BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028C21

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010088401.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    238   8e-74   
ref|XP_003535857.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    238   2e-73   Glycine max [soybeans]
ref|XP_003518108.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    237   7e-73   Glycine max [soybeans]
emb|CDP10072.1|  unnamed protein product                                234   8e-73   Coffea canephora [robusta coffee]
ref|XP_004513649.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    237   8e-73   Cicer arietinum [garbanzo]
ref|XP_006349549.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    234   2e-72   Solanum tuberosum [potatoes]
gb|KDO57199.1|  hypothetical protein CISIN_1g0379582mg                  227   4e-72   Citrus sinensis [apfelsine]
ref|XP_004234840.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    232   5e-72   Solanum lycopersicum
gb|KEH41602.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase-li...    234   1e-71   Medicago truncatula
ref|XP_007145631.1|  hypothetical protein PHAVU_007G255300g             233   1e-71   Phaseolus vulgaris [French bean]
ref|XP_009618579.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    231   2e-71   Nicotiana tomentosiformis
ref|XP_010257310.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    230   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006421451.1|  hypothetical protein CICLE_v10005148mg             228   1e-70   
ref|XP_009767064.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    227   2e-70   Nicotiana sylvestris
ref|XP_002323308.2|  hypothetical protein POPTR_0016s05340g             231   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004307568.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    230   3e-70   Fragaria vesca subsp. vesca
ref|XP_006421453.1|  hypothetical protein CICLE_v10005148mg             228   4e-70   Citrus clementina [clementine]
ref|XP_011033303.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    229   7e-70   Populus euphratica
gb|ABU50327.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase          228   8e-70   Helianthus annuus
gb|AGB05602.1|  sn-glycerol-3-phosphate acyltransferase                 227   2e-69   Camellia oleifera [abura-tsubaki]
ref|XP_006493900.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    225   3e-69   Citrus sinensis [apfelsine]
ref|NP_001105919.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    227   5e-69   Zea mays [maize]
ref|XP_011020321.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    225   5e-69   Populus euphratica
gb|ACN28103.1|  unknown                                                 226   1e-68   Zea mays [maize]
gb|AGO14580.1|  A-class lysophosphatidate acyltransferase 2 isofo...    226   1e-68   Echium pitardii
ref|NP_001148618.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    226   1e-68   Zea mays [maize]
ref|XP_004979811.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    225   2e-68   Setaria italica
ref|XP_002308046.1|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...    224   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002451179.1|  hypothetical protein SORBIDRAFT_05g025420          225   2e-68   Sorghum bicolor [broomcorn]
ref|XP_006402859.1|  hypothetical protein EUTSA_v10006028mg             225   3e-68   Eutrema salsugineum [saltwater cress]
gb|AGO14579.1|  A-class lysophosphatidate acyltransferase 2 isofo...    224   4e-68   Echium pitardii
gb|ABP93351.1|  lysophosphatidyl acyltransferase 2                      224   5e-68   Helianthus annuus
ref|XP_010524157.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    224   5e-68   Tarenaya hassleriana [spider flower]
emb|CAA88620.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase (...    224   6e-68   Limnanthes douglasii
ref|XP_009116469.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    224   6e-68   Brassica rapa
gb|ADC97478.1|  lysophosphatidic acid acyltransferase                   224   6e-68   Brassica napus [oilseed rape]
sp|Q6IWY1.1|LPAT2_BRAOL  RecName: Full=1-acyl-sn-glycerol-3-phosp...    224   7e-68   Brassica oleracea
gb|ADC97479.1|  lysophosphatidic acid acyltransferase                   224   7e-68   Brassica napus [oilseed rape]
emb|CDY33810.1|  BnaCnng07280D                                          224   9e-68   Brassica napus [oilseed rape]
ref|XP_009104068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    223   1e-67   Brassica rapa
gb|ABN09946.1|  lysophosphatidyl acyltransferase                        223   2e-67   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
emb|CAN83214.1|  hypothetical protein VITISV_038716                     220   2e-67   Vitis vinifera
gb|AAM61033.1|  1-acylcerol-3-phosphate acyltransferase-like protein    223   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567052.1|  lysophosphatidyl acyltransferase 2                    223   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002283340.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    220   3e-67   Vitis vinifera
ref|XP_009387255.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    222   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002876428.1|  hypothetical protein ARALYDRAFT_907235             222   5e-67   Arabidopsis lyrata subsp. lyrata
sp|Q9XFW4.1|LPAT2_BRANA  RecName: Full=1-acyl-sn-glycerol-3-phosp...    222   5e-67   Brassica napus [oilseed rape]
gb|ABM92334.2|  1-acylglycerol-3-phosphate acyltransferase              222   6e-67   Brassica juncea [brown mustard]
dbj|BAJ84894.1|  predicted protein                                      221   6e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK35010.1|  hypothetical protein AALP_AA5G222500                    221   8e-67   Arabis alpina [alpine rockcress]
ref|XP_008392182.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    216   2e-66   
ref|XP_010516385.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    220   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010504698.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    220   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010554846.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    220   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_003521190.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    215   3e-66   Glycine max [soybeans]
ref|XP_006293344.1|  hypothetical protein CARUB_v100174200mg            218   6e-66   
ref|XP_009345032.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    214   7e-66   Pyrus x bretschneideri [bai li]
ref|XP_009414749.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    218   7e-66   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX67700.1|  BnaA07g17400D                                          219   8e-66   
