPSSSGSDDLWLLSPASSSVSDLFAVFDRDGDGKITPHELEAVLRRL  107

Query  357  GA-EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            G  +PP+ EE+  M++EVDRDGDGCISLEEF  + +AF PP+  +ELR+AF  FD + DG
Sbjct  108  GGVDPPTEEEVASMVAEVDRDGDGCISLEEFGAIGTAFGPPA-GAELREAFAVFDANGDG  166

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KISAEEL  VF T+GD  CTLEDCRRMI  VD
Sbjct  167  KISAEELLGVFSTLGDEGCTLEDCRRMIGGVD  198


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL +AF + D + DGKI  EEL  + S +G E  + E+ R M+  VD DGDG +  ++F
Sbjct  151  AELREAFAVFDANGDGKISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFVCFDDF  210



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 99/148 (67%), Gaps = 5/148 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  369  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  545
            P+ EE+ +ML EV+ DGDG + LEE  S             EL++ F+FFD D DGKISA
Sbjct  101  PTEEEIDVMLKEVNCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRDGKISA  160

Query  546  EELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EEL  VF  IGD RCTLE+C RMI  VD
Sbjct  161  EELLRVFSAIGDERCTLEECERMIAAVD  188


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +3

Query  237  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  416
            +  D+  G   EL + F+  D D DGKI  EEL  + S +G E  + EE   M++ VD D
Sbjct  131  VDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDD  190

Query  417  GDGCISLEEFSVL  455
            G+G +   EFS +
Sbjct  191  GNGFVCFTEFSRM  203



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 102/154 (66%), Gaps = 12/154 (8%)
 Frame = +3

Query  183  KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  359
            KP G  +TP SVLP       P      Y ELVQAFKLIDRDDDG + + +L ALLS++ 
Sbjct  51   KPAGPTATPISVLP-------PQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLS  103

Query  360  AEPPSREELRLMLSEVDRDGD--GCISLEEF-SVLSSAFAPPSCDS-ELRDAFDFFDTDH  527
             EPPS+EE+ LML EVD D D  GCISLE+  S ++      S ++ ELR+ F++FD D 
Sbjct  104  PEPPSQEEVSLMLKEVDGDNDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  163

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            +GKISAEEL  VF  IGD RCTL++C RMI  VD
Sbjct  164  NGKISAEELHRVFGVIGDERCTLDECVRMIATVD  197



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = +3

Query  201  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            TPTS+LP ++   S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + +
Sbjct  57   TPTSILPDVSSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTED  109

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  560
            E+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FFD D DG ISAEEL  
Sbjct  110  EISVMIQEVDCDGDGAIRLEELASRLVSSDPSRDSAELKETFEFFDADRDGLISAEELLR  169

Query  561  VFKTIGDSRCTLEDCRRMILWVD  629
            VF TIGD RCTL+DC+RMI  VD
Sbjct  170  VFSTIGDDRCTLDDCKRMIADVD  192



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 100/157 (64%), Gaps = 16/157 (10%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  518
            +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD  154

Query  519  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             D +GKISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  155  VDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVD  191



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 100/157 (64%), Gaps = 16/157 (10%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  518
            +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD  154

Query  519  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             D +GKISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  155  VDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVD  191



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 103/153 (67%), Gaps = 11/153 (7%)
 Frame = +3

Query  189  GGESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            G ++TP SVL A + +    + PDE+S     L+  F + D D DGKI K ELEA+L ++
Sbjct  56   GLQTTPRSVLQAAHGKTPLFLFPDEVS-----LLDLFNMFDCDGDGKITKRELEAVLRRL  110

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS--CDSELRDAFDFFDTDHD  530
              + P+ EE+  M++E+DRDGDGCISL+EF+ L  A A  +   +SELR+AF  FD D D
Sbjct  111  VPDAPTAEEVASMVAEMDRDGDGCISLDEFAALGPALAASAGGGESELREAFAVFDADGD  170

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            GKISAEEL  VF T+GD  CTLEDCRRMI  VD
Sbjct  171  GKISAEELLGVFATLGDCGCTLEDCRRMIGGVD  203



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 5/148 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  82   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  137

Query  369  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  545
             + EE+ +ML EVD DGDG + LEE  S             EL++ F+FFD D DGKISA
Sbjct  138  LTEEEIDVMLKEVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRDGKISA  197

Query  546  EELFNVFKTIGDSRCTLEDCRRMILWVD  629
            EEL  VF  IGD RCTLE+C RMI  VD
Sbjct  198  EELLRVFSAIGDERCTLEECERMIAAVD  225


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +3

Query  237  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  416
            +  D+  G   EL + F+  D D DGKI  EEL  + S +G E  + EE   M++ VD D
Sbjct  168  VDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDD  227

Query  417  GDGCISLEEFS  449
            G+G +   EFS
Sbjct  228  GNGFVCFTEFS  238



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 106/167 (63%), Gaps = 16/167 (10%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPA---LNDEISPDELSG---LYAEL--------VQAFKLIDRDDD  311
            G+   G  STP SVLPA   L     P   +G   L+  L         + F + D D D
Sbjct  42   GFISSGLHSTPRSVLPASPGLRPAEKPPSAAGSNDLWLFLPASSSSSVSELFAVFDCDGD  101

Query  312  GKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS  488
            GKI ++ELEA+L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + SAF PP+  +
Sbjct  102  GKITRQELEAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGSAFGPPA-GA  160

Query  489  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ELR+ F  FD D DGKISAEEL  VF  +GD  CTLEDCRRMI  VD
Sbjct  161  ELREVFAVFDDDGDGKISAEELQRVFVMLGDDGCTLEDCRRMIGGVD  207


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL + F + D D DGKI  EEL+ +   +G +  + E+ R M+  VD DGDG +  E+F
Sbjct  160  AELREVFAVFDDDGDGKISAEELQRVFVMLGDDGCTLEDCRRMIGGVDTDGDGFVCFEDF  219



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score =   139 bits (350),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 101/158 (64%), Gaps = 17/158 (11%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  KPG  +TP SVLP  + +         Y ELVQAFKLIDRD DG + + +L ALLS+
Sbjct  46   GNLKPGPTATPISVLPHNSGD--------FYTELVQAFKLIDRDHDGVVSRGDLAALLSR  97

Query  354  VGAEPPSREELRLMLSEVDRDGDG-CISLEEFSVLSSAFAPPSCDS-----ELRDAFDFF  515
            +  EPPS+EE+ LML EVD D DG  I LEE   L+S  A  S +      ELR+ F+FF
Sbjct  98   LSPEPPSQEEVSLMLKEVDGDDDGDSIRLEE---LASRVAGTSGEGSVETEELREVFEFF  154

Query  516  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            D D +GKISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  155  DADRNGKISAEELHRVFGVIGDERCTLEECIRMIATVD  192



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 100/151 (66%), Gaps = 15/151 (10%)
 Frame = +3

Query  186  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
            GA+PP++EE++ MLSEVDR+GDG I LE               S L++ FDFFD DHDGK
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYIPLEALI------------SRLKETFDFFDADHDGK  157

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            I+AEELF VF  +GD  CTL+DCR MI  VD
Sbjct  158  ITAEELFGVFTKLGDELCTLDDCRGMIALVD  188


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +3

Query  252  LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  431
            L  L + L + F   D D DGKI  EEL  + +++G E  + ++ R M++ VD++GDG +
Sbjct  136  LEALISRLKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFV  195

Query  432  SLEEFS  449
              E+FS
Sbjct  196  CFEDFS  201



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  51   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  108

Query  369  PSREELRLMLSEVDRDGD-GCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKIS  542
             + +E+ +M+ EV  +GD G I LEE +        PS DS E+++ F+FFD D DG IS
Sbjct  109  LTEDEINVMIKEVGCEGDDGTIRLEELASRVVLSLDPSRDSAEMKETFEFFDADRDGLIS  168

Query  543  AEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            AEEL  VF TIGD RCTL+DC+RMI  VD
Sbjct  169  AEELLRVFSTIGDERCTLDDCKRMIADVD  197



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 98/151 (65%), Gaps = 7/151 (5%)
 Frame = +3

Query  195  ESTPTSVLPALNDEISPDE-----LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  359
             STP S+LPA              LS   + +   F + DRD DGKI ++ELEA+L  +G
Sbjct  49   HSTPRSILPAGKPPSVAGSGEFWLLSPASSSVSDLFAVFDRDRDGKITRQELEAVLRGLG  108

Query  360  -AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
             A+PP+ EE+  M++EVD DGDGCISLEEF  + SAF PP+   +LR+AF  FD D DGK
Sbjct  109  GADPPTEEEVASMVAEVDLDGDGCISLEEFGAIGSAFGPPA-GGDLREAFAVFDADGDGK  167

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ISAEEL  VF T+GD   TLEDCRRMI  VD
Sbjct  168  ISAEELLGVFVTLGDDGWTLEDCRRMIGEVD  198


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             +L +AF + D D DGKI  EEL  +   +G +  + E+ R M+ EVD DGDG +  E+F
Sbjct  151  GDLREAFAVFDADGDGKISAEELLGVFVTLGDDGWTLEDCRRMIGEVDTDGDGFVCFEDF  210



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 12/155 (8%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
             +K     +TP SVLP           S  ++EL+QAFKLIDRDDDG + + +L  L+S+
Sbjct  51   NHKPNPSSTTPISVLPWSG--------SDFHSELIQAFKLIDRDDDGVVSRRDLANLISK  102

Query  354  VGAEPPSREELRLMLSEVDRDG--DGCISLEEFSV-LSSAFAPPSCDSELRDAFDFFDTD  524
            +  EPPS EE+ LML EVD DG  DGCISLE+ +  +  A +    + E+R+ F++FD D
Sbjct  103  LSPEPPSHEEVSLMLREVD-DGEEDGCISLEDLANRVVVASSGDGSEEEMREVFEYFDVD  161

Query  525  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             DG+ISAEEL+ VF  IGD RCTL++CRRMI  VD
Sbjct  162  RDGRISAEELYRVFGVIGDERCTLDECRRMIATVD  196



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 97/157 (62%), Gaps = 17/157 (11%)
 Frame = +3

Query  174  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            G  K G  +TP SV     D          Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVSSNSGD---------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  96

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  518
            +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct  97   LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD  153

Query  519  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             D +GKISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  154  VDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVD  190



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 102/150 (68%), Gaps = 5/150 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  53   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  110

Query  369  PSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKI  539
             + +E+ +M+ EV  +   DG I LEE +        PS DS E+++ F+FFD D DG I
Sbjct  111  LTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAEMKETFEFFDADRDGLI  170

Query  540  SAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            SAEEL  VF TIGD RCTL+DC+RMI  VD
Sbjct  171  SAEELLRVFSTIGDERCTLDDCKRMIADVD  200



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG  TPTS+LP ++ + SP      Y E++QAFKLIDRD+DG I + +LE+LLS++G +P
Sbjct  51   GGSVTPTSILPEVSCDTSPPPPYS-YVEILQAFKLIDRDNDGAISRHDLESLLSRLGPDP  109

Query  369  PSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKI  539
             + +E+ +M+ EV  +   DG I LEE +        PS DS EL++ F+FFD D DG I
Sbjct  110  LTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAELKETFEFFDADRDGLI  169

Query  540  SAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            SAEEL  VF TIGD RCTL+DC+RMI  VD
Sbjct  170  SAEELLRVFSTIGDERCTLDDCKRMIADVD  199



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = +3

Query  177  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            +K   G  TPTSVLP ++ + S      +  +L QAF+LIDRD+DG + +++LEALL+ +
Sbjct  49   HKPSAGNQTPTSVLPGVSGDWSDVAAVDVRWDLAQAFRLIDRDNDGVVTRQDLEALLTCL  108

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
            GA P   +++ +ML EVD  GDG       S + S   P S   EL++AF+ FDTD DG+
Sbjct  109  GASP-CPDDVAVMLGEVD--GDGITVERLMSYVGSGLKPGSDPDELKEAFEVFDTDRDGR  165

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ISAEEL  VFK IGD RCTLE+CRRMI  VD
Sbjct  166  ISAEELLRVFKAIGDERCTLEECRRMIEGVD  196


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E+FS
Sbjct  150  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  209



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 98/151 (65%), Gaps = 13/151 (9%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDEL--SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            KPG  +TP SVLP ++ + S      S LY+ELVQAFKLIDRDDDG + + EL ALL+++
Sbjct  52   KPGPAATPISVLPEISGDWSQVSAGDSDLYSELVQAFKLIDRDDDGAVSRSELAALLTRL  111

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  536
              EPPS++E+ +ML    R+ DG        V  ++ A      ELR+ F+FFD D DG+
Sbjct  112  SPEPPSQDEVSMML----READG-------GVAGTSAAGSVEAEELREVFEFFDADRDGR  160

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  161  ISAEELLRVFGVIGDDRCTLEECLRMIATVD  191



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 101/154 (66%), Gaps = 13/154 (8%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSKLSP  101

Query  363  EPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAFAPPSCDS-ELRDAFDFFDTDH  527
            EPPS+EE+ LML EV     D  GCISLE+  S ++      S ++ ELR+ F++FD D 
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  161

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            +GKISAEEL  VF  IGD RCTLE+C RMI  VD
Sbjct  162  NGKISAEELHRVFGVIGDERCTLEECVRMIATVD  195



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 101/154 (66%), Gaps = 13/154 (8%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSP  101

Query  363  EPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAFAPPSCDS-ELRDAFDFFDTDH  527
            EPPS+EE+ LML EV     D  GCISLE+  S ++      S ++ ELR+ F++FD D 
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  161

Query  528  DGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            +GKISAEEL  VF  IGD RCTL++C RMI  VD
Sbjct  162  NGKISAEELHRVFGVIGDERCTLDECVRMIATVD  195



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 97/150 (65%), Gaps = 10/150 (7%)
 Frame = +3

Query  195  ESTPTSVLPALNDEIS----PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            ++TP SVLP  + +      PDE     A  +  F + D D DGKI K ELEA+L ++  
Sbjct  59   QATPRSVLPPDHGKAPVVFLPDE-----AAWLDLFNVFDCDGDGKITKRELEAVLRRLVP  113

Query  363  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC-DSELRDAFDFFDTDHDGKI  539
            +PP+ EE+  M++EVDRDGDGCISL+EF  L +        +SELRDAF  FD D DGKI
Sbjct  114  DPPTAEEVASMVAEVDRDGDGCISLDEFGALGALLGGGRGGESELRDAFAVFDADGDGKI  173

Query  540  SAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            SAEEL  VF T+GD  CTL+DCRRMI  VD
Sbjct  174  SAEELLGVFATLGDGGCTLDDCRRMIGGVD  203



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 100/153 (65%), Gaps = 5/153 (3%)
 Frame = +3

Query  177  YKKPGGESTPTSVLPALNDEISPDELSGL--YAELVQAFKLIDRDDDGKIRKEELEALLS  350
            +K   G  TPTSVLP ++ E S    + +    +L QA +LIDRD+DG + +++LE+LL+
Sbjct  50   HKPSPGNQTPTSVLPDVSGEWSEVAAAAVDVRWDLAQALRLIDRDNDGVVTRQDLESLLT  109

Query  351  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  530
            ++GA P S  ++ LML EVD DG    SL   S + S     S   EL++AF+ FDTD D
Sbjct  110  RLGASP-SPGDVALMLGEVDGDGITVESL--MSYVGSGLETGSDPDELKEAFEVFDTDRD  166

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            G+ISAEEL  VFK IGD RCTLE+CRRMI  VD
Sbjct  167  GRISAEELLRVFKAIGDERCTLEECRRMIEGVD  199


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E+FS
Sbjct  153  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  212



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 102/150 (68%), Gaps = 11/150 (7%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
             G  TPTSVLP ++ + S D    +  +L QAF+LIDRD+DG + +++LEA+L+++GA  
Sbjct  54   AGSLTPTSVLPGVSGDWS-DVTVDVRWDLAQAFRLIDRDNDGVVSRQDLEAVLTRLGAS-  111

Query  369  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS---ELRDAFDFFDTDHDGKI  539
                ++ LMLSEV+    GCI++E  ++++   + P   S   EL++AF  FDTD DG+I
Sbjct  112  ----DVALMLSEVEGGAGGCITVE--ALMNHIGSGPESGSDPEELKEAFAVFDTDRDGRI  165

Query  540  SAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            SAEEL  VF+ IGD RCTLE+CRRMI  VD
Sbjct  166  SAEELLRVFRAIGDERCTLEECRRMIEGVD  195


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +3

Query  189  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  368
            GG     +V   +N   S  E      EL +AF + D D DG+I  EEL  +   +G E 
Sbjct  122  GGAGGCITVEALMNHIGSGPESGSDPEELKEAFAVFDTDRDGRISAEELLRVFRAIGDER  181

Query  369  PSREELRLMLSEVDRDGDGCISLEEFS  449
             + EE R M+  VDR+GDG +  E+FS
Sbjct  182  CTLEECRRMIEGVDRNGDGFVCFEDFS  208



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 98/153 (64%), Gaps = 11/153 (7%)
 Frame = +3