ref|XP_003575968.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    217   2e-65   Brachypodium distachyon [annual false brome]
gb|KCW90238.1|  hypothetical protein EUGRSUZ_A02397                     210   4e-65   Eucalyptus grandis [rose gum]
ref|XP_003554183.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    214   4e-65   Glycine max [soybeans]
ref|XP_010057561.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    210   4e-65   Eucalyptus grandis [rose gum]
ref|XP_011078878.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    213   5e-65   Sesamum indicum [beniseed]
gb|KCW90239.1|  hypothetical protein EUGRSUZ_A02397                     209   5e-65   Eucalyptus grandis [rose gum]
ref|XP_007162250.1|  hypothetical protein PHAVU_001G136600g             213   6e-65   Phaseolus vulgaris [French bean]
ref|XP_009334964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    213   1e-64   Pyrus x bretschneideri [bai li]
gb|EYU20729.1|  hypothetical protein MIMGU_mgv1a008164mg                211   2e-64   Erythranthe guttata [common monkey flower]
ref|NP_001280186.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    211   2e-64   Prunus mume [ume]
ref|XP_010265751.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    214   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_011075205.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    209   4e-64   Sesamum indicum [beniseed]
emb|CDX88957.1|  BnaA04g02290D                                          214   4e-64   
gb|KDP37345.1|  hypothetical protein JCGZ_06799                         209   6e-64   Jatropha curcas
gb|AEZ56251.1|  plastid 1-acylglycerol-phosphate acyltransferase        209   6e-64   Jatropha curcas
ref|XP_007202144.1|  hypothetical protein PRUPE_ppa007002mg             210   7e-64   Prunus persica
ref|XP_004249199.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    207   1e-63   Solanum lycopersicum
ref|XP_009387254.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    212   1e-63   
ref|XP_004493527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    208   1e-63   Cicer arietinum [garbanzo]
ref|XP_010312077.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    206   2e-63   
ref|XP_006351222.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    209   2e-63   Solanum tuberosum [potatoes]
ref|XP_006852430.1|  hypothetical protein AMTR_s00021p00084240          206   4e-63   Amborella trichopoda
ref|XP_003597431.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     211   4e-63   
gb|ACV73676.1|  lysophosphatidic acid acyltransferase 2                 204   6e-63   Tropaeolum majus
ref|XP_003625176.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     206   7e-63   Medicago truncatula
gb|AFK40266.1|  unknown                                                 206   7e-63   Medicago truncatula
gb|KJB16432.1|  hypothetical protein B456_002G230000                    205   7e-63   Gossypium raimondii
ref|XP_002894307.1|  hypothetical protein ARALYDRAFT_474240             209   9e-63   
gb|KCW90236.1|  hypothetical protein EUGRSUZ_A02397                     202   9e-63   Eucalyptus grandis [rose gum]
gb|KJB16430.1|  hypothetical protein B456_002G230000                    205   1e-62   Gossypium raimondii
gb|KJB16434.1|  hypothetical protein B456_002G230000                    204   1e-62   Gossypium raimondii
gb|KJB36055.1|  hypothetical protein B456_006G138600                    205   1e-62   Gossypium raimondii
ref|XP_004486964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    210   1e-62   
ref|XP_009139024.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    210   1e-62   Brassica rapa
gb|KJB36056.1|  hypothetical protein B456_006G138600                    205   1e-62   Gossypium raimondii
gb|KJB16435.1|  hypothetical protein B456_002G230000                    204   1e-62   Gossypium raimondii
ref|XP_004486963.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    210   2e-62   Cicer arietinum [garbanzo]
ref|XP_008443106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    204   2e-62   Cucumis melo [Oriental melon]
ref|XP_004165747.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    203   2e-62   
gb|KFK35863.1|  hypothetical protein AALP_AA4G046700                    208   2e-62   Arabis alpina [alpine rockcress]
ref|XP_004136588.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    203   3e-62   Cucumis sativus [cucumbers]
gb|KJB16433.1|  hypothetical protein B456_002G230000                    203   3e-62   Gossypium raimondii
emb|CDP18472.1|  unnamed protein product                                206   5e-62   Coffea canephora [robusta coffee]
ref|NP_175537.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 3      208   5e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04120.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 2        202   6e-62   Gossypium arboreum [tree cotton]
ref|XP_002894308.1|  hypothetical protein ARALYDRAFT_892094             206   7e-62   
ref|XP_010479592.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    207   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_011006208.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    203   2e-61   Populus euphratica
gb|KHN33345.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 3        207   2e-61   Glycine soja [wild soybean]
ref|XP_003547001.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    207   2e-61   Glycine max [soybeans]
ref|XP_008227141.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    204   2e-61   Prunus mume [ume]
ref|XP_011006207.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    203   2e-61   Populus euphratica
gb|ABA94922.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase PL...    203   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011006209.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    203   2e-61   Populus euphratica
gb|EEC68515.1|  hypothetical protein OsI_36790                          202   3e-61   Oryza sativa Indica Group [Indian rice]
gb|EEE52425.1|  hypothetical protein OsJ_34550                          202   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002298406.2|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...    200   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010461958.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    206   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010237505.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    202   4e-61   Brachypodium distachyon [annual false brome]
ref|XP_008813484.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    201   4e-61   Phoenix dactylifera
ref|XP_003577308.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    202   5e-61   Brachypodium distachyon [annual false brome]
gb|AHC70248.1|  lysophosphatidic acid acyltransferase                   200   5e-61   Sterculia foetida
ref|XP_007150370.1|  hypothetical protein PHAVU_005G147900g             206   5e-61   Phaseolus vulgaris [French bean]
ref|XP_006663068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    201   6e-61   Oryza brachyantha
ref|XP_009395596.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    201   8e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008813483.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    201   8e-61   Phoenix dactylifera
ref|XP_004503603.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    205   2e-60   Cicer arietinum [garbanzo]
ref|XP_010673624.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    203   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006304715.1|  hypothetical protein CARUB_v10012002mg             202   3e-60   Capsella rubella
ref|XP_003636648.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     197   3e-60   
gb|EPS68644.1|  lysophosphatidic acid acyltransferase                   203   4e-60   Genlisea aurea
ref|XP_010500700.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    202   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010672763.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    202   1e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|ADE75797.1|  unknown                                                 196   1e-59   Picea sitchensis
ref|XP_010102333.1|  Xanthine dehydrogenase                             190   5e-59   
ref|XP_010031802.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    195   8e-59   Eucalyptus grandis [rose gum]
ref|XP_006597258.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    202   9e-59   Glycine max [soybeans]
ref|XP_007028850.1|  Lysophosphatidyl acyltransferase 2                 194   3e-58   
ref|XP_002526730.1|  lysophosphatidic acid acyltransferase, putative    194   4e-58   
ref|XP_010909860.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    197   8e-58   
ref|XP_002513487.1|  lysophosphatidic acid acyltransferase, putative    189   2e-57   Ricinus communis
ref|XP_010906759.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    191   2e-57   Elaeis guineensis
ref|XP_011080283.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    189   2e-57   Sesamum indicum [beniseed]
ref|XP_006393066.1|  hypothetical protein EUTSA_v10011593mg             190   6e-57   
ref|XP_008801931.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    189   6e-57   
ref|XP_008801930.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    189   1e-56   Phoenix dactylifera
ref|XP_009375057.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    186   1e-56   
ref|XP_002443267.1|  hypothetical protein SORBIDRAFT_08g016610          189   2e-56   Sorghum bicolor [broomcorn]
emb|CDY65469.1|  BnaA08g29540D                                          192   7e-56   Brassica napus [oilseed rape]
ref|XP_006470598.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    183   1e-55   Citrus sinensis [apfelsine]
ref|XP_006446109.1|  hypothetical protein CICLE_v10015539mg             183   1e-55   Citrus clementina [clementine]
ref|XP_006361745.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    192   2e-55   Solanum tuberosum [potatoes]
ref|XP_010545584.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    188   2e-55   
ref|XP_004250948.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    191   2e-55   
ref|XP_007015031.1|  Lysophosphatidyl acyltransferase 3                 181   3e-55   
ref|XP_007214575.1|  hypothetical protein PRUPE_ppa019921mg             182   8e-55   
emb|CDY35563.1|  BnaC05g27180D                                          185   1e-54   Brassica napus [oilseed rape]
emb|CDY03631.1|  BnaC03g68900D                                          188   3e-54   
ref|XP_009144912.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    184   4e-54   Brassica rapa
ref|XP_004139036.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    186   4e-54   Cucumis sativus [cucumbers]
ref|XP_008363711.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    181   1e-53   
ref|XP_008377433.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    180   2e-53   Malus domestica [apple tree]
ref|XP_008450418.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    181   2e-53   Cucumis melo [Oriental melon]
ref|XP_002268451.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    179   7e-53   Vitis vinifera
ref|XP_006470599.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   9e-53   Citrus sinensis [apfelsine]
emb|CBI21663.3|  unnamed protein product                                179   1e-52   Vitis vinifera
ref|XP_001754626.1|  predicted protein                                  187   2e-52   
ref|XP_009615949.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    179   2e-52   Nicotiana tomentosiformis
ref|XP_010673625.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    176   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009773917.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    177   5e-52   Nicotiana sylvestris
gb|EYU46266.1|  hypothetical protein MIMGU_mgv1a026523mg                180   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_004486965.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   1e-50   
ref|XP_007212911.1|  hypothetical protein PRUPE_ppa022232mg             177   5e-50   Prunus persica
ref|XP_001764965.1|  predicted protein                                  177   6e-50   
emb|CDY52093.1|  BnaC04g55420D                                          163   9e-49   Brassica napus [oilseed rape]
ref|XP_002986838.1|  hypothetical protein SELMODRAFT_124776             169   2e-47   Selaginella moellendorffii
ref|XP_007015028.1|  Lysophosphatidyl acyltransferase 2, putative...    170   2e-47   
gb|EMT23643.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1     159   2e-47   
ref|XP_002969275.1|  hypothetical protein SELMODRAFT_146320             169   2e-47   
ref|XP_008227143.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   2e-46   Prunus mume [ume]
ref|XP_006493899.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    149   2e-46   
ref|XP_006421452.1|  hypothetical protein CICLE_v10005148mg             147   1e-45   
ref|XP_002513486.1|  1-acylglycerol-3-phosphate acyltransferase, ...    160   4e-45   Ricinus communis
gb|EMS63864.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1     151   6e-45   Triticum urartu
gb|AAF20003.1|AF213937_1  1-acyl-sn-glycerol-3-phosphate acyltran...    139   1e-42   Prunus dulcis [sweet almond]
gb|KJB16431.1|  hypothetical protein B456_002G230000                    136   4e-42   Gossypium raimondii
tpg|DAA42326.1|  TPA: hypothetical protein ZEAMMB73_334173              137   7e-42   