Query  192  GES-TPTSVLPALNDEISPDE--LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  362
            GES TPTSVL              +G   EL +AF LIDRD DG + ++ELEALLS++G 
Sbjct  56   GESLTPTSVLGRGGGGGGGGGGVWAGSNLELARAFGLIDRDGDGILSRKELEALLSRLG-  114

Query  363  EPPSREELRLMLSEVDRDGDG---CISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  530
               SR+E+ +MLSEV   G+G    +S+EE  S +  A  P   D+ELR+ F+FFD DHD
Sbjct  115  ---SRDEVAVMLSEVGCHGEGEDAAVSIEELLSRVGPACGPACDDAELRETFEFFDADHD  171

Query  531  GKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            GKI+AEEL  VF   GD RCTLE+CRRMI  VD
Sbjct  172  GKITAEELLGVFAAFGDERCTLEECRRMISEVD  204


 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL + F+  D D DGKI  EEL  + +  G E  + EE R M+SEVD++GDG +  E+F
Sbjct  157  AELRETFEFFDADHDGKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFVCFEDF  216

Query  447  S  449
            +
Sbjct  217  T  217



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 102/161 (63%), Gaps = 17/161 (11%)
 Frame = +3

Query  189  GGES-TPTSVLP-----ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  350
            GGE+ TPTSVLP       +D  S  E++G   ELV+AF  ID D+DG + +E+LEALLS
Sbjct  47   GGEARTPTSVLPPQLSGEWSDVASSSEMNG---ELVRAFTYIDGDNDGVLSREDLEALLS  103

Query  351  QVGAEPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAF----APPSCDSELRDAF  506
            ++GAEP S +E  LML EV   D  G   + +E+  S + SA     A   CD E+R  F
Sbjct  104  RLGAEPLSADEKALMLREVGCADEGGAAGVRIEDLVSRVGSAGGDEEADAGCDVEMRRTF  163

Query  507  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            +FFD + DG+I+AEEL   F+ +GD RCTL +CRRMI  VD
Sbjct  164  EFFDRNGDGRITAEELLGAFEAMGDGRCTLGECRRMIAEVD  204



>ref|XP_010931583.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=215

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +3

Query  297  DRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP  476
            +++ DG+I + ELE +L ++G +PP+ EE+  ML+E DR GDG I LEE   L SAF PP
Sbjct  86   EKEGDGRITRRELEVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLEEIVALGSAFGPP  145

Query  477  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                ELR+ F  FD D DG ISAEEL  +F T+GD RCTLEDCRRMI  VD
Sbjct  146  VV-PELRETFAVFDGDGDGMISAEELLAMFVTLGDKRCTLEDCRRMIGVVD  195



>ref|XP_008789596.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=209

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 91/152 (60%), Gaps = 10/152 (7%)
 Frame = +3

Query  195  ESTPTSVLP-------ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  353
            +STP SVLP       A +  I   E    ++         +R+ + ++ + ELE +L +
Sbjct  41   QSTPKSVLPPSPRRRVAKSASIGGGEE--CWSSSSTDHSPAEREGEERVTRRELEVVLQR  98

Query  354  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
            +G +PP+ EE+  ML+E DR GDG I L+E   L SAF PP    ELR+ F  FD D DG
Sbjct  99   LGPDPPTEEEVAAMLAEADRGGDGSIRLQEIVALGSAFGPPVA-PELRETFAVFDVDGDG  157

Query  534  KISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            KISAEEL  +F T+GD RCTLEDCRRMI  VD
Sbjct  158  KISAEELLAMFVTLGDERCTLEDCRRMIGVVD  189



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = +3

Query  264  YAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  443
            + EL++AF LID+D+DG + + +LEALL+Q+G  PP+++E+ +ML EVDRDG G IS++ 
Sbjct  54   HLELLKAFTLIDKDNDGAVSRHDLEALLTQLGPNPPNKDEINVMLREVDRDGHGTISIDT  113

Query  444  FSV----LSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF-KTIGDSRCTLEDCR  608
             +       S+ +     +EL++ F+ FD+D +G ISAEEL  VF   IGD RCTLE+C 
Sbjct  114  LATRVVSSVSSDSSHGSSTELKETFELFDSDRNGLISAEELLRVFAAAIGDDRCTLEECS  173

Query  609  RMILWVD  629
            RMI  VD
Sbjct  174  RMIAAVD  180



>ref|XP_010922185.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=209

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +3

Query  294  IDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP  473
            ++RD + ++ + ELE +L ++G +PP+ EE+  ML+E DR G+G I L+E   L SAF P
Sbjct  79   VERDGEERVTRRELEVVLRRLGPDPPTEEEVVAMLAEADRGGEGSIRLQEIVALGSAFGP  138

Query  474  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            P    EL+  F  FD D DGKISAEEL  +F T+GD RCTLEDCRRMI  VD
Sbjct  139  PVA-PELQQTFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVD  189


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL Q F + D D DGKI  EEL A+   +G E  + E+ R M+  VD DGDG +  E+F
Sbjct  143  ELQQTFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDGDGFVCFEDF  201



>ref|XP_008786895.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=205

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 87/145 (60%), Gaps = 1/145 (1%)
 Frame = +3

Query  195  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  374
            + TP +VLP L         +   +     +   +R+ +G+I + ELE +L ++G +PP+
Sbjct  42   QCTPKTVLPRLPGCHLAAPAAKSASSSSTDYPSAEREGEGRITRRELEVVLRRLGPDPPT  101

Query  375  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  554
             EE+  ML+E DR GDG I LEE   L S   PP    ELR+ F  FD D DGKISAEEL
Sbjct  102  EEEVVAMLAEADRAGDGSIRLEEIVELGSVVGPPVV-PELRETFAVFDADGDGKISAEEL  160

Query  555  FNVFKTIGDSRCTLEDCRRMILWVD  629
              +F T+GD +CTLEDCRRMI  VD
Sbjct  161  LAMFVTLGDEQCTLEDCRRMIGVVD  185



>ref|XP_010672963.1| PREDICTED: probable calcium-binding protein CML35 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = +3

Query  279  QAFKLIDRDDDGKIRKEELEALLSQVGAEPPS--REELRLMLSEVDRDGDGCISLEEFSV  452
            +AFK++D D DGKI + EL +L  +V    PS   EE+  M+ ++D DGDGCISLEE   
Sbjct  70   EAFKMMDLDGDGKITRVELHSLFKRVRVNAPSLSEEEVAEMIKDIDTDGDGCISLEELEA  129

Query  453  LSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            + SA  P   D + L+DAF FFD + DGKIS EEL   F  +GD RCTLE+CRRMI  VD
Sbjct  130  VGSALDPTGADEDDLKDAFGFFDVNKDGKISPEELHAGFVALGDERCTLEECRRMIEGVD  189



>ref|XP_004136671.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
Length=166

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 84/143 (59%), Gaps = 39/143 (27%)
 Frame = +3

Query  201  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  43   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  81

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  560
            E+++M+ E+DR G                  P+C SELRD F+ FD DHDG+I+AEELF+
Sbjct  82   EIKIMMGEMDRVG------------------PTCHSELRDTFEIFDADHDGRITAEELFS  123

Query  561  VFKTIGDSRCTLEDCRRMILWVD  629
            VF  +GD  CTLEDC+RMI  VD
Sbjct  124  VFAAMGDDGCTLEDCQRMIAGVD  146



>ref|XP_004159632.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
 gb|KGN59507.1| hypothetical protein Csa_3G823060 [Cucumis sativus]
Length=167

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 84/143 (59%), Gaps = 39/143 (27%)
 Frame = +3

Query  201  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  44   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  82

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  560
            E+++M+ E+DR G                  P+C SELRD F+ FD DHDG+I+AEELF+
Sbjct  83   EIKIMMGEMDRVG------------------PTCHSELRDTFEIFDADHDGRITAEELFS  124

Query  561  VFKTIGDSRCTLEDCRRMILWVD  629
            VF  +GD  CTLEDC+RMI  VD
Sbjct  125  VFAAMGDDGCTLEDCQRMIAGVD  147



>ref|XP_008443339.1| PREDICTED: probable calcium-binding protein CML35 [Cucumis melo]
Length=233

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 18/107 (17%)
 Frame = +3

Query  309  DGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS  488
            D  + ++EL+ALL  +GAEPPS EE+++M+ E+DR G                  P+C S
Sbjct  125  DPTLSRKELKALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PACHS  166

Query  489  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            ELRD F+ FD DHDG+I+AEELF+VF  +GD  CTLEDCRRMI  VD
Sbjct  167  ELRDTFEIFDADHDGRITAEELFSVFTAMGDEGCTLEDCRRMIAGVD  213



>ref|XP_008457589.1| PREDICTED: probable calcium-binding protein CML36 [Cucumis melo]
Length=192

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 79/110 (72%), Gaps = 5/110 (5%)
 Frame = +3

Query  300  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS  479
            R+++G + ++ELEA+LS++ +E    EE+ +MLSEVD  GDG I LEE      +    +
Sbjct  68   RENEGVVTRKELEAILSRIASE----EEVAMMLSEVDSGGDGFIRLEELMARVGS-GEAA  122

Query  480  CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             +SELR+ F+FFD D DG+I+AEEL  VF++IGD +CTLEDCRRMI  VD
Sbjct  123  GESELRETFEFFDADQDGRITAEELHGVFRSIGDEQCTLEDCRRMIRDVD  172



>ref|XP_004151276.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 ref|XP_004172820.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 gb|KGN54524.1| hypothetical protein Csa_4G355130 [Cucumis sativus]
Length=192

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = +3

Query  300  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS  479
            R ++G + ++ELEA+LS++ +E    EE+ +ML EVD  GDG I LEE      +    +
Sbjct  68   RGNEGVVSRKELEAILSRIASE----EEVAMMLREVDSGGDGFIRLEELMARVGS-GEAA  122

Query  480  CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             +SE+R+ F+FFD D DG+I+AEEL  VF++IGD RCTLEDC RMI  VD
Sbjct  123  GESEMRETFEFFDADQDGRITAEELHGVFRSIGDERCTLEDCGRMIRDVD  172



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 83/135 (61%), Gaps = 4/135 (3%)
 Frame = +3

Query  234  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  413
            +  P +  G   ++ Q F   D++ DGKI  +EL  +LS +G+ P +REE +  ++E+D+
Sbjct  26   QAKPADSLGNVDQVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDK  85

Query  414  DGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  584
            DGDG I L+EF+  +L      P C + ELRDAFD +D D +G IS  EL  V K +G  
Sbjct  86   DGDGFIDLDEFAELILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKLG-Q  144

Query  585  RCTLEDCRRMILWVD  629
            +C+L DCR+MI  VD
Sbjct  145  KCSLRDCRKMISSVD  159


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL  AF L D D +G I   EL A++ ++G +  S  + R M+S VDRDGDG ++ EEF 
Sbjct  114  ELRDAFDLYDLDGNGVISVSELHAVMKKLG-QKCSLRDCRKMISSVDRDGDGNVNFEEFK  172

Query  450  VLSSA  464
             + +A
Sbjct  173  KMMTA  177



>ref|XP_010924246.1| PREDICTED: probable calcium-binding protein CML35 [Elaeis guineensis]
Length=320

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 85/145 (59%), Gaps = 10/145 (7%)
 Frame = +3

Query  198  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            STP SVLP    +            LS   + +   F + +RD DGKI   ELEA+L  +
Sbjct  67   STPCSVLPPPTGKTPSSSRSDDLWLLSPASSSISNLFIIFNRDGDGKIMPHELEAILCHL  126

Query  357  -GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  533
             GA PP++EEL  M+ EV+RD +GCISLE F  + + F      +EL +AF  FD ++DG
Sbjct  127  HGANPPTKEELASMVVEVNRDDNGCISLE-FGAIETTFRLLE-GAELWEAFAIFDANNDG  184

Query  534  KISAEELFNVFKTIGDSRCTLEDCR  608
            KIS EEL  +F T+ D  CTLEDCR
Sbjct  185  KISIEELLRMFNTLRDEGCTLEDCR  209



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 90/151 (60%), Gaps = 7/151 (5%)
 Frame = +3

Query  192  GESTPTSV---LPALNDEISP-DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  359
            G+++PT+     P +N   S  +  S L  EL Q FK  D + DGKI   EL ++L  VG
Sbjct  18   GDTSPTTAPVQAPMINSRSSSLNGRSRLEEELEQVFKKFDVNGDGKISASELGSILGSVG  77

Query  360  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  536
             +P + EELR+M+ EVD DGDG I L+EF  L++           L+DAF  FD D +G 
Sbjct  78   -QPATEEELRIMIQEVDADGDGFIDLQEFIALNTTDVGHEEVMENLKDAFKVFDIDKNGY  136

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            I+AEEL +V +++G+  CTL +C +MI  VD
Sbjct  137  ITAEELQDVLQSLGE-ECTLAECEKMISGVD  166



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 3/134 (2%)
 Frame = +3

Query  231  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  410
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+ML EVD
Sbjct  7    DSSQPTSLTAEMEEVEKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMML-EVD  65

Query  411  RDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
             DGDG I L+EF+       +P + + +LR+AF+ +D D +GKISA EL +V K IG+ +
Sbjct  66   TDGDGFIDLKEFAAFHCPVESPNTVNKDLREAFNLYDKDKNGKISAAELHSVMKGIGE-K  124

Query  588  CTLEDCRRMILWVD  629
            C+L+DCRRMI  VD
Sbjct  125  CSLKDCRRMISSVD  138


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            +  +L +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDG ++ E
Sbjct  90   VNKDLREAFNLYDKDKNGKISAAELHSVMKGIG-EKCSLKDCRRMISSVDDDGDGSVNFE  148

Query  441  EFSVLSS  461
            EF  + S
Sbjct  149  EFKKMMS  155



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 3/134 (2%)
 Frame = +3

Query  231  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  410
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+M+ EVD
Sbjct  7    DSSPPASLTAEMEEVKKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMI-EVD  65

Query  411  RDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
             DGDG I L+EF+       +P + + +LRDAF+ +D D +GKISA EL +V K IG+ +
Sbjct  66   TDGDGFIDLKEFAAFHCPVESPNTVNKDLRDAFNLYDKDKNGKISAAELHSVMKGIGE-K  124

Query  588  CTLEDCRRMILWVD  629
            C+L+DCRRMI  VD
Sbjct  125  CSLKDCRRMISSVD  138


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            +  +L  AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD D DG ++ E
Sbjct  90   VNKDLRDAFNLYDKDKNGKISAAELHSVMKGIG-EKCSLKDCRRMISSVDDDCDGSVNFE  148

Query  441  EFSVLSS  461
            EF  + S
Sbjct  149  EFKKMMS  155



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPSSDEELNSMISEVDSDGDGFINFKEF  113

Query  447  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++           L+DAF  +D D +G ISAEEL+ V +++GD  C++++CR+MI  
Sbjct  114  VELNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIDECRQMIGG  172

Query  624  VD  629
            VD
Sbjct  173  VD  174



>gb|EYU30122.1| hypothetical protein MIMGU_mgv1a025962mg [Erythranthe guttata]
Length=187

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 79/134 (59%), Gaps = 6/134 (4%)
 Frame = +3

Query  240  SPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  410
            SP +  G   +  EL   FK  D + DGKI   EL +++  +G  P + EELR M+ EVD
Sbjct  27   SPSQNGGRCRIEEELEHVFKKFDVNGDGKICAAELGSIMGSLG-HPATEEELRTMIQEVD  85

Query  411  RDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
             DGDG I L EF  L++           LRDAF+ FD D +G ISAEEL NV K++G+  
Sbjct  86   SDGDGFIDLREFIELNTNGIGQDEVIENLRDAFEVFDMDKNGSISAEELHNVLKSLGE-E  144

Query  588  CTLEDCRRMILWVD  629
            CTL +CR+MI  VD
Sbjct  145  CTLAECRKMISGVD  158



>ref|XP_004298507.1| PREDICTED: probable calcium-binding protein CML25 [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 81/146 (55%), Gaps = 3/146 (2%)
 Frame = +3

Query  195  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  374
            +STP+S    L             AEL Q F   D + DGKI   EL A++  +G  P +
Sbjct  12   KSTPSSAAAPLVMRSPSFATRAQIAELEQVFNKFDVNGDGKISSSELGAIMGSLG-HPAT  70

Query  375  REELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEE  551
             +ELR M+ EVD DGDG I + EF  L++           LRDAF  +D D +G ISAEE
Sbjct  71   EDELRSMILEVDADGDGFIDINEFVELNTKGIDSAEALQNLRDAFSVYDKDGNGSISAEE  130

Query  552  LFNVFKTIGDSRCTLEDCRRMILWVD  629
            LF V K++GD  C+L +CR+MI  VD
Sbjct  131  LFEVLKSLGD-ECSLAECRKMIGGVD  155



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 4/123 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +EF 
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFV  70

Query  450  VLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
             L++     A  +   EL+ AF  FDTD +G ISAEEL+ V   +G+   T+EDC RMI 
Sbjct  71   HLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIG  130

Query  621  WVD  629
             VD
Sbjct  131  GVD  133


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = +3

Query  225  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  404
            LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  
Sbjct  72   LNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGG  131

Query  405  VDRDGDGCISLEEFS--VLSSAFAPPSC  482
            VD DGDG ++ EEF   +LSS+ A PS 
Sbjct  132  VDSDGDGFVNFEEFQRMMLSSSNASPST  159