ref|XP_007015027.1|  Lysophosphatidyl acyltransferase 2, putative...    154   8e-42   
gb|AFW60270.1|  hypothetical protein ZEAMMB73_783506                    137   9e-42   
gb|ACU18782.1|  unknown                                                 133   9e-42   Glycine max [soybeans]
gb|KCW51192.1|  hypothetical protein EUGRSUZ_J00779                     133   2e-40   Eucalyptus grandis [rose gum]
ref|XP_002314068.2|  hypothetical protein POPTR_0009s05930g             145   3e-39   
gb|EYU39879.1|  hypothetical protein MIMGU_mgv1a010933mg                127   5e-39   Erythranthe guttata [common monkey flower]
ref|XP_011025520.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    142   2e-38   Populus euphratica
ref|XP_011025521.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    142   2e-38   Populus euphratica
ref|XP_006446108.1|  hypothetical protein CICLE_v10015539mg             123   1e-37   
gb|KDO61278.1|  hypothetical protein CISIN_1g016254mg                   123   1e-37   Citrus sinensis [apfelsine]
ref|XP_008363635.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    119   4e-37   
gb|AAP80656.1|AF479037_1  1-acy1-glycerol-3-phosphate acyltransfe...    124   6e-37   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001068336.2|  Os11g0637800                                       132   1e-35   
gb|KHG13155.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 2 ...    129   5e-35   Gossypium arboreum [tree cotton]
ref|XP_008337106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   3e-34   
ref|XP_010672762.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    133   5e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002590323.1|  hypothetical protein BRAFLDRAFT_121375             127   3e-31   Branchiostoma floridae
ref|XP_001621942.1|  predicted protein                                  116   3e-31   Nematostella vectensis
ref|XP_010366228.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   5e-30   Rhinopithecus roxellana
gb|KDP22082.1|  hypothetical protein JCGZ_25913                         114   6e-30   Jatropha curcas
ref|XP_003927614.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   6e-30   Saimiri boliviensis boliviensis
ref|XP_006608633.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   6e-30   Apis dorsata [rock honeybee]
ref|XP_008985009.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   7e-30   
gb|KFZ60093.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    117   8e-30   Podiceps cristatus
ref|XP_010366226.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   8e-30   Rhinopithecus roxellana
ref|XP_006724095.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   1e-29   
ref|XP_005261216.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   1e-29   
ref|XP_003823897.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   1e-29   Pan paniscus [bonobo]
ref|XP_003277406.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   2e-29   
ref|XP_011143319.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   2e-29   Harpegnathos saltator
ref|NP_064517.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    114   2e-29   Homo sapiens [man]
ref|XP_001146797.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   2e-29   Pan troglodytes
ref|XP_006608632.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   2e-29   Apis dorsata [rock honeybee]
ref|NP_001127407.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    114   2e-29   Pongo abelii [orang utan]
ref|XP_003689806.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    122   2e-29   Apis florea [dwarf honeybee]
gb|KDR11829.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    122   2e-29   Zootermopsis nevadensis
gb|AAQ89067.1|  AGPAT3                                                  114   2e-29   Homo sapiens [man]
ref|XP_001849976.1|  1-acylglycerol-3-phosphate acyltransferase         119   2e-29   Culex quinquefasciatus
dbj|BAG62268.1|  unnamed protein product                                114   2e-29   Homo sapiens [man]
ref|XP_001944534.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    122   2e-29   Acyrthosiphon pisum
ref|XP_011161524.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   2e-29   Solenopsis invicta [imported red fire ant]
ref|XP_011261943.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   3e-29   Camponotus floridanus
ref|XP_003798130.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   3e-29   Otolemur garnettii
gb|EFN64501.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    117   4e-29   Camponotus floridanus
ref|XP_003705225.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   4e-29   Megachile rotundata
ref|XP_001607215.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    118   5e-29   
ref|XP_008545546.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   5e-29   Microplitis demolitor
gb|EFZ17110.1|  hypothetical protein SINV_05410                         117   5e-29   
ref|XP_011338106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   6e-29   Ooceraea biroi
ref|XP_005323500.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   1e-28   Ictidomys tridecemlineatus
gb|EZA54711.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    117   1e-28   Ooceraea biroi
ref|XP_003962129.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   1e-28   Takifugu rubripes [tiger puffer]
gb|AAI58874.1|  Agpat3 protein                                          112   1e-28   Rattus norvegicus [brown rat]
ref|NP_001099848.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    112   1e-28   Rattus norvegicus [brown rat]
ref|XP_004410719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   1e-28   Odobenus rosmarus divergens
ref|XP_004264654.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   2e-28   Orcinus orca [Orca]
ref|XP_001745510.1|  hypothetical protein                               109   2e-28   Monosiga brevicollis MX1
ref|XP_007452559.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   2e-28   Lipotes vexillifer [baiji]
ref|XP_008565934.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-28   Galeopterus variegatus [Malayan flying lemur]
gb|AGG54998.1|  acyltransferase AGPAT6                                  119   3e-28   Heliothis virescens
ref|XP_008498571.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    119   3e-28   Calypte anna
ref|XP_003419084.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    119   4e-28   Loxodonta africana [African bush elephant]
ref|XP_008275417.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   5e-28   Stegastes partitus
gb|EFX74227.1|  hypothetical protein DAPPUDRAFT_200081                  112   5e-28   Daphnia pulex
emb|CAX11992.1|  1-acylglycerol-3-phosphate O-acyltransferase 3         112   6e-28   Danio rerio [leopard danio]
ref|NP_998590.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    112   6e-28   Danio rerio [leopard danio]
ref|XP_008939552.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   7e-28   Merops nubicus
ref|XP_001654527.1|  AAEL010399-PA                                      113   7e-28   
ref|XP_005907644.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    118   8e-28   Bos mutus
ref|XP_006060833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    118   8e-28   
ref|XP_011055419.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   8e-28   Acromyrmex echinatior
gb|AGG55014.1|  acyltransferase AGPAT6                                  118   9e-28   Heliothis subflexa
ref|XP_010833202.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   9e-28   Bison bison bison
ref|XP_011498819.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   9e-28   Ceratosolen solmsi marchali
ref|XP_010739293.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   1e-27   
ref|XP_416756.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    117   1e-27   Gallus gallus [bantam]
gb|AIN34698.1|  fatty alcohol acetyltransferase                         117   1e-27   Agrotis segetum
ref|XP_005956861.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   1e-27   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004931957.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   1e-27   
ref|XP_009071880.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   1e-27   Acanthisitta chloris
ref|XP_006109547.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   1e-27   
ref|XP_001664249.1|  AAEL014026-PA                                      112   1e-27   
ref|XP_005675712.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   1e-27   
ref|XP_004003424.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   1e-27   
ref|XP_004931956.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   1e-27   Bombyx mori [silk moth]
ref|XP_007251394.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   1e-27   Astyanax mexicanus [blind cave fish]
gb|ADO27983.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    113   2e-27   Ictalurus furcatus
ref|XP_002189743.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   2e-27   Taeniopygia guttata
ref|XP_008631063.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   2e-27   
ref|XP_008320056.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    109   2e-27   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005745742.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-27   Pundamilia nyererei
ref|XP_010722493.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   2e-27   Meleagris gallopavo [common turkey]
ref|XP_008327138.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-27   
ref|XP_010127144.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   2e-27   
ref|XP_004575514.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-27   
gb|EFX76870.1|  hypothetical protein DAPPUDRAFT_198783                  114   2e-27   
ref|NP_001008119.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    110   2e-27   
ref|NP_001087659.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     110   2e-27   
ref|XP_007426401.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    117   2e-27   
ref|XP_004602547.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   2e-27   
ref|XP_005919380.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-27   
ref|XP_011311483.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   2e-27   
ref|XP_009996223.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   2e-27   
ref|XP_009472604.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   2e-27   
ref|XP_005501703.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   2e-27   
ref|XP_006799219.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-27   
gb|KFV99739.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    116   2e-27   
ref|XP_009489719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   2e-27   
ref|XP_003445368.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-27   
emb|CAA90019.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase       90.1    3e-27   
ref|XP_009639322.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_010159792.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_007064498.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_010011299.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|NP_001033135.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    116   3e-27   
ref|XP_005012527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_009985430.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_005151770.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_009904113.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_009057171.1|  hypothetical protein LOTGIDRAFT_121393             110   3e-27   
ref|XP_005234551.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_009877719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
gb|KFP28149.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    115   3e-27   
ref|XP_009930927.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_010073966.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   3e-27   
ref|XP_010206239.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   4e-27   
ref|XP_005037280.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   4e-27   
ref|XP_007128496.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   4e-27   
ref|XP_005037288.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   4e-27   
ref|XP_007172727.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   4e-27   
ref|XP_005427279.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   4e-27   
ref|NP_001187438.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    114   4e-27   
ref|XP_006137946.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    116   4e-27   
ref|XP_009087839.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   4e-27   
ref|XP_005489059.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   4e-27   
ref|XP_970017.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    115   5e-27   
emb|CAB41190.1|  1-acylcerol-3-phosphate acyltransferase-like pro...  89.4    5e-27   
ref|XP_011471961.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-27   
gb|ENN81517.1|  hypothetical protein YQE_02046                          111   5e-27   
ref|NP_998157.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    110   5e-27   
ref|XP_004996737.1|  hypothetical protein PTSG_02252                    114   5e-27   
ref|XP_004696957.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   6e-27   
ref|XP_003434035.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    115   6e-27   
ref|XP_006876849.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   6e-27   
gb|ETE66236.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    115   6e-27   