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPASDEELNGMISEVDSDGDGFINFKEF  180

Query  447  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++    P      L+DAF  +D D +G IS EEL+ V +++GD  C++++CR+MI  
Sbjct  181  VELNTKGIDPDEALENLKDAFSVYDIDGNGSISVEELYKVLRSLGD-ECSMDECRKMIGG  239

Query  624  VD  629
            VD
Sbjct  240  VD  241



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 79/123 (64%), Gaps = 9/123 (7%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F+  D + DGKI   EL+ +L+ +G +    E  R+ML EVD DGDG I LEEF+
Sbjct  10   EVEKVFRKYDTNGDGKISLSELDGVLNALGTKTTPDEAKRMML-EVDTDGDGFIDLEEFA  68

Query  450  VLSSAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
                AF  P   S   +LRDAFD +D D +GKISA EL +V K IG+ +C+L+DCRRMI 
Sbjct  69   ----AFHCPVEGSNSKDLRDAFDLYDKDKNGKISASELHSVMKGIGE-KCSLKDCRRMIS  123

Query  621  WVD  629
             VD
Sbjct  124  SVD  126


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L  AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDG ++ EEF 
Sbjct  81   DLRDAFDLYDKDKNGKISASELHSVMKGIG-EKCSLKDCRRMISSVDDDGDGSVNFEEFK  139

Query  450  VL  455
             +
Sbjct  140  KM  141



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 4/123 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +EF 
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFV  70

Query  450  VLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
             L++     A  +   EL+ AF  FDTD +G ISAEEL+ V   +G+   T+EDC RMI 
Sbjct  71   HLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIG  130

Query  621  WVD  629
             VD
Sbjct  131  GVD  133


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +3

Query  225  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  404
            LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  
Sbjct  72   LNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGG  131

Query  405  VDRDGDGCISLEEFS  449
            VD DGDG ++ EEF 
Sbjct  132  VDSDGDGFVNFEEFQ  146



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 90/156 (58%), Gaps = 11/156 (7%)
 Frame = +3

Query  177  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  356
            + +P       S  P+ +  +S    + L  EL Q FK  D + DGKI   EL +++  +
Sbjct  7    FNRPKDMIPSASSTPSRSTSLSVHSRARLAGELEQVFKKFDVNGDGKISASELGSIMGSL  66

Query  357  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDT  521
            G +P + +EL  M+ EVD DGDGCISL+EF  L++       DS+     L+DAF  FD 
Sbjct  67   G-QPATEQELDNMIREVDGDGDGCISLQEFIELNT----KGVDSDEILENLKDAFAVFDM  121

Query  522  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            D +G I+AEEL  V +++G+  C+L +CRRMI  VD
Sbjct  122  DGNGSITAEELNTVMRSLGE-ECSLAECRRMIGGVD  156



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F+  D + DGKI   EL A+L+ +G++    E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                     S + ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  VD
Sbjct  79   AFYCPGGADSDNKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISKVD  137


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGDGC++ EEF 
Sbjct  92   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGDGCVNFEEFK  150

Query  450  VLSS  461
             + S
Sbjct  151  KMMS  154



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 80/122 (66%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q FK  D + DGKI   EL A++S +G +  S EEL  M+SEVD DGDG I+ +EF
Sbjct  50   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QASSDEELNSMISEVDSDGDGFINFKEF  108

Query  447  SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++     +   E L+DAF  +D D +G ISAEEL+ V +++GD  C++++CR+MI  
Sbjct  109  VELNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIDECRKMIGG  167

Query  624  VD  629
            VD
Sbjct  168  VD  169



>ref|XP_006346894.1| PREDICTED: probable calcium-binding protein CML18-like [Solanum 
tuberosum]
Length=145

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 81/130 (62%), Gaps = 9/130 (7%)
 Frame = +3

Query  249  ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGC  428
            +L+    E+ + F+  D + DGKI   EL+ +L  +G +    E  R+ML EVD DGDG 
Sbjct  3    KLTARMKEVEKVFRKFDTNGDGKISLLELDEVLKALGTKTTPDEAKRMML-EVDTDGDGF  61

Query  429  ISLEEFSVLSSAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  599
            I LEEF+    AF  P   S   +LRDAFD +D D +GKISA EL +V K IG+ +C+L+
Sbjct  62   IDLEEFA----AFHCPVEGSNSKDLRDAFDLYDKDKNGKISAAELHSVMKGIGE-KCSLK  116

Query  600  DCRRMILWVD  629
            DCRRMI  VD
Sbjct  117  DCRRMISSVD  126


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L  AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDG ++ EEF 
Sbjct  81   DLRDAFDLYDKDKNGKISAAELHSVMKGIG-EKCSLKDCRRMISSVDVDGDGSVNFEEFK  139

Query  450  VLSS  461
             + +
Sbjct  140  KMMT  143



>gb|EPS62655.1| hypothetical protein M569_12136 [Genlisea aurea]
Length=186

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q FK  D + DGKI  EEL  +++ +G    + EE+R+M+ EVD DGDG I L EF 
Sbjct  35   ELEQVFKKFDANGDGKISGEELGKIIASLG-HSVTDEEIRIMIQEVDSDGDGFIDLREFI  93

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++A          LR AFD FD D +G ISAEEL  V +++G+  CT+EDCR+MI  V
Sbjct  94   DLNTADVDNDEALENLRRAFDVFDIDRNGAISAEELRQVLRSLGEE-CTIEDCRKMISGV  152

Query  627  D  629
            D
Sbjct  153  D  153



>gb|ABK24059.1| unknown [Picea sitchensis]
 gb|ABK24534.1| unknown [Picea sitchensis]
Length=260

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 13/131 (10%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + FK+ D D DGKI   EL  +L  +G +  S EEL LM+   D+DGDG I L+EF 
Sbjct  112  ELREVFKVFDADGDGKITITELGCVLRSLG-DDLSEEELALMVQAADKDGDGSIDLDEFI  170

Query  450  VLSSAFAP-----------PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  596
             L++A A            P+ D +L DAF  FD D DGKISA+EL  V  ++GD+ CT+
Sbjct  171  SLNTAAADAAEFSASAGVFPATD-DLHDAFRIFDADKDGKISAQELHRVLTSLGDAECTI  229

Query  597  EDCRRMILWVD  629
            +DCR+MI  VD
Sbjct  230  DDCRQMIRGVD  240



>ref|XP_003544994.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ Q F   D++ DGKI   EL+ +LS +G++    EEL+ M+ E+D++GDG I L+EF+
Sbjct  4    EVQQIFNKFDKNGDGKISMAELKDMLSALGSKTTD-EELKRMIEELDQNGDGFIDLKEFA  62

Query  450  VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
                       DS ELRDAFD +D D +G ISA+EL +V + +G+ +C+L DCRRMI  V
Sbjct  63   DFHCNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHHVLRNLGE-KCSLSDCRRMISNV  121

Query  627  D  629
            D
Sbjct  122  D  122



>ref|XP_007033045.1| Calmodulin like 23, putative [Theobroma cacao]
 gb|EOY03971.1| Calmodulin like 23, putative [Theobroma cacao]
Length=152

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 81/130 (62%), Gaps = 8/130 (6%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   E+ + F   D++ DGKI ++EL+++LS +G+ PPS +E+  ++S +D+DG+G + L
Sbjct  6    GSMEEMKEVFNKFDKNGDGKISRDELKSILSALGS-PPSSDEVDRIMSMMDKDGNGYVDL  64

Query  438  EEFSVLSSAFAPPSCD------SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  599
            +EF          + D       EL+DAFD +D D +G ISA EL  V K +G+ +C+L 
Sbjct  65   DEFIAFHGTNINGNGDDSQCGNKELKDAFDMYDLDKNGLISANELHAVLKRLGE-KCSLS  123

Query  600  DCRRMILWVD  629
            DCRRMI  VD
Sbjct  124  DCRRMISQVD  133


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL  AF + D D +G I   EL A+L ++G E  S  + R M+S+VD+DGDG ++ EEF 
Sbjct  88   ELKDAFDMYDLDKNGLISANELHAVLKRLG-EKCSLSDCRRMISQVDKDGDGNVNFEEFK  146

Query  450  VL  455
             +
Sbjct  147  KM  148



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 78/125 (62%), Gaps = 11/125 (9%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q FK  D + DGKI   EL A++  +G +P   EELR M+ EVD DGDG I L+EF 
Sbjct  44   ELEQVFKKFDVNGDGKISSSELGAIMGSLG-QPSGEEELRKMIKEVDSDGDGFIDLKEFI  102

Query  450  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  614
             L++       DS+     L+DAF  +D D +G ISAEEL+ V +++GD  C++ +CR+M
Sbjct  103  ELNTK----GVDSDEVLENLKDAFSVYDIDKNGSISAEELYEVLRSLGD-ECSIAECRKM  157

Query  615  ILWVD  629
            I  VD
Sbjct  158  ISGVD  162



>ref|XP_004498255.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=200

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L   F+  D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I+LEEF 
Sbjct  49   DLEHVFRKFDVNGDGKISSSELGSIMGSLG-QPATEEELNNMIREVDADGDGHINLEEFI  107

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++    P      L+DAF  FD D +G I+AEEL NV  +IGD +C+L +C++MI  V
Sbjct  108  ELNTKDVNPNEIIENLKDAFSIFDIDGNGSITAEELHNVMVSIGD-KCSLAECKKMIRGV  166

Query  627  D  629
            D
Sbjct  167  D  167



>gb|KJB08532.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
 gb|KJB08533.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
Length=154

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 80/130 (62%), Gaps = 8/130 (6%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   E+ + F   D++ DGKI ++EL+++L+ +G+ P S E  R+M SE+D+DG+G + L
Sbjct  6    GSVEEMKKVFNKFDKNGDGKISRDELKSVLTALGSAPSSGEVDRIM-SEMDKDGNGYVDL  64

Query  438  EEFSVLSSAF-----APPSC-DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  599
            +EF                C + EL+DAFD +D D +G ISA EL  V K +G+ +C+L 
Sbjct  65   DEFVAFQQTNINDDDGEAQCGNKELKDAFDMYDLDKNGLISANELHAVLKRLGE-KCSLS  123

Query  600  DCRRMILWVD  629
            DCRRMI  VD
Sbjct  124  DCRRMISQVD  133


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL  AF + D D +G I   EL A+L ++G E  S  + R M+S+VD+DGDG ++ +EF 
Sbjct  88   ELKDAFDMYDLDKNGLISANELHAVLKRLG-EKCSLSDCRRMISQVDKDGDGNVNFDEFK  146

Query  450  VL  455
             +
Sbjct  147  KM  148



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +EF
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  447  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++           L+DAF  +D D +G ISAEEL+ V +++GD  C++ +C++MI  
Sbjct  98   VELNTNGVDQAEALENLKDAFSVYDIDGNGSISAEELYKVLRSLGD-ECSIAECKKMISA  156

Query  624  VD  629
            VD
Sbjct  157  VD  158



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = +3

Query  237  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  416
            +S  E+ G+     + F+  D + DGKI   EL A+L+ +G++    E  R+ML EVD D
Sbjct  13   VSSAEMDGVE----KVFRKFDANGDGKISLSELGAILNALGSKTSPDEVNRIML-EVDTD  67

Query  417  GDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  596
            GDG I L+EF+           + ELR+AFD +D D +GKI+A EL +V K++G+ +C+L
Sbjct  68   GDGFIDLKEFAAFYCPRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSL  126

Query  597  EDCRRMILWVD  629
            +DCRRMI  VD
Sbjct  127  KDCRRMISKVD  137


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  243  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD  422
            P    G   EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGD
Sbjct  83   PRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGD  141

Query  423  GCISLEEFSVLSS  461
            GC++ EEF  + S
Sbjct  142  GCVNFEEFKKMMS  154



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 78/122 (64%), Gaps = 4/122 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F+  D + DGKI   EL A+L+ +G+     E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVAKVFRKFDTNGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  450  VLSSAFAPPSCD--SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
                     + D   ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  
Sbjct  79   AFHCPGGETNGDDSKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISS  137

Query  624  VD  629
            VD
Sbjct  138  VD  139


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC++ EEF 
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  450  VLSS  461
             + S
Sbjct  153  KMMS  156



>ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN51467.1| Polcalcin Jun o [Cucumis sativus]
Length=182

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+EF
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLDEF  94

Query  447  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++           L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+MI  
Sbjct  95   IELNTKGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRKMITG  153

Query  624  VD  629
            VD
Sbjct  154  VD  155



>ref|XP_003519336.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             E+ Q F   D++ DGKI   EL+ +L+ +G++    EEL+ M+ E+D++GDG I L+EF
Sbjct  3    VEVRQIFNKFDKNGDGKISVTELKDMLAALGSKTTD-EELKRMMEELDQNGDGFIDLKEF  61

Query  447  SVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
            +           DS ELRDAFD +D D +G ISA+EL +V + +G+ +C+L DCRRMI  
Sbjct  62   ADFHCNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHDVLRNLGE-KCSLSDCRRMISN  120

Query  624  VD  629
            VD
Sbjct  121  VD  122



>gb|KHN40730.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=143

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L   FK  D + DGKI   EL +++  +G +P + EEL+ ++ EVD DGDG I+LEEF+
Sbjct  3    DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLEEFT  61

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++    P      L+DAF  FD D +G I+AEEL  V  ++GD+ C++E+CR+MI  V
Sbjct  62   ELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLGDA-CSIEECRKMIAGV  120

Query  627  D  629
            D
Sbjct  121  D  121


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = +3

Query  234  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  413
            ++ PDE+      L  AF + D D +G I  EEL+ +++ +G +  S EE R M++ VD 
Sbjct  67   DVDPDEV---LENLKDAFSIFDLDGNGSITAEELKMVMASLG-DACSIEECRKMIAGVDG  122

Query  414  DGDGCISLEEFSVLSSA  464
            +GDG I+ +EF ++ + 
Sbjct  123  NGDGMINFDEFQIMMTG  139



>ref|XP_006583713.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=182

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L   FK  D + DGKI   EL +++  +G +P + EEL+ ++ EVD DGDG I+LEEF+
Sbjct  42   DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLEEFT  100

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++    P      L+DAF  FD D +G I+AEEL  V  ++GD+ C++E+CR+MI  V
Sbjct  101  ELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLGDA-CSIEECRKMIAGV  159

Query  627  D  629
            D
Sbjct  160  D  160


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = +3

Query  234  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  413
            ++ PDE+      L  AF + D D +G I  EEL+ +++ +G +  S EE R M++ VD 
Sbjct  106  DVDPDEV---LENLKDAFSIFDLDGNGSITAEELKMVMASLG-DACSIEECRKMIAGVDG  161

Query  414  DGDGCISLEEFSVLSSA  464
            +GDG I+ +EF ++ + 
Sbjct  162  NGDGMINFDEFQIMMTG  178



>ref|XP_008467096.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=182

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F   D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I L+EF
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELHNMIKEVDADGDGYIDLDEF  94

Query  447  SVLSSAFAPPS-CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++     +     L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+MI  
Sbjct  95   IELNTKGVDSNEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRKMITG  153

Query  624  VD  629
            VD
Sbjct  154  VD  155



>ref|XP_011099473.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=152

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 77/123 (63%), Gaps = 3/123 (2%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            L  E+ + F   D + DG+I   EL A+L+ +G+  P  E  R+M SE+D DGDG I L 
Sbjct  12   LEEEVEKVFSKFDTNGDGRISLTELGAILNGLGSATPGDEVARIM-SELDTDGDGFIDLN  70

Query  441  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
            EF          S + EL++AFD +D D +GKISA EL +V +++G+ +C+L+DCRRMI 
Sbjct  71   EFKAFHCGGGEDS-NKELKEAFDLYDKDKNGKISASELHSVLRSLGE-KCSLKDCRRMIS  128

Query  621  WVD  629
             VD
Sbjct  129  SVD  131


 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL +AF L D+D +GKI   EL ++L  +G E  S ++ R M+S VD DGDGC++ EEF
Sbjct  86   ELKEAFDLYDKDKNGKISASELHSVLRSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEF  143



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+EF
Sbjct  18   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLDEF  76

Query  447  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++           L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+MI  
Sbjct  77   IELNTKGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRKMITG  135

Query  624  VD  629
            VD
Sbjct  136  VD  137



>gb|AFK34900.1| unknown [Lotus japonicus]
Length=196

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + F+  D + DGKI   EL +++  +G +  ++EEL  M+ EVD DGDG ISLEEF 
Sbjct  51   ELEKVFEKFDVNRDGKISSSELGSIMGSLG-QSATKEELDNMIREVDSDGDGYISLEEFI  109

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++    P      LRDAF  FD D +G I+AEEL NV  ++GD  C+LE+C++MI  V
Sbjct  110  ELNTKDIDPNEILENLRDAFSVFDIDGNGSITAEELHNVMASLGD-ECSLEECQKMIGGV  168

Query  627  D  629
            D
Sbjct  169  D  169



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            S D  +G   EL + F   D++ DG+I  +EL  +   +G+E  S EE++ +++E D+DG
Sbjct  11   SGDGAAGSMEELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDG  70