ref|XP_009305745.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    109   7e-27   
ref|XP_308646.4|  AGAP007113-PA                                         113   7e-27   
ref|XP_008931200.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   8e-27   
emb|CDQ68415.1|  unnamed protein product                                109   8e-27   
ref|XP_007015029.1|  Lysophosphatidyl acyltransferase 2, putative...    114   9e-27   
ref|XP_009677833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   9e-27   
ref|XP_005312682.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   1e-26   
ref|XP_005836674.1|  hypothetical protein GUITHDRAFT_67735              109   1e-26   
ref|XP_010217044.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   1e-26   
gb|ETN67995.1|  1-acylglycerol-3-phosphate acyltransferase              115   1e-26   
ref|XP_004651151.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   1e-26   
ref|XP_006639021.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    115   1e-26   
ref|XP_007493273.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   1e-26   
ref|XP_010163464.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   1e-26   
gb|EFX76865.1|  hypothetical protein DAPPUDRAFT_188541                  114   1e-26   
ref|NP_001085041.1|  1-acylglycerol-3-phosphate O-acyltransferase 4     108   1e-26   
ref|XP_003395337.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   2e-26   
ref|XP_010781417.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   2e-26   
ref|XP_006894008.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   2e-26   
ref|XP_004429705.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   2e-26   
ref|XP_011199230.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    114   2e-26   
ref|XP_006877339.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-26   
ref|NP_001279132.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     114   2e-26   
gb|AFM88716.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ga...    114   2e-26   
gb|ELV10335.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    113   2e-26   
ref|XP_010884320.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-26   
ref|XP_007967793.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   3e-26   
ref|XP_006262808.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   3e-26   
ref|XP_005548628.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   3e-26   
ref|NP_001137172.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    113   3e-26   
ref|XP_004384856.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   3e-26   
gb|EHB08231.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    113   4e-26   
gb|KFB43263.1|  AGAP007113-PA-like protein                              110   4e-26   
ref|NP_080920.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    113   4e-26   
ref|XP_003488699.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   4e-26   
gb|EDL02075.1|  1-acylglycerol-3-phosphate O-acyltransferase 1 (l...    113   4e-26   
ref|XP_005992834.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   4e-26   
ref|XP_004842553.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   4e-26   
ref|XP_005111448.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   4e-26   
ref|XP_008105662.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   4e-26   
ref|XP_004892857.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    113   5e-26   
ref|XP_006088912.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   5e-26   
ref|XP_003463996.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   5e-26   
ref|XP_005900476.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    109   5e-26   
ref|NP_596897.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    112   5e-26   
ref|NP_001011265.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    112   6e-26   
ref|XP_010866423.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    106   6e-26   
ref|XP_006227918.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   6e-26   
ref|XP_006169505.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   6e-26   
ref|XP_003991408.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   6e-26   
ref|XP_007945444.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   6e-26   
ref|XP_006010829.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   6e-26   
ref|XP_006978083.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   7e-26   
ref|XP_006275864.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   7e-26   
ref|XP_005375932.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   7e-26   
ref|XP_008572824.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   7e-26   
ref|XP_004842550.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    113   7e-26   
ref|XP_004654569.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   7e-26   
ref|XP_011374681.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   8e-26   
ref|XP_010597152.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   8e-26   
gb|KFO53964.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    109   9e-26   
ref|XP_004702147.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   1e-25   
ref|XP_010138461.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   1e-25   
ref|XP_003215831.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    105   1e-25   
ref|XP_006922611.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   1e-25   
ref|XP_004556060.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_005737162.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_004556061.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_005915527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_008641548.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   1e-25   
ref|XP_006021965.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   1e-25   
ref|XP_010389961.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   1e-25   
ref|XP_010218895.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   1e-25   
ref|XP_010964818.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   1e-25   
ref|XP_008834942.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    112   1e-25   
ref|XP_003964149.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_004556063.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_003503111.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   1e-25   
ref|XP_005915529.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_010082881.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    109   1e-25   
ref|XP_005737161.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   1e-25   
ref|XP_005526983.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   2e-25   
ref|XP_010634747.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
gb|EHJ69411.1|  hypothetical protein KGM_16372                          108   2e-25   
ref|XP_007641874.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
ref|XP_004631856.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
gb|ELK34832.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    111   2e-25   
ref|XP_004480140.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    111   2e-25   
ref|XP_006757783.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
ref|XP_005230336.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   2e-25   
ref|XP_010634754.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
ref|XP_006882885.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
ref|XP_004556062.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   2e-25   
ref|XP_005915528.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   2e-25   
gb|ERE86376.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase de...    111   2e-25   
gb|KFW82364.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   2e-25   
ref|XP_005973237.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-25   
ref|XP_005737160.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    104   2e-25   
gb|KFV88186.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   2e-25   
ref|XP_005880486.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
ref|XP_006175309.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   2e-25   
ref|XP_006099969.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    111   2e-25   
gb|EPY88109.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ga...    111   2e-25   
ref|XP_002030766.1|  GM24405                                            108   2e-25   
ref|XP_001957018.1|  GF10214                                            108   2e-25   
ref|XP_003441050.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    103   2e-25   
ref|XP_009083431.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   3e-25   
gb|KFP74586.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   3e-25   
ref|XP_009686661.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   3e-25   
ref|XP_008261974.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_009893833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   3e-25   
ref|XP_005443156.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    108   3e-25   
ref|XP_006759048.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_003419277.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_005321486.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_001491027.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_006746103.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_003763398.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_009319030.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   3e-25   
ref|XP_011196051.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
ref|XP_008923849.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   3e-25   
ref|XP_009938658.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   3e-25   
ref|XP_009980716.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   3e-25   
ref|XP_010582782.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   3e-25   
gb|KFQ87757.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   3e-25   
gb|KFV14158.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   3e-25   
ref|XP_006038517.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   3e-25   
gb|KFR15276.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   3e-25   
ref|XP_006915102.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   3e-25   
ref|XP_009469458.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   4e-25   
ref|XP_005363432.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   4e-25   
ref|XP_009288284.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   4e-25   
ref|XP_007546255.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    105   4e-25   
ref|XP_006800842.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    103   4e-25   
ref|XP_007943472.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   4e-25   
ref|XP_004935617.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   4e-25   
gb|KFZ68512.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   4e-25   
ref|XP_419616.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    107   4e-25   
gb|KFQ91658.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   4e-25   
ref|XP_008708403.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   4e-25   
ref|XP_009806874.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    108   4e-25   
ref|XP_008488411.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   4e-25   
ref|XP_008143886.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   4e-25   
gb|EOB03997.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    108   4e-25   
ref|XP_005181709.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    108   4e-25   
ref|XP_005015963.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   4e-25   
ref|XP_004011492.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   4e-25   
ref|XP_005474100.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    103   4e-25   
ref|XP_006638831.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   4e-25   
ref|XP_005416320.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    107   4e-25   
ref|XP_005685014.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   
ref|XP_008055094.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    110   5e-25   
ref|XP_004762311.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   
ref|XP_011196059.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   
ref|XP_008428104.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    105   5e-25   
ref|XP_006043131.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   
gb|AAX08708.1|  1-acylglycerol-3-phosphate O-acyltransferase 4 (l...    110   5e-25   
sp|Q5E9R2.1|PLCD_BOVIN  RecName: Full=1-acyl-sn-glycerol-3-phosph...    110   5e-25   
ref|XP_005685015.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   
ref|NP_001015537.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    109   5e-25   
ref|XP_005211156.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   
ref|NP_001246793.1|  CG4729, isoform E                                  107   5e-25   
ref|XP_005305778.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   5e-25   
ref|NP_648888.1|  CG4729, isoform A                                     107   5e-25   
ref|XP_004011493.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    109   5e-25   
ref|XP_009089786.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    107   5e-25   
ref|XP_008058314.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   
ref|XP_007665415.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    110   5e-25   