Query  420  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  599
            DG I +EEF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L+
Sbjct  71   DGHIDIEEFAEIINGGSTK----ELRDAFDLYDLDKNGLISTSELHEVLKRLG-QKCSLK  125

Query  600  DCRRMILWVD  629
            DC +MI  VD
Sbjct  126  DCAKMISSVD  135



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +EF
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  447  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++           L+DAF  +D D +G ISAEEL+ V +++GD  C++ +C++MI  
Sbjct  98   VELNTNGVDQAEALENLKDAFSVYDIDGNGLISAEELYKVLRSLGD-ECSIAECKKMISA  156

Query  624  VD  629
            VD
Sbjct  157  VD  158



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F+  D + DGKI   EL A+L+ +G+     E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVAKVFRKFDANGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  450  VLSSAFAPPSCD--SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
                       D   ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  
Sbjct  79   AFHCPGGGTDGDDSKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISS  137

Query  624  VD  629
            VD
Sbjct  138  VD  139


 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC++ EEF 
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  450  VLSS  461
             + S
Sbjct  153  KMMS  156



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + F+L D + DGKI   EL+  ++++G  P +  EL +M+ E D DGDG ISL EF 
Sbjct  30   ELERVFRLYDTNGDGKISAAELQETMAKLGHHPANDHELEMMMKEADADGDGFISLAEFK  89

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             ++ A      + +L++AF  FD D DGKISA+EL NV K +G+ + T E C+ MI  VD
Sbjct  90   DINGA-GEGVEEVDLKEAFAVFDEDRDGKISAKELQNVLKGLGE-QVTTEQCQEMIRGVD  147


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L +AF + D D DGKI  +EL+ +L  +G E  + E+ + M+  VDRDGDG +S +EF 
Sbjct  102  DLKEAFAVFDEDRDGKISAKELQNVLKGLG-EQVTTEQCQEMIRGVDRDGDGMVSFQEFK  160

Query  450  VLSSAFAPPSCDS  488
            V+ +     S  S
Sbjct  161  VMMTGGGAFSVSS  173



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 81/151 (54%), Gaps = 8/151 (5%)
 Frame = +3

Query  180  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  359
            +K    S   +  P++N     +E      EL Q FK  D + DGKI   EL A+   +G
Sbjct  4    RKAKASSGAMNSTPSMNSRAQIEE------ELEQVFKKFDVNGDGKISGSELGAIFRSLG  57

Query  360  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  536
             E  + EEL+ M+ EVD DGDG I L+EF  L++           L+DAF  FD D DG 
Sbjct  58   GEAMAEEELKSMIREVDSDGDGFIDLKEFVELNTKDIDYDETVENLKDAFQVFDIDGDGS  117

Query  537  ISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            IS EEL  V +++G+  CTL +C +MI  VD
Sbjct  118  ISCEELRQVLESLGE-ECTLGECAKMIAGVD  147



>ref|XP_007141898.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
 gb|ESW13892.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
Length=140

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ Q F   D++ DGKI   EL  +L  +G+   ++EEL+ ++ E+D++GDG I L+EF+
Sbjct  4    EVRQIFNKFDKNGDGKISITELRDMLGTLGS-KTTKEELKRIMEELDQNGDGYIDLKEFA  62

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                  A      ELRDAFD +D D +G ISA+EL +V   +G+ +C+L DCRRMI  VD
Sbjct  63   DFHCNDAGNDESKELRDAFDLYDVDKNGLISAKELHDVLSKLGE-KCSLSDCRRMISNVD  121



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + F+L D + DGKI   EL  +++++G  P    EL +M+ E D DGDG I+L EF 
Sbjct  38   ELERVFRLYDTNGDGKISAAELRDMMAKLGRPPADDHELEMMMKEADADGDGFINLAEFK  97

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             ++ A      +++LR+AF  FD DHDGKISA EL  V K +G+   T + CR+MI  VD
Sbjct  98   DINRA-GEGVQEADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTTAQ-CRKMIRGVD  155


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            A+L +AF + D D DGKI   EL  +L  +G E  +  + R M+  VDRDGDG +S +EF
Sbjct  109  ADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTT-AQCRKMIRGVDRDGDGMVSFQEF  167

Query  447  SVLSSAFAPP  476
             V+ +    P
Sbjct  168  KVMMTGGGRP  177



>ref|XP_003637661.1| Calcium-binding pollen allergen [Medicago truncatula]
 gb|KEH40591.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=198

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L   F+  D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I+LEEF 
Sbjct  46   DLEHVFRKFDVNGDGKISSSELGSIMGSLG-QPATEEELDNMIREVDADGDGHINLEEFI  104

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++    P      L+DAF  FD D +G ISAEEL NV  ++GD +C+L +C++MI  V
Sbjct  105  ELNTKDIDPNEILENLKDAFSVFDIDKNGSISAEELHNVMVSLGD-QCSLAECQKMIGGV  163

Query  627  D  629
            D
Sbjct  164  D  164



>ref|XP_010693960.1| PREDICTED: probable calcium-binding protein CML18 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +E+ + F   D + DGKI   EL++LL  +G+E  S EE++ M+ E+D+DGDG + L EF
Sbjct  5    SEIERIFSKFDANGDGKISATELKSLLQALGSET-STEEVKKMMEEMDKDGDGFVDLLEF  63

Query  447  SVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
            S   +     +  + EL +AF  +D D +GKISA EL++V K++G+ +C+L+DC++MI  
Sbjct  64   SEFHAGSGGNAGSTKELEEAFRLYDKDGNGKISARELYDVLKSLGE-KCSLKDCKKMISS  122

Query  624  VD  629
            VD
Sbjct  123  VD  124


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +3

Query  255  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  434
            +G   EL +AF+L D+D +GKI   EL  +L  +G E  S ++ + M+S VD DGDG + 
Sbjct  74   AGSTKELEEAFRLYDKDGNGKISARELYDVLKSLG-EKCSLKDCKKMISSVDADGDGHVD  132

Query  435  LEEFSVLSSA  464
             EEF  + +A
Sbjct  133  FEEFKKMMAA  142



>ref|XP_006654163.1| PREDICTED: probable calcium-binding protein CML18-like [Oryza 
brachyantha]
Length=154

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  4    AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDLTEF  62

Query  447  SVL--------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  602
            +          S+     + ++ELR+AF  +D D +GKISA EL  V + +GD +C++ D
Sbjct  63   TAFHCSGGSGDSAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-KCSVAD  121

Query  603  CRRMILWVD  629
            C RMI  VD
Sbjct  122  CSRMIRSVD  130


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  75   AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  133

Query  420  DGCISLEEFSVLSSAFAP  473
            DGC++ +EF  +    A 
Sbjct  134  DGCVNFDEFKKMMGGGAA  151



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 5/135 (4%)
 Frame = +3

Query  225  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  404
            L+ + S D  +G   EL + F   D++ DG+I  EEL  +   +G+E  S EE++ +++E
Sbjct  6    LDSKGSGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAE  65

Query  405  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  584
             D+DGDG I + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  
Sbjct  66   FDKDGDGHIDIVEFAEIINGGSTK----ELRDAFDLYDLDKNGLISTSELHEVLKRLG-Q  120

Query  585  RCTLEDCRRMILWVD  629
            +C+L+DC +MI  VD
Sbjct  121  KCSLKDCAKMISSVD  135



>ref|XP_002274476.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
 emb|CAN68471.1| hypothetical protein VITISV_028194 [Vitis vinifera]
Length=150

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   E+ + F   D++ DGKI  EE   +L  +G+   S +EL  ++SE+D DGDG I L
Sbjct  10   GTMEEVERVFNRFDKNGDGKISAEEFGEVLQALGS-TTSPDELTRIMSEIDTDGDGFIDL  68

Query  438  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            +EF+    A       +ELRDAFD +D D +G ISA EL  VFK++G+ + TL+DC RMI
Sbjct  69   KEFADFHRATDSNGGLTELRDAFDMYDRDKNGLISASELHAVFKSLGE-KVTLKDCSRMI  127

Query  618  LWVD  629
              VD
Sbjct  128  SSVD  131


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 47/107 (44%), Gaps = 30/107 (28%)
 Frame = +3

Query  213  VLPALNDEISPDELS-----------------------------GLYAELVQAFKLIDRD  305
            VL AL    SPDEL+                             G   EL  AF + DRD
Sbjct  38   VLQALGSTTSPDELTRIMSEIDTDGDGFIDLKEFADFHRATDSNGGLTELRDAFDMYDRD  97

Query  306  DDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             +G I   EL A+   +G E  + ++   M+S VD DGDGC++ EEF
Sbjct  98   KNGLISASELHAVFKSLG-EKVTLKDCSRMISSVDADGDGCVNFEEF  143



>ref|XP_001765534.1| predicted protein [Physcomitrella patens]
 gb|EDQ69584.1| predicted protein [Physcomitrella patens]
Length=165

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 80/141 (57%), Gaps = 9/141 (6%)
 Frame = +3

Query  219  PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  398
               N  +SPD    L  EL  +FK  DR+ DGKI KEEL  ++  +G +    E  RL +
Sbjct  6    AGFNLNLSPD----LVQELTDSFKFFDRNGDGKISKEELGTVVRSLGQKVNDAELARL-I  60

Query  399  SEVDRDGDGCISLEEFSVLSS-AFAPPSCDS---ELRDAFDFFDTDHDGKISAEELFNVF  566
            S+VD +GDG I L+EF  L++ A A    DS    +  AF+ FD D +G ISAEEL  V 
Sbjct  61   SDVDSNGDGYIDLQEFIDLNARAIAECPMDSMHAAMVSAFNVFDVDRNGYISAEELHRVL  120

Query  567  KTIGDSRCTLEDCRRMILWVD  629
               GD + +LEDCR MI  VD
Sbjct  121  VGFGDEKVSLEDCRSMIECVD  141


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = +3

Query  252  LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  431
            +  ++A +V AF + D D +G I  EEL  +L   G E  S E+ R M+  VD DGD  +
Sbjct  89   MDSMHAAMVSAFNVFDVDRNGYISAEELHRVLVGFGDEKVSLEDCRSMIECVDEDGDQMV  148

Query  432  SLEEFSVL  455
            +  EF  L
Sbjct  149  NFREFEAL  156



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D + DGKI  +EL  ++  +G+E  S +E+  M+ E+D D DG ISLEEF+
Sbjct  20   EVKRVFDRFDANGDGKISSDELGGVIEALGSET-SADEVARMMEEIDTDKDGFISLEEFA  78

Query  450  VLSSAFAPPS----CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            V  SA + PS     + ELR+AFD +D DHDG+IS  EL  +   +G+ RC++ DC  MI
Sbjct  79   VFCSADSDPSGGGNSEKELREAFDLYDQDHDGQISKTELHLILTRLGE-RCSVNDCSEMI  137

Query  618  LWVD  629
              VD
Sbjct  138  RSVD  141


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL +AF L D+D DG+I K EL  +L+++G E  S  +   M+  VD DGDG +S +EF
Sbjct  96   ELREAFDLYDQDHDGQISKTELHLILTRLG-ERCSVNDCSEMIRSVDSDGDGFVSFDEF  153



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 79/129 (61%), Gaps = 12/129 (9%)
 Frame = +3

Query  255  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  428
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  1    SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  60

Query  429  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC--TLED  602
            + L+EF V     A  S D +L DAF  FD + DG ISA+EL  V + +   RC  ++ED
Sbjct  61   VDLDEFLV-----AVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV---RCEASIED  112

Query  603  CRRMILWVD  629
            CRRMI  VD
Sbjct  113  CRRMIRGVD  121



>gb|EAY97018.1| hypothetical protein OsI_18939 [Oryza sativa Indica Group]
Length=189

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 15/134 (11%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  35   AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDLSEF  93

Query  447  SVLSSAFAPP-------------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
            +       P              + ++ELR+AF  +D D +GKISA EL  V + +GD +
Sbjct  94   AAFHCGPTPAHGGKGGDAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-K  152

Query  588  CTLEDCRRMILWVD  629
            C++ DC RMI  VD
Sbjct  153  CSVADCSRMIRSVD  166


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  111  AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  169

Query  420  DGCISLEEF  446
            DGC++ +EF
Sbjct  170  DGCVNFDEF  178



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AE  +AF LID+D DG I  EEL AL  Q   E P+ EE++ M++E D DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEEL-ALAIQSLNEHPTSEEIQEMVNEADSDGDGTVDFEEF  69

Query  447  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             ++ S+    +   E++DAF  FD D DG ISA EL NV   +G+ R T E+  +MI  V
Sbjct  70   LIVMSSKMKENVVEEIKDAFKVFDRDQDGFISAIELRNVMINMGE-RLTEEEAEQMINEV  128

Query  627  D  629
            D
Sbjct  129  D  129



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AE+ + F   D ++DGKI   EL  +L  +G+E  S +E+  M+ E+D D DG I+L+EF
Sbjct  19   AEVQKVFDRFDTNNDGKISPGELGGVLKALGSES-SPDEVARMMGEIDTDKDGNINLQEF  77

Query  447  SVLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
            +   SA A P  S + ELR+AF+ +D +HDGKISA EL      +G+  C++EDC  MI 
Sbjct  78   AAFCSAEADPYHSAEKELREAFELYDQNHDGKISAAELQKTLLRLGE-HCSIEDCAGMIK  136

Query  621  WVD  629
             +D
Sbjct  137  PID  139



>ref|XP_010526084.1| PREDICTED: calmodulin-like protein 4 [Tarenaya hassleriana]
Length=208

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             EL + F++ D++ DG+I KEEL   L  +G   P RE L  M+ ++D +GDGC+ ++EF
Sbjct  66   VELKRVFQMFDKNGDGRITKEELNDSLENLGLFLPDRE-LAQMIQKIDANGDGCVDMDEF  124

Query  447  SVLSSAFAPPS-CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMIL  620
              L  +    S  D ++RDAFD FD D DG I+ EEL +V  ++G  +  TLEDC++MI+
Sbjct  125  ESLYKSIVDQSDKDDDMRDAFDVFDQDGDGFITVEELKSVMGSLGLKQGKTLEDCKKMIM  184

Query  621  WVD  629
             VD
Sbjct  185  QVD  187



>ref|XP_003630938.1| Calcium-binding pollen allergen [Medicago truncatula]
Length=188

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 76/124 (61%), Gaps = 3/124 (2%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  31   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  89

Query  441  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            EF  L++           L+DAF  FD D +G I+AEEL  V +++G+  C+L +CR+MI
Sbjct  90   EFIELNTKGVDSDEILENLKDAFAVFDMDGNGSITAEELNTVMRSLGE-ECSLAECRKMI  148

Query  618  LWVD  629
              VD
Sbjct  149  GGVD  152



>ref|XP_007160425.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
 gb|ESW32419.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
Length=188

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 76/124 (61%), Gaps = 3/124 (2%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            +  EL Q FK  D + DGKI   EL +++  +G E  + +E+  M+ EVD DGDGCISL+
Sbjct  32   MAGELEQVFKKFDVNGDGKISASELGSIMRSLGQEA-TEQEVDNMIREVDGDGDGCISLQ  90

Query  441  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            EF  L++           L+DAF  FD D +G I+AEEL  V +++G+  C+L +CRRMI
Sbjct  91   EFIELNTKGVDSDEVLENLKDAFSVFDMDGNGLITAEELNTVMRSLGEE-CSLAECRRMI  149

Query  618  LWVD  629
              VD
Sbjct  150  GGVD  153


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  273  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  452
            L  AF + D D +G I  EEL  ++  +G E  S  E R M+  VDRDGDG I  EEF V
Sbjct  109  LKDAFSVFDMDGNGLITAEELNTVMRSLG-EECSLAECRRMIGGVDRDGDGTIDFEEFRV  167

Query  453  L  455
            +
Sbjct  168  M  168



>gb|KJB50384.1| hypothetical protein B456_008G168100 [Gossypium raimondii]
Length=195

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 77/125 (62%), Gaps = 11/125 (9%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK+ D + DGKI   EL +++  +G +P S EE++ M+ E D DGDG I+ EEF 
Sbjct  50   ELEHIFKMFDANGDGKISSSELASIMGSLGQQP-SDEEVQKMIKEFDADGDGFINFEEFV  108

Query  450  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  614
             L++       DS+     L+DAF  +D D +G ISAEEL  V K++GD  C++ +CR+M
Sbjct  109  ELNTK----GVDSKEVLENLKDAFSVYDLDGNGSISAEELHKVLKSLGDD-CSITECRKM  163

Query  615  ILWVD  629
            I  VD
Sbjct  164  ISGVD  168



>gb|AET05414.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=190

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 76/124 (61%), Gaps = 3/124 (2%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  33   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  91

Query  441  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            EF  L++           L+DAF  FD D +G I+AEEL  V +++G+  C+L +CR+MI
Sbjct  92   EFIELNTKGVDSDEILENLKDAFAVFDMDGNGSITAEELNTVMRSLGE-ECSLAECRKMI  150

Query  618  LWVD  629
              VD
Sbjct  151  GGVD  154



>ref|XP_006355093.1| PREDICTED: probable calcium-binding protein CML25-like [Solanum 
tuberosum]
Length=194

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 78/131 (60%), Gaps = 3/131 (2%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            S D  + +  EL Q FK  D + DGKI   EL ++++ +G  P + EEL  M+ EVD DG
Sbjct  36   SIDSRARIEEELEQVFKKFDMNGDGKICSSELGSIMASLG-NPTTEEELVNMIREVDSDG  94

Query  420  DGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  596
            DG I L+EF  L++           L+DAF  FD D +G ISAEEL  V +++G+  CTL
Sbjct  95   DGFIDLQEFIELNTKDIDSNEVLESLKDAFSVFDMDKNGSISAEELLTVLRSLGED-CTL  153

Query  597  EDCRRMILWVD  629
             +CR+MI  VD
Sbjct  154  AECRKMISGVD  164



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 79/129 (61%), Gaps = 12/129 (9%)
 Frame = +3

Query  255  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  428
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  61   SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  120

Query  429  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC--TLED  602
            + L+EF V     A  S D +L DAF  FD + DG ISA+EL  V + +   RC  ++ED
Sbjct  121  VDLDEFLV-----AVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV---RCEASIED  172

Query  603  CRRMILWVD  629
            CRRMI  VD
Sbjct  173  CRRMIRGVD  181



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 81/137 (59%), Gaps = 8/137 (6%)
 Frame = +3

Query  228  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  398
            ND IS       SG   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGASGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  399  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  578
            +E D+DGDG I + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G
Sbjct  64   AEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYDLDKNGLISKSELHEVLKRLG  119

Query  579  DSRCTLEDCRRMILWVD  629
              +C+L++C +MI  VD
Sbjct  120  -QKCSLKECAKMIGSVD  135



>ref|XP_004145834.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 ref|XP_004160107.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 gb|KGN57816.1| hypothetical protein Csa_3G319280 [Cucumis sativus]
Length=156

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   E+++ F   D++ DGKI   EL A L ++     + E  R+M SE+D+DGDG I L
Sbjct  18   GSMDEIIRVFNKFDKNGDGKISVTELAAALGELSGNISTDEIHRIM-SEIDKDGDGFIDL  76

Query  438  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            +EF+  +S+      + +L+DAFD +D D +G ISA+EL +V K +G+ +C+L+DC RMI
Sbjct  77   DEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKELHSVLKRLGE-KCSLKDCCRMI  133

Query  618  LWVD  629
              VD
Sbjct  134  SSVD  137



>ref|NP_173866.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
 sp|Q9FYK2.1|CML25_ARATH RecName: Full=Probable calcium-binding protein CML25; AltName: 
Full=Calmodulin-like protein 25 [Arabidopsis thaliana]
 gb|AAF97973.1|AC000103_23 F21J9.28 [Arabidopsis thaliana]
 gb|ABE65653.1| polcalcin [Arabidopsis thaliana]
 gb|AEE30554.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
Length=186

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  95

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  627  D  629
            D
Sbjct  155  D  155



>ref|XP_010262278.1| PREDICTED: probable calcium-binding protein CML23 [Nelumbo nucifera]
Length=164

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 78/125 (62%), Gaps = 7/125 (6%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + FK  D + DGKI   EL  +L  +G++  S EE+  M+SE+D DGDG I L+EF+
Sbjct  18   EVEKVFKRFDANGDGKISSTELRDVLGALGSDT-SPEEIHRMMSEIDTDGDGFIDLKEFA  76

Query  450  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  614
                +    +  +E     L+DAF+ +D D +G ISA+EL+ V K +G+ +C+L+DC RM
Sbjct  77   EFHKSNGTGNTKAEDELKELKDAFNLYDKDKNGLISAKELYTVLKRLGE-KCSLQDCSRM  135

Query  615  ILWVD  629
            I  VD
Sbjct  136  INSVD  140


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL  AF L D+D +G I  +EL  +L ++G E  S ++   M++ VD DGDG ++ EEF 
Sbjct  95   ELKDAFNLYDKDKNGLISAKELYTVLKRLG-EKCSLQDCSRMINSVDVDGDGHVNFEEFK  153

Query  450  VLSSAFAPPS  479
            ++ +    PS
Sbjct  154  LMMTNGKAPS  163



>ref|XP_008457051.1| PREDICTED: probable calcium-binding protein CML27 [Cucumis melo]
Length=157

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   E+++ F   D++ DGKI   EL A L ++     + E  R+M SE+D+DGDG I L
Sbjct  19   GSMDEVIRVFNKFDKNGDGKISVSELGAALGELSGNISTGEIHRIM-SEIDKDGDGFIDL  77

Query  438  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            +EF+  +S+      + +L+DAFD +D D +G ISA+EL +V K +G+ +C+L+DC RMI
Sbjct  78   DEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKELHSVLKRLGE-KCSLKDCCRMI  134

Query  618  LWVD  629
              VD
Sbjct  135  SSVD  138



>emb|CDY40786.1| BnaAnng06490D [Brassica napus]
 emb|CDY03874.1| BnaC07g10990D [Brassica napus]
Length=184

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  446
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL+  ++E+D+ GDG I+LEEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFV  92

Query  447  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             + +           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  93   ELFTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGV  151

Query  627  D  629
            D
Sbjct  152  D  152


 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  273  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  452
            L  AF + D D +G I  EEL  +L  +G E  S  E R M+S VD+DGDG I  EEF V
Sbjct  108  LKDAFSVYDIDGNGSISAEELHEVLRSLGDEC-SIAECRKMISGVDKDGDGTIDFEEFKV  166

Query  453  L  455
            +
Sbjct  167  M  167



>ref|XP_006415824.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
 gb|ESQ34177.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
Length=198

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL+  ++E+DR GDG I+ EEF 
Sbjct  50   ELEAVFKKFDVNGDGKISSKELGAIMANLGHEVPE-EELQKAITEIDRKGDGYINFEEFV  108

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  109  ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDD-CSIAECRKMIGGV  167

Query  627  D  629
            D
Sbjct  168  D  168



>ref|XP_009770094.1| PREDICTED: calmodulin-like [Nicotiana sylvestris]
Length=147

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 83/131 (63%), Gaps = 6/131 (5%)
 Frame = +3

Query  225  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  404
            + D +S D++S    EL +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEDQIS----ELREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  405  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  584
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  585  RCTLEDCRRMI  617
            R T E+ ++MI
Sbjct  115  RLTDEEAQQMI  125


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE + M+ E D DGDG +S EEF
Sbjct  84   ELKEAFKVFDRDQDGFISANELRNVMMNLG-ERLTDEEAQQMIREADLDGDGLVSYEEF  141



>ref|XP_003616365.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99323.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=139

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D++ DGKI + EL+ +L  +G+E  S EE++ M+ E+D++GDG I L+EF+
Sbjct  4    EVRKIFSKFDKNGDGKISRSELKEMLLTLGSETTS-EEVKRMMEELDQNGDGFIDLKEFA  62

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                        SELRDAFD +D D +G ISA EL  V   +G+ +C+L DC++MI  VD
Sbjct  63   DFHCTEPGKDESSELRDAFDLYDLDKNGLISANELHAVLMKLGE-KCSLNDCKKMISNVD  121



>ref|XP_009371792.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 81/137 (59%), Gaps = 8/137 (6%)
 Frame = +3

Query  228  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  398
            ND IS       +G   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGAAGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  399  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  578
            +E D+DGDG I + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G
Sbjct  64   AEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYDLDKNGLISKSELHEVLKRLG  119

Query  579  DSRCTLEDCRRMILWVD  629
              +C+L++C +MI  VD
Sbjct  120  -QKCSLKECAKMIGSVD  135



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q F+  D + DGKI   EL +++S +G  P + EEL  M+ EVD DGDG I  +EF 
Sbjct  43   ELEQVFRKFDANGDGKISASELGSIMSSLG-HPETEEELAKMVREVDSDGDGFIDFDEFV  101

Query  450  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++    P+   E LRDAF  +D D DG I+AEEL  V +++G+   +L +CR+MI  V
Sbjct  102  ELNTKGVDPAEAMENLRDAFSVYDIDGDGSITAEELHKVMRSLGEEN-SLAECRKMIGGV  160

Query  627  D  629
            D
Sbjct  161  D  161



>ref|XP_010271345.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=190

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 10/134 (7%)
 Frame = +3

Query  243  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD  422
            P     L  EL   FK  D + DGKI   EL +++  +G  P + EEL+ M+  VD DG+
Sbjct  35   PGNSRTLVEELGAVFKKFDMNGDGKISWSELGSIMENLG-NPVTEEELQKMVKVVDLDGN  93

Query  423  GCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
            G I L EF  L++       DSE     LR AF  FDTD +G IS EEL  VF+++GD +
Sbjct  94   GFIDLNEFIDLNTN----GVDSEKAVEDLRHAFMIFDTDGNGSISPEELQAVFRSLGDDK  149

Query  588  CTLEDCRRMILWVD  629
            C++ DC++MI  VD
Sbjct  150  CSIADCKKMIRGVD  163



>ref|XP_002890700.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66959.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  95

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  627  D  629
            D
Sbjct  155  D  155



>ref|XP_011021780.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=197

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 86/144 (60%), Gaps = 4/144 (3%)
 Frame = +3

Query  204  PTSVLPALNDEISPD-ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            P++++ + N   SP   L     EL Q FK  D + DGKI   EL ++++ +G E  + +
Sbjct  23   PSAIVTSTNGSKSPSIRLRPQVQELEQVFKKFDVNGDGKISSAELGSIMASLGHEA-TED  81

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELF  557
            EL+ M++E D DGDG I L+EF  L++     +   E L+DAF  +D D +G ISAEEL 
Sbjct  82   ELKTMITEFDADGDGFIDLQEFVALNTQGVDTNEVMENLKDAFSVYDVDGNGSISAEELH  141

Query  558  NVFKTIGDSRCTLEDCRRMILWVD  629
             V  ++G+  C++ +CR++I  VD
Sbjct  142  KVMASLGEP-CSMAECRKIISGVD  164



>ref|XP_006351748.1| PREDICTED: calmodulin-5/6/7/8-like [Solanum tuberosum]
Length=147

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = +3

Query  225  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  404
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRMEELASVIQSL-HEHPTREEIQEMINE  55

Query  405  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  584
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGSIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  585  RCTLEDCRRMI  617
            R T E+ ++MI
Sbjct  115  RLTEEEAQQMI  125


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
             +  EL +AFK+ DRD DG I   EL  ++  +G E  + EE + M+ E D DGDG +S 
Sbjct  80   NVTEELKEAFKVFDRDQDGFISANELRNVMMNLG-ERLTEEEAQQMIREADLDGDGLVSY  138

Query  438  EEF  446
            +EF
Sbjct  139  DEF  141



>ref|XP_009392676.1| PREDICTED: probable calcium-binding protein CML10 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             +L + F   D + DGKI   EL A+L  +  +PPS EEL  M+ E D DGDG IS  EF
Sbjct  36   GDLERVFNKFDANGDGKISSAELAAVLEILSGQPPSEEELGRMMREADVDGDGFISFAEF  95

Query  447  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
              L++  AP + + +LR AF  FD D  G ISA+EL ++   IG+   +L  CRRMI  V
Sbjct  96   VDLNT--APAALEEDLRLAFAVFDLDRSGSISADELAHILGGIGEG-ASLAQCRRMIDGV  152

Query  627  D  629
            D
Sbjct  153  D  153


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +3

Query  255  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  434
            + L  +L  AF + D D  G I  +EL  +L  +G E  S  + R M+  VDRDGDG +S
Sbjct  103  AALEEDLRLAFAVFDLDRSGSISADELAHILGGIG-EGASLAQCRRMIDGVDRDGDGLVS  161

Query  435  LEEFSVLSSA  464
             EEF  + +A
Sbjct  162  FEEFKAMMTA  171



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = +3

Query  225  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  404
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRIEELASVIQSL-HENPTREEMQEMMNE  55

Query  405  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  584
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGTIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  585  RCTLEDCRRMI  617
            R T E+ ++MI
Sbjct  115  RLTEEEAQQMI  125


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
             +  EL +AFK+ DRD DG I   EL  ++  +G E  + EE + M+ E D DGDG +S 
Sbjct  80   NVTEELKEAFKVFDRDQDGFISANELRNVMMNLG-ERLTEEEAQQMIREADLDGDGLVSY  138

Query  438  EEF  446
            EEF
Sbjct  139  EEF  141



>gb|AAZ20284.1| calcium-binding pollen allergen [Arachis hypogaea]
Length=164

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 75/124 (60%), Gaps = 3/124 (2%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            + AEL Q F   D + DGKI   EL A++  +G +  + +EL  ML EVD DGDG ISL+
Sbjct  9    MAAELEQVFHKFDVNGDGKIDASELGAVMGSLG-QKATEQELINMLREVDGDGDGYISLQ  67

Query  441  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            EF  L++           L++AF  FD D +G I+AEEL  V +++G+  CTL +CRRMI
Sbjct  68   EFIELNTKGVDSDEVLENLKEAFSVFDIDGNGSITAEELNTVMRSLGE-ECTLAECRRMI  126

Query  618  LWVD  629
              VD
Sbjct  127  SGVD  130



>ref|XP_008464718.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=185

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL + FK  D + DGKI   EL ++++ +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   AELEEVFKKFDVNGDGKISSAELGSIMTSLG-HNATEEELGKMIEEFDADGDGFINLHEF  99

Query  447  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI  
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLRSLGDD-CSVADCRQMISG  158

Query  624  VD  629
            VD
Sbjct  159  VD  160


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +3

Query  234  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  413
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLRSLG-DDCSVADCRQMISGVDS  161

Query  414  DGDGCISLEEFSVLSSA  464
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>gb|EYU40733.1| hypothetical protein MIMGU_mgv1a014669mg [Erythranthe guttata]
Length=182

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q FK  D + DGKI   EL +++  +G  P + EEL+ M+ EVD DGDG I L+EF 
Sbjct  46   ELEQVFKKFDVNGDGKISAAELGSIMGSLG-HPATEEELQTMIREVDADGDGFIDLKEFV  104

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
             L++           L+DAF+ FD D +G ISAEEL +V +++G+  CTL +CR+MI
Sbjct  105  ELNTKDIDYDEVLENLKDAFEVFDIDKNGAISAEELQDVLQSLGE-ECTLAECRKMI  160



>ref|XP_001751654.1| predicted protein [Physcomitrella patens]
 gb|EDQ83971.1| predicted protein [Physcomitrella patens]
Length=163

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 80/142 (56%), Gaps = 12/142 (8%)
 Frame = +3

Query  237  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  416
            +S D  +    +L   FK++DR+ DGKI K EL A+L  +G E  +  EL  M+ EVD D
Sbjct  1    MSQDLTASAVKDLEDVFKMLDRNGDGKISKTELGAVLGSLG-EILTDPELEQMIREVDVD  59

Query  417  GDGCISLEEFSVLSS-----------AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNV  563
            GDG I L+EF  L++             A    +  L+ AF+ FD+D+DG ISA EL  V
Sbjct  60   GDGGIDLQEFIKLNAECVDAKRLTAEGEADSHIEEALQSAFNVFDSDNDGFISAGELHRV  119

Query  564  FKTIGDSRCTLEDCRRMILWVD  629
              ++GD   +L+DCR MI  VD
Sbjct  120  LSSLGDDNISLDDCRYMISCVD  141



>ref|XP_010271280.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=205

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI   EL +++  +G  P + EEL+ M+ EVD DGDG I L EF 
Sbjct  44   ELEHVFKRFDVNGDGKISWSELGSIMGSLG-HPATEEELQKMVEEVDSDGDGFIDLNEFI  102

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++          +L++AF  FD D +G IS EEL  V K++GD RC++ +C++MI  V
Sbjct  103  ELNTKGVDSLKVIEDLKNAFMVFDIDRNGSISPEELQTVLKSLGDDRCSIAECKKMIRGV  162

Query  627  D  629
            D
Sbjct  163  D  163



>ref|XP_009413607.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + F   D D DG+I   EL A+L  +G++P S +E+R M++E+D D DG + L+EF+
Sbjct  26   ELEKVFARFDADGDGRISASELAAVLRALGSDP-SPDEIRDMIAEMDADRDGFVDLQEFA  84

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
                        ++EL+DAF  +D D DG IS +EL  V +++G+ +CTLEDC RMI  V
Sbjct  85   AFHRCGVGRGGAEAELKDAFRMYDLDSDGLISVDELLRVMRSLGE-KCTLEDCARMIRSV  143

Query  627  D  629
            D
Sbjct  144  D  144



>ref|XP_010531587.1| PREDICTED: probable calcium-binding protein CML25 [Tarenaya hassleriana]
Length=202

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + FK  D + DGKI   EL ++++ +G E P  +EL+  ++E+D DGDG I+ EEF 
Sbjct  49   ELEEVFKKFDVNGDGKISSSELGSIMASLGHEVP-EDELQKAITEIDGDGDGNINFEEFV  107

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL+ V +++GD  C++ +CR+MI  V
Sbjct  108  ELNTKGMDQDDVMENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIGECRKMISGV  166

Query  627  D  629
            D
Sbjct  167  D  167



>ref|XP_009379268.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
 ref|XP_009347046.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=205

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 79/136 (58%), Gaps = 13/136 (10%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  437
            + ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  438  EEFSVL------------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  581
            +EF               S  F     DSEL DAF  FDTD +GKISA+EL  V  ++G 
Sbjct  108  DEFMNAVNVDRSRSNDNNSVGFGNEEEDSELMDAFRIFDTDKNGKISAKELQRVLFSLGC  167

Query  582  SRCTLEDCRRMILWVD  629
              C+L +CR+MI  VD
Sbjct  168  KECSLRECRQMIKGVD  183


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +EL+ AF++ D D +GKI  +EL+ +L  +G +  S  E R M+  VDR+GDG +  EEF
Sbjct  136  SELMDAFRIFDTDKNGKISAKELQRVLFSLGCKECSLRECRQMIKGVDRNGDGAVDFEEF  195

Query  447  SVL  455
             ++
Sbjct  196  RLM  198



>ref|XP_009103045.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
Length=184

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  446
            EL   FK  D + DGKI  +EL ++++ +G E P  EEL+  ++E+D+ GDG I+LEEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGSIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFV  92

Query  447  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             + +           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  93   ELFTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGV  151

Query  627  D  629
            D
Sbjct  152  D  152


 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  273  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  452
            L  AF + D D +G I  EEL  +L  +G E  S  E R M+S VD+DGDG I  EEF V
Sbjct  108  LKDAFSVYDIDGNGSISAEELHEVLRSLGDEC-SIAECRKMISGVDKDGDGTIDFEEFKV  166

Query  453  L  455
            +
Sbjct  167  M  167



>ref|XP_010499149.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
 ref|XP_010460422.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPE-EELEKAINEIDRKGDGYINFEEFV  95

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDE-CSIAECRKMIGGV  154

Query  627  D  629
            D
Sbjct  155  D  155



>ref|XP_010477987.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPE-EELEKAINEIDRKGDGYINFEEFV  95

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  627  D  629
            D
Sbjct  155  D  155



>ref|XP_004960644.1| PREDICTED: probable calcium-binding protein CML18-like [Setaria 
italica]
Length=179

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 74/130 (57%), Gaps = 11/130 (8%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AE+ Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  30   AEVEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDADRDGFVDLAEF  88

Query  447  SVLS---------SAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  599
                               + ++ELR+AF  +D DH+G ISA EL  V + +GD +C++ 
Sbjct  89   VAFHCGPSGGAGAGEGQEDATEAELREAFRMYDADHNGLISARELHRVLRQLGD-KCSVA  147

Query  600  DCRRMILWVD  629
            DC RMI  VD
Sbjct  148  DCSRMIRSVD  157



>ref|XP_006304603.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
 gb|EOA37501.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
Length=184

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  92

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +C++MI  V
Sbjct  93   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECKKMIGGV  151

Query  627  D  629
            D
Sbjct  152  D  152



>ref|XP_011467223.1| PREDICTED: calcium-binding protein CML24-like [Fragaria vesca 
subsp. vesca]
Length=148

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + F   D++ DGKI ++EL  +  ++G+E    EE++ +++E D+DGDG I L+EF+
Sbjct  17   ELKKIFNKFDKNGDGKICRDELREIFRELGSETTP-EEVKTIMAEFDKDGDGRIDLDEFA  75

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             + +  +      +LRDAFD +D D +G+ISA EL  V K +G  +C+L+DC +MI  VD
Sbjct  76   EILNGGSTK----DLRDAFDLYDLDKNGRISASELHEVLKRLG-QKCSLKDCAKMIGSVD  130



>ref|XP_007045260.1| Polcalcin Jun o, putative [Theobroma cacao]
 gb|EOY01092.1| Polcalcin Jun o, putative [Theobroma cacao]
Length=199

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 76/125 (61%), Gaps = 11/125 (9%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + FK  D + DGKI   EL +++  +G   PS +EL+ M+ E D DGDG I+ +EF 
Sbjct  54   ELEEVFKKFDVNGDGKISSSELGSIMGSLG-HKPSEDELQKMIKEFDADGDGSINFKEFV  112

Query  450  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  614
             L++       DS+     L+DAF  +D D +G ISAEEL  V K++GD  C++ +CR+M
Sbjct  113  ELNT----KGVDSDEVLENLKDAFSVYDIDGNGSISAEELHEVLKSLGD-ECSIAECRKM  167

Query  615  ILWVD  629
            I  VD
Sbjct  168  ISGVD  172


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 37/66 (56%), Gaps = 1/66 (2%)
 Frame = +3

Query  273  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  452
            L  AF + D D +G I  EEL  +L  +G E  S  E R M+S VD DGDG I  EEF V
Sbjct  128  LKDAFSVYDIDGNGSISAEELHEVLKSLGDEC-SIAECRKMISGVDSDGDGMIDFEEFKV  186

Query  453  LSSAFA  470
            +  A A
Sbjct  187  MMMAGA  192



>ref|XP_003524362.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=188

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q F   D + DGKI   EL +++  +G +P +  EL  M+ EVD DGDGCISL EF 
Sbjct  36   ELEQVFNKFDVNGDGKISASELGSIMGSLG-QPATELELDNMIREVDGDGDGCISLPEFI  94

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  FD D +G I+AEEL  V +++G+  C+L +CRRMI  V
Sbjct  95   ELNTKGVDSDEVLENLKDAFAVFDIDGNGSITAEELNTVMRSLGED-CSLAECRRMISGV  153

Query  627  D  629
            D
Sbjct  154  D  154



>ref|XP_006469245.1| PREDICTED: probable calcium-binding protein CML25-like [Citrus 
sinensis]
Length=212

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q F   D + DGKI   EL ++L+ +G    + EEL+ M+ E+D DGDG +  +EF 
Sbjct  60   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVKEIDADGDGFVDFDEFV  118

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G I+AEEL  V +++GD  CTL +CRRMI  V
Sbjct  119  ELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDD-CTLAECRRMIRGV  177

Query  627  D  629
            D
Sbjct  178  D  178



>ref|XP_007163392.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
 gb|ESW35386.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
Length=139

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D++ DGKI   EL  L++ +G++  + EE+R M++E+DR+GDG I L+EF 
Sbjct  4    EVRKIFNKFDKNGDGKISCSELRELMAALGSKTTT-EEVRRMMAELDRNGDGYIDLKEFG  62

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  63   EFHCGGGGGD-GKELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  120



>gb|AFK37714.1| unknown [Medicago truncatula]
 gb|KEH34669.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=138

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D++ DGKI + EL+ +++ +G++  + EE+  M+ E+DR+GDG I L+EF 
Sbjct  5    EVRKIFNKFDKNGDGKISRTELKEMMTALGSKTTT-EEVTRMMEELDRNGDGYIDLKEFG  63

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             L +         ELR+AF+ +D D +G ISA+EL  V + +G+ +C+L DCR+MI  VD
Sbjct  64   ELHNGGGDTK---ELREAFEMYDLDKNGLISAKELHAVMRRLGE-KCSLGDCRKMIGNVD  119



>emb|CDP16307.1| unnamed protein product [Coffea canephora]
Length=189

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q FK  D + DGKI   EL  ++  +G  P + EEL  +++E D DGDG I L+EF 
Sbjct  42   ELEQVFKKFDVNGDGKISASELGQIMGSLGY-PTTDEELHKLMNEADSDGDGFIDLQEFI  100

Query  450  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  FD D +G ISA+EL NV K++G+  C+L +CR+MI  V
Sbjct  101  ELNTKDIDSDEVMENLKDAFSVFDIDKNGSISADELQNVLKSLGE-ECSLAECRKMICGV  159

Query  627  D  629
            D
Sbjct  160  D  160



>ref|XP_002459097.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
 gb|EES04217.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
Length=189

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 4/132 (3%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            SP   +    E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DG
Sbjct  34   SPPRAATAEEEMARVFRKFDANGDGRISRSELAALFESLG-HAASDDEVARMMAEADADG  92

Query  420  DGCISLEEFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT  593
            DG ISL+EF+ L++  A    + + +LR AF  FD D +G ISA EL  V + +G+S  +
Sbjct  93   DGFISLDEFAALNATVAGDAAAVEEDLRHAFRVFDADGNGTISAAELARVLRGLGES-AS  151

Query  594  LEDCRRMILWVD  629
            +  CRRMI  VD
Sbjct  152  VAQCRRMIEGVD  163


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  216  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  395
              ALN  ++ D  + +  +L  AF++ D D +G I   EL  +L  +G E  S  + R M
Sbjct  101  FAALNATVAGD-AAAVEEDLRHAFRVFDADGNGTISAAELARVLRGLG-ESASVAQCRRM  158

Query  396  LSEVDRDGDGCISLEEFSVL  455
            +  VD++GDG IS EEF V+
Sbjct  159  IEGVDQNGDGLISFEEFKVM  178



>ref|XP_002279679.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
Length=204

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 5/125 (4%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSR-EELRLMLSEVDRDGDGCISLEEF  446
            +L Q F+L+D + DGKI   EL  +L  +G E  +  EE   M+ EVD +GDG I L+EF
Sbjct  55   QLKQVFRLLDTNGDGKISSFELSEVLLWLGQEKSTAVEEAEGMVREVDCNGDGFIDLDEF  114

Query  447  -SVLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  614
              V+++ F   +  +CD  L DAF  FD+D +G ISAEEL  V  ++G  +C+L++C+RM
Sbjct  115  MRVMNTDFTVGSSSTCDDGLMDAFLIFDSDKNGVISAEELQRVLISLGCVKCSLQECKRM  174

Query  615  ILWVD  629
            I  VD
Sbjct  175  IKGVD  179


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +3

Query  273  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  452
            L+ AF + D D +G I  EEL+ +L  +G    S +E + M+  VD+DGDG +  EEF  
Sbjct  134  LMDAFLIFDSDKNGVISAEELQRVLISLGCVKCSLQECKRMIKGVDKDGDGFVDFEEFRS  193

Query  453  LSSAFAPP  476
            + +  A  
Sbjct  194  MMTGCAST  201



>ref|XP_002974189.1| hypothetical protein SELMODRAFT_100711 [Selaginella moellendorffii]
 gb|EFJ25144.1| hypothetical protein SELMODRAFT_100711 [Selaginella moellendorffii]
Length=181

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 81/150 (54%), Gaps = 4/150 (3%)
 Frame = +3

Query  183  KPGGESTPTSVLPALNDEISPDE-LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  359
            K  G  +P + + A     SP   +     EL Q F+ ID D DG+I  EEL A+L  +G
Sbjct  10   KKSGRDSPVASIAAEATVPSPARSIDQRAKELEQVFRSIDTDGDGRICLEELRAMLRLIG  69

Query  360  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  539
               P   EL  +L  +D DGDG ISLEEF  L +     S   +LR AF  FD D +G I
Sbjct  70   NANPDDTELLGLLRAIDSDGDGFISLEEF--LRANDEGGSSAGDLRAAFQVFDIDGNGFI  127

Query  540  SAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
            SA+EL  V + +GD + T  +CRRMI  VD
Sbjct  128  SADELHCVLQKMGD-KITKSECRRMIKGVD  156



>ref|XP_002314786.2| hypothetical protein POPTR_0010s11740g [Populus trichocarpa]
 gb|EEF00957.2| hypothetical protein POPTR_0010s11740g [Populus trichocarpa]
Length=197

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 87/144 (60%), Gaps = 4/144 (3%)
 Frame = +3

Query  204  PTSVLPALNDEISPD-ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            P++++ +++   SP   L     EL Q FK  D + DGKI   EL ++++ +G E  + +
Sbjct  23   PSAIVASISGSKSPSIRLRPQVEELEQVFKKFDVNGDGKISSAELGSIMANLGHEA-TED  81

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELF  557
            EL+ M++E D DGDG I L+EF  L++     +   E L+DAF  +D D +G ISAEEL 
Sbjct  82   ELQTMITEFDADGDGFIDLQEFVALNTQGVDTNEVMENLKDAFSVYDVDGNGSISAEELH  141

Query  558  NVFKTIGDSRCTLEDCRRMILWVD  629
             V  ++G+  C++ +CR++I  VD
Sbjct  142  KVMASLGEP-CSMSECRKIISGVD  164


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 54/123 (44%), Gaps = 8/123 (7%)
 Frame = +3

Query  210  SVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  389
            S++  L  E + DEL  +  E        D D DG I  +E  AL +Q        E L+
Sbjct  69   SIMANLGHEATEDELQTMITEF-------DADGDGFIDLQEFVALNTQGVDTNEVMENLK  121

Query  390  LMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  569
               S  D DG+G IS EE   + ++   P   SE R      D+D DG I  EE F V  
Sbjct  122  DAFSVYDVDGNGSISAEELHKVMASLGEPCSMSECRKIISGVDSDGDGMIDFEE-FKVMM  180

Query  570  TIG  578
             +G
Sbjct  181  MMG  183



>gb|KDO60746.1| hypothetical protein CISIN_1g029304mg [Citrus sinensis]
Length=195

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q F   D + DGKI   EL ++L+ +G    + EEL+ M+ E+D DGDG +  +EF 
Sbjct  43   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVREIDADGDGFVDFDEFV  101

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G I+AEEL  V +++GD  CTL +CRRMI  V
Sbjct  102  ELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDD-CTLAECRRMIRGV  160

Query  627  D  629
            D
Sbjct  161  D  161



>ref|XP_007215081.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
 gb|EMJ16280.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
Length=161

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  24   GSREQLETIFNKFDKNGDGKISCDELRGVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83

Query  438  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
             EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L+DC +MI
Sbjct  84   LEFAEIMNGGSSQ----ELRDAFDLYDLDKNGLISVSELHEVMKRLG-LKCSLQDCVKMI  138

Query  618  LWVD  629
              VD
Sbjct  139  RNVD  142



>gb|AAM67124.1| calmodulin-related protein [Arabidopsis thaliana]
Length=157

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 9/129 (7%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP--SREELRLMLSEVDRDGDGCI  431
            G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct  11   GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI  67

Query  432  SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  602
             L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct  68   DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD  126

Query  603  CRRMILWVD  629
            C+RMI  VD
Sbjct  127  CQRMISKVD  135


 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +L +AF L D D +G+I   EL +++  +G E  S ++ + M+S+VD DGDGC+  EEF
Sbjct  90   DLKEAFDLYDLDRNGRISANELHSVMKNLG-EKCSIQDCQRMISKVDSDGDGCVDFEEF  147



>ref|XP_002525994.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF36418.1| Polcalcin Jun o, putative [Ricinus communis]
Length=190

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 80/145 (55%), Gaps = 3/145 (2%)
 Frame = +3

Query  198  STPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSR  377
            ++PT+            +L     EL Q FK  D + DGKI   EL +++S +G E  + 
Sbjct  21   NSPTTANQVTGSRSQSLKLKPHIEELEQVFKKFDVNGDGKISSLELGSIMSSLGHEA-NE  79

Query  378  EELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEEL  554
            EE+  M+ E D DGDG I  +EF  L++           L+DAFD +D D +G ISAEEL
Sbjct  80   EEVMKMIKEFDADGDGFIDFKEFVELNTQGVGSDEVMENLKDAFDVYDIDGNGSISAEEL  139

Query  555  FNVFKTIGDSRCTLEDCRRMILWVD  629
              V  +IG+S C++ +CR+MI  VD
Sbjct  140  HKVMGSIGES-CSIAECRKMISGVD  163



>gb|EYU17655.1| hypothetical protein MIMGU_mgv1a015081mg [Erythranthe guttata]
Length=168

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 4/122 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F+  D + DGKI  +EL  +L+ +G+   S +E+  M+ E+D D DG I+L+EF+
Sbjct  20   EVRKVFQRFDTNGDGKISSDELGGVLNALGS-GTSADEVARMMEEIDTDKDGHINLQEFA  78

Query  450  VLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
               S  + P  S + ELR+AF  +D DH+GKISA EL  +   +G+  C+ +DC  MI  
Sbjct  79   AFCSGDSDPYNSAEKELREAFQLYDQDHNGKISAAELHQILTRLGE-HCSEQDCAGMIRT  137

Query  624  VD  629
            VD
Sbjct  138  VD  139


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL +AF+L D+D +GKI   EL  +L+++G E  S ++   M+  VD DGDG +S +EF
Sbjct  94   ELREAFQLYDQDHNGKISAAELHQILTRLG-EHCSEQDCAGMIRTVDSDGDGFVSFDEF  151



>sp|Q0DJV6.1|CML18_ORYSJ RecName: Full=Probable calcium-binding protein CML18; AltName: 
Full=Calmodulin-like protein 18 [Oryza sativa Japonica Group]
 dbj|BAG92613.1| unnamed protein product [Oryza sativa Japonica Group]
Length=158

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 15/134 (11%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F+  D + DGKI  EEL ++L  +GA P    E+R M+ E+D D DG + L EF
Sbjct  4    AELEQVFRRYDANGDGKISAEELASVLRALGA-PLGPGEVRRMMDEMDSDRDGFVDLSEF  62

Query  447  SVLSSAFAPP-------------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
            +       P              + ++ELR+AF  +D D +GKISA EL  V + +GD +
Sbjct  63   AAFHCGPTPAHGGKGGDAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-K  121

Query  588  CTLEDCRRMILWVD  629
            C++ DC RMI  VD
Sbjct  122  CSVADCSRMIRSVD  135


 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  80   AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  138

Query  420  DGCISLEEF  446
            DGC++ +EF
Sbjct  139  DGCVNFDEF  147



>gb|KEH26932.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=174

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 74/130 (57%), Gaps = 1/130 (1%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            +P  L G   EL + F   D + DGKI   ELE +L  + ++ P +EELR ++ E+  D 
Sbjct  16   TPSPLLGDMDELKKVFNNFDANGDGKISVNELETVLRTLRSDVPQQEELRRVMEELSTDR  75

Query  420  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  599
            DG I+L EF+    +      DS LRDAFD +D D +G IS EEL      +G  +C++E
Sbjct  76   DGFINLSEFAAFCRSDTTDGGDSALRDAFDLYDKDKNGLISTEELHLALDRLG-MKCSVE  134

Query  600  DCRRMILWVD  629
            +C+ MI  VD
Sbjct  135  ECQDMIKSVD  144



>ref|NP_564874.1| calmodulin like 23 [Arabidopsis thaliana]
 sp|Q9C8Y1.1|CML23_ARATH RecName: Full=Probable calcium-binding protein CML23; AltName: 
Full=Calmodulin-like protein 23 [Arabidopsis thaliana]
 gb|AAG52166.1|AC020665_11 calmodulin-related protein; 72976-72503 [Arabidopsis thaliana]
 gb|AAL36209.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AAM51400.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AEE34504.1| calmodulin like 23 [Arabidopsis thaliana]
Length=157

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 9/129 (7%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP--SREELRLMLSEVDRDGDGCI  431
            G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct  11   GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI  67

Query  432  SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  602
             L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct  68   DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD  126

Query  603  CRRMILWVD  629
            C+RMI  VD
Sbjct  127  CQRMINKVD  135


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +L +AF L D D +G+I   EL +++  +G E  S ++ + M+++VD DGDGC+  EEF
Sbjct  90   DLKEAFDLYDLDRNGRISANELHSVMKNLG-EKCSIQDCQRMINKVDSDGDGCVDFEEF  147



>gb|EMT07142.1| Putative calcium-binding protein CML10 [Aegilops tauschii]
Length=185

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISLEEF+
Sbjct  50   EMERVFRKFDANGDGRISRPELAALFESLG-HAATEDELTRMMAEADADGDGFISLEEFA  108

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             L +A AP   + +LR AF  FD D  G ISA EL  V   +G+ + T++ CRRMI  VD
Sbjct  109  AL-NATAPGDDEEDLRLAFKVFDADGSGDISAAELARVLHVLGE-KATVQQCRRMIEGVD  166



>ref|XP_008343178.1| PREDICTED: probable calcium-binding protein CML18 [Malus domestica]
Length=205

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 78/136 (57%), Gaps = 13/136 (10%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  437
            + ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  438  EEFSVL------------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  581
            +EF               S  F     D EL DAF  FDTD +GKISA+EL  V  ++G 
Sbjct  108  DEFMNAVNVDRSRSNDSDSVGFGNEEEDCELMDAFRIFDTDKNGKISAKELQRVLVSLGC  167

Query  582  SRCTLEDCRRMILWVD  629
              C+L +CR+MI  VD
Sbjct  168  KECSLRECRQMIKGVD  183


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             EL+ AF++ D D +GKI  +EL+ +L  +G +  S  E R M+  VDR+GDG +  EEF
Sbjct  136  CELMDAFRIFDTDKNGKISAKELQRVLVSLGCKECSLRECRQMIKGVDRNGDGAVDFEEF  195

Query  447  SVL  455
             ++
Sbjct  196  RLM  198



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 74/124 (60%), Gaps = 2/124 (2%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   E+ + F   D++ DGKI  +EL+ +L  +G++  S EE++ ++ E+D DGDG I  
Sbjct  13   GSMDEVRKVFNKFDKNGDGKISADELKDVLRSLGSKT-SPEEVKRVMDEIDTDGDGYIDF  71

Query  438  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            +EFS    A        EL+DAFD +D D +G ISA EL  V K +G+ + +L+DC  MI
Sbjct  72   KEFSTFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLGE-KSSLKDCVNMI  130

Query  618  LWVD  629
              VD
Sbjct  131  KKVD  134



>ref|XP_011075365.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=197

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 73/124 (59%), Gaps = 3/124 (2%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            +  EL Q FK  D + DGKI   EL +++  +G    + EELR M+  VD DGDG I L+
Sbjct  44   MEQELEQVFKKFDVNGDGKISALELGSIMGSLG-HSATEEELRTMIQGVDSDGDGHIDLQ  102

Query  441  EFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            EF  L++           L+DAF  FD D +G ISAEEL +V + +G+  CTL +CR+MI
Sbjct  103  EFIELNTKDVDYDEVLQNLKDAFQVFDIDKNGSISAEELQDVLQNLGE-ECTLAECRKMI  161

Query  618  LWVD  629
              VD
Sbjct  162  SGVD  165


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 5/68 (7%)
 Frame = +3

Query  264  YAELVQ----AFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  431
            Y E++Q    AF++ D D +G I  EEL+ +L  +G E  +  E R M+S VD DG+G I
Sbjct  114  YDEVLQNLKDAFQVFDIDKNGSISAEELQDVLQNLG-EECTLAECRKMISGVDTDGNGAI  172

Query  432  SLEEFSVL  455
            S +EF V+
Sbjct  173  SFDEFKVM  180



>gb|AAV59327.1| unknown protein [Oryza sativa Japonica Group]
Length=156

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 15/134 (11%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F+  D + DGKI  EEL ++L  +GA P    E+R M+ E+D D DG + L EF
Sbjct  2    AELEQVFRRYDANGDGKISAEELASVLRALGA-PLGPGEVRRMMDEMDSDRDGFVDLSEF  60

Query  447  SVLSSAFAPP-------------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
            +       P              + ++ELR+AF  +D D +GKISA EL  V + +GD +
Sbjct  61   AAFHCGPTPAHGGKGGDAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-K  119

Query  588  CTLEDCRRMILWVD  629
            C++ DC RMI  VD
Sbjct  120  CSVADCSRMIRSVD  133


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  78   AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  136

Query  420  DGCISLEEF  446
            DGC++ +EF
Sbjct  137  DGCVNFDEF  145



>ref|XP_004971250.1| PREDICTED: probable calcium-binding protein CML10-like [Setaria 
italica]
Length=235

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 74/122 (61%), Gaps = 4/122 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F+  D + DG+I + EL AL   +G    S +EL  M++E D DGDG ISL+EF+
Sbjct  90   EMARVFRKFDANGDGRISRSELAALFESLG-HAASDDELARMMAEADADGDGFISLDEFA  148

Query  450  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
             L++  A    + + +LR AF  FD D +G ISA EL  V + +G+S  ++  CRRMI  
Sbjct  149  ALNATVAGDAAAVEEDLRHAFRVFDADGNGTISATELARVLRGLGES-ASVAQCRRMIEG  207

Query  624  VD  629
            VD
Sbjct  208  VD  209


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +3

Query  216  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  395
              ALN  ++ D  + +  +L  AF++ D D +G I   EL  +L  +G E  S  + R M
Sbjct  147  FAALNATVAGDA-AAVEEDLRHAFRVFDADGNGTISATELARVLRGLG-ESASVAQCRRM  204

Query  396  LSEVDRDGDGCISLEEFSVL  455
            +  VD++GDG IS EEF V+
Sbjct  205  IEGVDQNGDGLISFEEFKVM  224



>gb|EEE62792.1| hypothetical protein OsJ_17595 [Oryza sativa Japonica Group]
Length=189

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 15/134 (11%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL Q F+  D + DGKI  EEL ++L  +GA P    E+R M+ E+D D DG + L EF
Sbjct  35   AELEQVFRRYDANGDGKISAEELASVLRALGA-PLGPGEVRRMMDEMDSDRDGFVDLSEF  93

Query  447  SVLSSAFAPP-------------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  587
            +       P              + ++ELR+AF  +D D +GKISA EL  V + +GD +
Sbjct  94   AAFHCGPTPAHGGKGGDAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-K  152

Query  588  CTLEDCRRMILWVD  629
            C++ DC RMI  VD
Sbjct  153  CSVADCSRMIRSVD  166


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  240  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  419
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  111  AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  169

Query  420  DGCISLEEF  446
            DGC++ +EF
Sbjct  170  DGCVNFDEF  178



>ref|XP_010925997.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 81/145 (56%), Gaps = 17/145 (12%)
 Frame = +3

Query  195  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  374
            ES  TS L ++ND             + + F   D + DGKI   EL  ++  +G+E  S
Sbjct  6    ESEKTSELVSVND-------------VERVFTRYDTNGDGKISPSELADVMRALGSEV-S  51

Query  375  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  554
             EEL+ M++E+D DGDG + L+EF            + ELRDAF  +D D DG+ISA+EL
Sbjct  52   DEELKAMMAELDSDGDGFVDLKEFVAFHRGLGEK--EGELRDAFAMYDLDRDGQISAKEL  109

Query  555  FNVFKTIGDSRCTLEDCRRMILWVD  629
              V K +G+ +C++ DC RMI  VD
Sbjct  110  HLVLKRLGE-KCSVHDCSRMIRSVD  133



>emb|CDX84967.1| BnaC05g20880D [Brassica napus]
Length=189

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A+++ +G E P  E L   ++E+DR GDG I+ EEF 
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVP-EEVLEKAITEIDRKGDGYINFEEFV  97

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  98   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIGECRKMIGGV  156

Query  627  D  629
            D
Sbjct  157  D  157



>ref|XP_004241666.2| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=197

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+L+EF+
Sbjct  60   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINLDEFA  118

Query  450  -VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
                +  +      EL++AFD +D DH+G+ISA EL  +   +G   CTL+DC RMI  V
Sbjct  119  DFCKNDESVDGGAKELKEAFDLYDQDHNGRISATELHQILNRLG-QNCTLQDCTRMITSV  177

Query  627  D  629
            D
Sbjct  178  D  178



>gb|EYU44572.1| hypothetical protein MIMGU_mgv1a015576mg [Erythranthe guttata]
Length=152

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 73/115 (63%), Gaps = 3/115 (3%)
 Frame = +3

Query  285  FKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA  464
            F + D++ DGKI + EL A+LS +G+   + +  RLM SE+D+DGDG I   EF      
Sbjct  21   FNMFDKNGDGKISRTELGAILSSLGSSTSAADAARLM-SELDKDGDGFIDRSEFRAYKLG  79

Query  465  FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             A    + EL++AF  +D D +GKISA EL +V  ++G ++C+++DCR+MI   D
Sbjct  80   GAGGDGE-ELKEAFALYDKDKNGKISATELHSVLTSLG-TKCSVKDCRKMIASFD  132


 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL +AF L D+D +GKI   EL ++L+ +G    S ++ R M++  D DGDGC++ +EF
Sbjct  87   ELKEAFALYDKDKNGKISATELHSVLTSLGT-KCSVKDCRKMIASFDVDGDGCMNFDEF  144



>ref|XP_004490807.1| PREDICTED: calcium-binding protein CML24-like [Cicer arietinum]
Length=143

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D++ DGKI   EL+ +L  +G +  S +E++ M+  +D++GDG I L+EFS
Sbjct  8    EVRKIFSKFDKNGDGKISSSELKEMLITLGTKTTS-DEVKRMMEMIDQNGDGYIDLKEFS  66

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                  A     +ELRDAFD +D D +G ISA EL  V   +G+ +C+L DCRRMI  VD
Sbjct  67   DFHCIDAGKDDANELRDAFDLYDLDKNGLISANELHAVLIKLGE-KCSLGDCRRMIKNVD  125



>ref|XP_009109853.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY36129.1| BnaA08g19190D [Brassica napus]
Length=187

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A+++ +G E P  E L+  ++++DR GDG I+ EEF 
Sbjct  38   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEVLQKAITDIDRKGDGYINFEEFV  96

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  97   ELNTKGMDQNEVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  155

Query  627  D  629
            D
Sbjct  156  D  156



>ref|XP_001768906.1| predicted protein [Physcomitrella patens]
 gb|EDQ66260.1| predicted protein, partial [Physcomitrella patens]
Length=138

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            +L   FKL DR+ DGKI K EL  +L  +G +  +  EL  M+ +VD DGDG I L+EF 
Sbjct  3    DLEDVFKLFDRNGDGKISKAELGTVLHLLG-DTLTDAELDQMIRDVDVDGDGAIDLQEFI  61

Query  450  VLSSAFAPPSCDSE---LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
             L+      SC  E   L+ AFD FD D +G ISAEEL  V K++GD   +L +CR MI 
Sbjct  62   KLN--VDGRSCSQENDNLQSAFDVFDADKNGFISAEELQRVMKSLGDYNTSLAECRHMIN  119

Query  621  WVD  629
             VD
Sbjct  120  CVD  122



>ref|XP_002312460.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
 gb|EEE89827.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
Length=172

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q FK  D + DGKI   EL++   ++G E  S EEL+ M++E D DGDG I L+EF 
Sbjct  21   ELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEEELQRMITEFDADGDGFIDLQEFV  79

Query  450  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++     +   E L+DAF  +D D +G ISAEEL  V  ++G+  C++ +CR+MI  V
Sbjct  80   ALNTQGVDTNEVMENLKDAFSVYDIDGNGSISAEELHKVMASLGEP-CSMAECRKMISGV  138

Query  627  D  629
            D
Sbjct  139  D  139


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  273  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  452
            L  AF + D D +G I  EEL  +++ +G EP S  E R M+S VDRDGDG I  EEF V
Sbjct  95   LKDAFSVYDIDGNGSISAEELHKVMASLG-EPCSMAECRKMISGVDRDGDGMIDFEEFKV  153

Query  453  L  455
            +
Sbjct  154  M  154



>ref|XP_011024051.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=195

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 81/144 (56%), Gaps = 4/144 (3%)
 Frame = +3

Query  204  PTSVLPALNDEISPD-ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  380
            P+ +  ++N   SP   L     EL Q FK  D + DGKI   EL++   ++G E  S E
Sbjct  21   PSGMATSINGSKSPSVRLRLQVEELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEE  79

Query  381  ELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELF  557
            EL  M++E D DGDG I L+EF  L++           L+DAF  +D D +G ISAEEL 
Sbjct  80   ELLRMITEFDADGDGFIDLQEFVALNTQGVDTDEVMENLKDAFSVYDIDGNGSISAEELH  139

Query  558  NVFKTIGDSRCTLEDCRRMILWVD  629
             V  ++G+  C++ +CR+MI  VD
Sbjct  140  KVMASLGEP-CSMAECRKMISGVD  162


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 5/79 (6%)
 Frame = +3

Query  222  ALNDE-ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  398
            ALN + +  DE+      L  AF + D D +G I  EEL  +++ +G EP S  E R M+
Sbjct  103  ALNTQGVDTDEV---MENLKDAFSVYDIDGNGSISAEELHKVMASLG-EPCSMAECRKMI  158

Query  399  SEVDRDGDGCISLEEFSVL  455
            S VDRDGDG I  EEF V+
Sbjct  159  SGVDRDGDGMIDFEEFKVM  177



>ref|XP_009113828.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY27574.1| BnaA09g28330D [Brassica napus]
Length=191

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A+++ +G E P  E L   ++E+DR GDG I+ EEF 
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVP-EEVLEKAITEIDRKGDGYINFEEFV  97

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  98   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIGECRKMIGGV  156

Query  627  D  629
            D
Sbjct  157  D  157



>ref|XP_010663678.1| PREDICTED: calcium-binding allergen Ole e 8 [Vitis vinifera]
 emb|CAN60554.1| hypothetical protein VITISV_014971 [Vitis vinifera]
Length=163

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + F   D + DGKI   EL  +L  +G+E  S EE+  ++ E+D D DGCI+LEEF+
Sbjct  21   ELQKVFNRFDANGDGKISSSELANVLRALGSES-SPEEMSRVMKEIDTDDDGCINLEEFA  79

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
                + +      ELRDAF  +D D +G ISA EL  V K +G+ +C+++DC++MI
Sbjct  80   QFCKSGSNADA-GELRDAFQLYDGDKNGLISAVELHQVLKQLGE-KCSVQDCQKMI  133



>gb|ABK26821.1| unknown [Picea sitchensis]
Length=194

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLEEF 
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLEEFI  109

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++      +C  +L++AF  FD D +G ISA+EL+ V K +GD   + EDC+ MI  V
Sbjct  110  DLNTKGNDKAACLEDLKNAFKIFDLDRNGSISADELYQVLKGMGDG-SSREDCQNMITGV  168

Query  627  D  629
            D
Sbjct  169  D  169


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +L  AFK+ D D +G I  +EL  +L  +G +  SRE+ + M++ VDR+GDG I+ EEF
Sbjct  124  DLKNAFKIFDLDRNGSISADELYQVLKGMG-DGSSREDCQNMITGVDRNGDGLINFEEF  181



>ref|XP_010925995.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 81/145 (56%), Gaps = 17/145 (12%)
 Frame = +3

Query  195  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  374
            ES  +S L ++ND             + + F   D + DGKI   EL  ++  +G+E  S
Sbjct  6    ESEKSSELVSVND-------------IKRVFTRYDTNGDGKISPSELADVMRALGSEV-S  51

Query  375  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  554
             EEL+ M++E+D DGDG + L+EF            + ELRDAF  +D D DG+ISA+EL
Sbjct  52   DEELKAMMAELDSDGDGFVDLKEFVAFHRGLGEK--EEELRDAFAMYDLDRDGQISAKEL  109

Query  555  FNVFKTIGDSRCTLEDCRRMILWVD  629
              V K +G+ +C++ DC RMI  VD
Sbjct  110  HLVLKQLGE-KCSVHDCSRMIRSVD  133



>ref|XP_001779680.1| predicted protein [Physcomitrella patens]
 gb|EDQ55476.1| predicted protein [Physcomitrella patens]
Length=175

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 83/145 (57%), Gaps = 9/145 (6%)
 Frame = +3

Query  213  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  392
            V  ALN   +P  +    AEL  AFK+ D + DG+I   EL  +L  +     + +EL+L
Sbjct  14   VSQALN---APCTIHCSEAELEAAFKVFDANGDGRICITELGKVLGSLSGCEVTEQELQL  70

Query  393  MLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE------LRDAFDFFDTDHDGKISAEEL  554
            ++++VD++ DG ISLE+F   +        D+E      +R+AF  FD D +  ISA+EL
Sbjct  71   IMNDVDKNQDGFISLEQFKAANKTLTSHLADNETPKEDSIREAFATFDKDGNNLISADEL  130

Query  555  FNVFKTIGDSRCTLEDCRRMILWVD  629
              V +++GD   +LEDCRRMI  VD
Sbjct  131  RAVMQSLGDKGYSLEDCRRMISNVD  155



>ref|XP_009617304.1| PREDICTED: calmodulin-like [Nicotiana tomentosiformis]
Length=147

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = +3

Query  225  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  404
            + D +S +++S    E  +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEEQIS----EFREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  405  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  584
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  585  RCTLEDCRRMI  617
            R T E+ ++MI
Sbjct  115  RLTDEEAQQMI  125



>ref|XP_010109033.1| putative calcium-binding protein CML23 [Morus notabilis]
 gb|EXC20673.1| putative calcium-binding protein CML23 [Morus notabilis]
Length=151

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 78/127 (61%), Gaps = 5/127 (4%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   E+ + F   D++ DGKI + EL  +L  +G+   S +E++ +++E+D DGDG I  
Sbjct  7    GSMEEVQKIFNKFDKNRDGKISRSELRDVLGALGS-KTSDDEVKRVMAEIDADGDGYIDF  65

Query  438  EEFSVLSSAFAP---PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  608
            +EF    S  +     + + ELRDAFD +D D +G IS+ EL +V +++G+ +C+L DC 
Sbjct  66   DEFVKFHSGGSENDGAANEKELRDAFDLYDLDKNGVISSRELHSVLRSLGE-KCSLSDCS  124

Query  609  RMILWVD  629
            RMI  VD
Sbjct  125  RMIRSVD  131



>ref|XP_002968790.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
 gb|EFJ29906.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
Length=135

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 71/120 (59%), Gaps = 3/120 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL Q F+ ID D DG+I  EEL A+L  +G   P   EL  +L  +D DGDG ISLEEF 
Sbjct  2    ELEQVFRSIDTDGDGRICLEELRAMLRLIGNANPDDTELLGLLRAIDSDGDGFISLEEF-  60

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             L +     S   +LR AF  FD D +G ISA+EL  V + +GD + T  +CRRMI  VD
Sbjct  61   -LRANDEGGSSADDLRAAFQVFDIDGNGFISADELHCVLQKMGD-KITKSECRRMIKGVD  118



>ref|XP_003538397.1| PREDICTED: probable calcium-binding protein CML27-like isoformX1 
[Glycine max]
 ref|XP_006591331.1| PREDICTED: probable calcium-binding protein CML27-like isoform 
X2 [Glycine max]
Length=137

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D++ DGKI   EL+ ++  +G++  S EE++ M++E+DR+GDG I L+EF 
Sbjct  4    EVRKIFSKFDKNGDGKISCAELKEMMVALGSKTTS-EEVKRMMAELDRNGDGYIDLKEFG  62

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  63   EFHCGGGDGR---ELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  118



>gb|KHM99973.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=152

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = +3

Query  261  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  440
            +  +L   FK  D + DGKI   EL +++  +G +P + EE++ M+ EVD +GDG I+L 
Sbjct  5    ITEDLEYVFKKFDANGDGKISSSELGSIMKSLG-QPATEEEVKRMIQEVDANGDGHINLG  63

Query  441  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
            EF  L++    P      L+DAF  FD D +G I+A+EL  V  ++GD+ C++++C++MI
Sbjct  64   EFLELNTKGVDPDEVLENLKDAFSIFDVDGNGLITAQELNMVMASLGDA-CSIDECQKMI  122

Query  618  LWVD  629
              VD
Sbjct  123  AGVD  126



>ref|XP_009403239.1| PREDICTED: calmodulin-like protein 3 [Musa acuminata subsp. malaccensis]
Length=150

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 74/123 (60%), Gaps = 3/123 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            +EL + F++ DR+ DG I K EL+  L  +G   P  EEL  M+ ++D +GDGC+ +EEF
Sbjct  4    SELKRVFQMFDRNGDGSITKTELQDSLKNLGIHIPE-EELASMIEKIDVNGDGCVDMEEF  62

Query  447  SVLSSAFAPP-SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMIL  620
              L  A       D ++ +AF+ FD + DG I+ EEL  V  ++G  +  T+EDCRRMI 
Sbjct  63   GTLYQAIMDERDEDEDMLEAFNVFDQNGDGFITVEELRTVLGSLGLKQGRTVEDCRRMIS  122

Query  621  WVD  629
             VD
Sbjct  123  KVD  125



>ref|XP_002962635.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
 gb|EFJ36098.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
Length=140

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 71/123 (58%), Gaps = 5/123 (4%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAE---PPSREELRLMLSEVDRDGDGCISLE  440
            EL   F+L D + DG+I   EL A+L  +      PP+ EEL  M+ EVD DGDG ISL+
Sbjct  1    ELEAVFRLFDANGDGRISVSELGAVLKCLAMGNDPPPTEEELHKMVEEVDADGDGFISLD  60

Query  441  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
            EF  L       +  +EL+ AF  FD D +G ISA+EL  V   +G+   T+EDC RMI 
Sbjct  61   EF--LHFHAQSTASVAELKAAFYVFDLDRNGFISADELHRVLVGLGEVNLTMEDCGRMIR  118

Query  621  WVD  629
             VD
Sbjct  119  GVD  121



>ref|XP_003552973.1| PREDICTED: calcium-binding protein CML24-like isoform 1 [Glycine 
max]
Length=139

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D++ DGKI   EL+ +++ +G++  S +E++ M++E+DR+GDG I L+EF 
Sbjct  5    EVRKIFSKFDKNGDGKISCAELKEMMAALGSKTTS-DEVKRMMAELDRNGDGYIDLKEFG  63

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  64   EFHCGGGGDG--RELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  120



>gb|ABK26031.1| unknown [Picea sitchensis]
Length=194

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLEEF 
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLEEFI  109

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++      +C  +L++AF  FD D +G ISA+EL+ V K +GD   + EDC+ MI  V
Sbjct  110  DLNTKGNDKAACLEDLKNAFKVFDLDRNGSISADELYQVLKGMGDG-SSREDCQNMITGV  168

Query  627  D  629
            D
Sbjct  169  D  169



>ref|XP_009414956.1| PREDICTED: probable calcium-binding protein CML15 [Musa acuminata 
subsp. malaccensis]
Length=180

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 70/121 (58%), Gaps = 2/121 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
              L + F   D + DGKI   EL  +L  +G + PS EEL  M+ E D DGDG ISL EF
Sbjct  29   GNLERVFNKFDSNGDGKISSAELADVLESLGGQRPSEEELGRMMREADADGDGFISLAEF  88

Query  447  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
              L+++  P + + +LR AF  FD D  G ISA+E+  V + IG+   ++  CRRMI  V
Sbjct  89   VELNTS-PPAAVEEDLRLAFAVFDLDRSGAISADEIARVLRGIGEG-ASVAQCRRMIDGV  146

Query  627  D  629
            D
Sbjct  147  D  147



>ref|XP_010033692.1| PREDICTED: probable calcium-binding protein CML27 [Eucalyptus 
grandis]
 gb|KCW84060.1| hypothetical protein EUGRSUZ_B00943 [Eucalyptus grandis]
Length=171

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL + F   D + DGKI   EL  +L+ +G+  P  E+L   ++E+D DGDG ISL EF+
Sbjct  33   ELRKVFDQFDANGDGKISASELSQVLAAMGSAVPP-EDLDRAMAEIDADGDGFISLPEFA  91

Query  450  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             L  +   PS D++LRDAFD +D D +G ISA EL  V   +    C++EDC RMI  VD
Sbjct  92   GLCRS--GPSPDADLRDAFDLYDQDRNGLISAAELHLVLNRLS-MNCSVEDCARMIKSVD  148



>ref|XP_008229213.1| PREDICTED: probable calcium-binding protein CML23 [Prunus mume]
Length=161

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
 Frame = +3

Query  258  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  437
            G   +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  24   GSREQLETIFNKFDKNGDGKISCDELRDVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83

Query  438  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  617
             EF+ + +  +      ELRDAFD +D D +G ISA EL  V K +G  +C+ +DC +MI
Sbjct  84   LEFAEIMNGGSSQ----ELRDAFDLYDLDKNGLISASELHEVMKRLG-LKCSHQDCVKMI  138

Query  618  LWVD  629
              VD
Sbjct  139  RNVD  142



>gb|KFK44513.1| hypothetical protein AALP_AA1G266400 [Arabis alpina]
Length=194

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +E+ A+++ +G E P  E L+  ++E+D+ GDG I+ EEF 
Sbjct  40   ELEAVFKKFDVNGDGKISSKEIGAIMTSLGHEVP-EELLQKAITEIDQKGDGYINFEEFV  98

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  99   ELNTKGMDQDDVLENLKDAFSVYDIDGNGSISAEELHQVLRSLGD-ECSIAECRKMIGGV  157

Query  627  D  629
            D
Sbjct  158  D  158



>ref|XP_006402687.1| hypothetical protein EUTSA_v10006367mg [Eutrema salsugineum]
 gb|ESQ44140.1| hypothetical protein EUTSA_v10006367mg [Eutrema salsugineum]
Length=201

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             +L + F++ D++ DG+I KEEL   L  +G   P ++ ++ M+ ++D +GDGC+ + EF
Sbjct  52   VDLKRVFQMFDKNGDGRITKEELNDSLENLGIFMPEKDLIQ-MIQKMDANGDGCVDIHEF  110

Query  447  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMILW  623
              L S+      D ++RDAF+ FD D DG I+ EEL +V  ++G  +  TLE C+ MI  
Sbjct  111  ESLYSSIVEEKVDEDMRDAFNVFDQDGDGYITVEELKSVMASLGLKQGKTLECCKDMITQ  170

Query  624  VD  629
            VD
Sbjct  171  VD  172



>ref|XP_006365410.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=154

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+++EF+
Sbjct  17   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINIDEFA  75

Query  450  -VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
                +  +      EL++AFD +D DH+G+ISA EL  +   +G   CT++DC RMI  V
Sbjct  76   DFCKNDDSVDGGAKELKEAFDLYDQDHNGRISATELHQILNRLG-QNCTIQDCTRMITSV  134

Query  627  D  629
            D
Sbjct  135  D  135



>ref|XP_009797345.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
sylvestris]
Length=189

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 87/155 (56%), Gaps = 11/155 (7%)
 Frame = +3

Query  180  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  359
            KK   ++      P ++   S +  + +  EL Q FK  D + DGKI   EL ++++ +G
Sbjct  11   KKRVAKANNNDPTPVISSSSSINARARIEEELEQVFKKFDVNGDGKICSSELGSIMASLG  70

Query  360  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  524
                + EEL  M+ EVD DGDG I L+EF  L++       DS+     L+DAF  FD D
Sbjct  71   -NAATEEELLNMIREVDADGDGFIDLQEFIELNT----KDVDSDEVLENLKDAFSVFDMD  125

Query  525  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILWVD  629
             +G ISAEEL  V +++G+  C+L +CR+MI  VD
Sbjct  126  KNGSISAEELQTVLRSLGED-CSLAECRKMISGVD  159


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  273  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  452
            L  AF + D D +G I  EEL+ +L  +G E  S  E R M+S VD DGDG I+ EEF V
Sbjct  115  LKDAFSVFDMDKNGSISAEELQTVLRSLG-EDCSLAECRKMISGVDCDGDGMINFEEFKV  173

Query  453  L  455
            +
Sbjct  174  M  174



>ref|XP_011079925.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AE  +AF LID+D DG I  EEL +++  +  E P+ EE++ M+SEVD DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEELTSVMQSLN-EHPTMEEIQEMVSEVDGDGDGTVDFEEF  69

Query  447  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
              + +     +   EL++AF  FD D DG ISA EL NV   +G+ R + E+  +MI   
Sbjct  70   LGIMARKMKENVGEELKEAFKVFDRDQDGFISAIELKNVMINLGE-RVSDEEAEQMIREA  128

Query  627  D  629
            D
Sbjct  129  D  129


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            EL +AFK+ DRD DG I   EL+ ++  +G E  S EE   M+ E D DGDG +S EEF
Sbjct  84   ELKEAFKVFDRDQDGFISAIELKNVMINLG-ERVSDEEAEQMIREADVDGDGVVSYEEF  141



>emb|CDY24421.1| BnaCnng04880D [Brassica napus]
Length=271

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            EL   FK  D + DGKI  +EL A+++ +G E P  E L+  ++++DR GDG I+ EEF 
Sbjct  122  ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEVLQKAITDIDRKGDGYINFEEFV  180

Query  450  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILWV  626
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI  V
Sbjct  181  ELNTKGMDQNEVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  239

Query  627  D  629
            D
Sbjct  240  D  240



>ref|XP_002980456.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
 gb|EFJ18716.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
Length=140

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 71/123 (58%), Gaps = 5/123 (4%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAE---PPSREELRLMLSEVDRDGDGCISLE  440
            EL   F+L D + DG+I   EL A+L  +      PP+ EEL  M+ EVD DGDG ISL+
Sbjct  1    ELEAVFRLFDANGDGRISVSELGAVLKCLAMGNDPPPTEEELLKMVEEVDADGDGFISLD  60

Query  441  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  620
            EF  L       +  +EL+ AF  FD D +G ISA+EL  V   +G+   T+EDC RMI 
Sbjct  61   EF--LHFHAQSTASVAELKAAFYVFDLDRNGFISADELHRVLVGLGEVNLTMEDCGRMIR  118

Query  621  WVD  629
             VD
Sbjct  119  GVD  121



>ref|XP_004142374.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN52351.1| hypothetical protein Csa_5G627080 [Cucumis sativus]
Length=185

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 3/122 (2%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
             EL + FK  D + DGKI   EL +++  +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   TELEEVFKKFDVNGDGKISSAELGSIMRSLG-HNATEEELGKMIDEFDADGDGFINLHEF  99

Query  447  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILW  623
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI  
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLQSLGDD-CSVADCRQMISG  158

Query  624  VD  629
            VD
Sbjct  159  VD  160


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +3

Query  234  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  413
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLQSLG-DDCSVADCRQMISGVDS  161

Query  414  DGDGCISLEEFSVLSSA  464
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>gb|KJB15360.1| hypothetical protein B456_002G172400 [Gossypium raimondii]
Length=197

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 75/125 (60%), Gaps = 11/125 (9%)
 Frame = +3

Query  270  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  449
            E+ + FK  D + DGKI   EL +++  +G + PS EEL  M+ E D DGDG I+  EF 
Sbjct  46   EIEEVFKKFDANGDGKISASELGSIMKSLG-QQPSDEELHNMIKEFDADGDGFINFNEFI  104

Query  450  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  614
             L++       DSE     L+DAF  +D D +G ISAEEL  V K++G+  C++ +CR+M
Sbjct  105  ELNT----KGVDSEEVLENLKDAFSVYDIDGNGWISAEELHEVLKSLGE-ECSIAECRKM  159

Query  615  ILWVD  629
            I  VD
Sbjct  160  ISGVD  164



>ref|XP_003580040.2| PREDICTED: probable calcium-binding protein CML22 [Brachypodium 
distachyon]
Length=265

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 17/137 (12%)
 Frame = +3

Query  267  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  446
            AEL + F+L+DR+ DG+I +EELE  L ++G   P  +EL  M++ +D DGDGC+  EEF
Sbjct  105  AELSRVFQLLDRNGDGRITREELEDCLGKLGIPVPG-DELAAMIARIDADGDGCVDEEEF  163

Query  447  SVLSSAFAPPSC---------------DSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  581
              L  A                     D ++R+AF  FD + DG I+ EEL  V  ++G 
Sbjct  164  GELYRAIMSTGGGEDEEKKGGDEGVEEDEDMREAFRVFDANGDGYITVEELGAVLASLGL  223

Query  582  SRC-TLEDCRRMILWVD  629
             +  T E+CRRMI  VD
Sbjct  224  KQGRTAEECRRMIGQVD  240



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875