>ref|XP_010088401.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
 gb|EXB35416.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
Length=528

 Score =   238 bits (608),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQAIC+V+IRP SKSTYRRINR+ AELLWLELVW++DWWAGVK+QLYTD +TF LMGK
Sbjct  164  NLIQAICFVLIRPLSKSTYRRINRVVAELLWLELVWVVDWWAGVKIQLYTDSDTFHLMGK  223

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW+VGW++AQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLERS
Sbjct  224  EHALVISNHRSDIDWLVGWIVAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS  283

Query  436  WAKDESTLK  462
            WAKDESTLK
Sbjct  284  WAKDESTLK  292


 Score = 65.9 bits (159),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  293  SGIQRLKDYPLPFWLALFVEGTRFTQAKLLAAQE  326



>ref|XP_003535857.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN22374.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=383

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYVV+RP SK+ YRR+NR+ AELLWLELVW+IDWWAGVKVQ
Sbjct  8    PLGLLFFASGLIVNLIQAICYVVVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQ  67

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TDPETF+ MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  68   VFTDPETFRSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  127

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  128  SMWFSEYLFLERSWAKDERTLK  149


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL++L+D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  150  SGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQE  183



>ref|XP_003518108.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN05957.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=384

 Score =   237 bits (604),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYVV+RP SK+ YRR+NR+ AELLWLELVW+IDWWAGVKVQ
Sbjct  8    PLGLLFFASGLIVNLIQAICYVVVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQ  67

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TDPETF  MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  68   VFTDPETFHSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  127

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  128  SMWFSEYLFLERSWAKDERTLK  149


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL++L+D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  150  SGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQE  183



>emb|CDP10072.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   234 bits (598),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N  QAI +V+IRP SKSTYRRINR+ AELLWLELVW++DWWAGVK+Q
Sbjct  11   PLGVLFFLSGLVINLFQAIFFVLIRPLSKSTYRRINRVLAELLWLELVWIVDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ETFKLMGKEHAL+ISNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS  LPVIGW
Sbjct  71   LYTDSETFKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDESTLK
Sbjct  131  SMWFSEYLFLERSWAKDESTLK  152


 Score = 66.6 bits (161),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLERLRDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_004513649.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=386

 Score =   237 bits (604),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 128/140 (91%), Gaps = 2/140 (1%)
 Frame = +1

Query  49   SFLHFRS--FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLY  222
            S L F S    N IQAICYV++RP SK+ +RRINRL AELLWLELVW+IDWWAGV++Q++
Sbjct  13   SILFFASGLIVNLIQAICYVIVRPVSKNLHRRINRLVAELLWLELVWIIDWWAGVQIQVF  72

Query  223  TDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSM  402
            TDPETF+LMGKEHAL+ISNH+SDIDW+VGW+LA+RSGCLGSTLAVMKKSS +LPVIGWSM
Sbjct  73   TDPETFRLMGKEHALVISNHKSDIDWLVGWILAERSGCLGSTLAVMKKSSKFLPVIGWSM  132

Query  403  FFSEYLFLERSWAKDESTLK  462
            +FSEYLFLER+WAKDESTLK
Sbjct  133  WFSEYLFLERNWAKDESTLK  152


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL++L+D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_006349549.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=388

 Score =   234 bits (596),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA CYV++RP SKSTYRRINR+ AELLWLELVW++DWWAGVK++
Sbjct  11   PLGVLFFISGLVINLIQATCYVLVRPISKSTYRRINRIVAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y DPETF LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGW
Sbjct  71   VYADPETFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDERTLK  152


 Score = 66.2 bits (160),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>gb|KDO57199.1| hypothetical protein CISIN_1g0379582mg, partial [Citrus sinensis]
Length=152

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+ D ET++LMGKEHAL++SNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  131  SMWFSEYLFLERNWAKDESTLK  152



>ref|XP_004234840.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317926.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317927.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
Length=375

 Score =   232 bits (592),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA C+V++RP SKSTYRRINR+ AELLWLELVW++DWWAGVK++
Sbjct  11   PLGVLFFISGLVINLIQATCFVLVRPISKSTYRRINRIVAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y DPETF LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGW
Sbjct  71   VYADPETFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDERTLK  152


 Score = 66.2 bits (160),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>gb|KEH41602.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=386

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA C+V++RPFSK+ YRRINR+ AELLWLELVW+ DWWAGVK+Q
Sbjct  11   PLGILFFASGLIVNIIQATCFVILRPFSKNLYRRINRMVAELLWLELVWIFDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+TDPETF+ MG EHAL+ISNHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LFTDPETFRFMGTEHALVISNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDE TLK
Sbjct  131  SMWFSEYLFLERNWAKDERTLK  152


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL++L+D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_007145631.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
 gb|ESW17625.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
Length=383

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+CYV +RP SK+ YRR+NR+ AELLWLELVW+IDWWAGVKVQ
Sbjct  8    PLGLLFFSSGLIVNLIQALCYVFVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQ  67

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ETF+ MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  68   VFTDSETFRSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  127

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDESTLK
Sbjct  128  SMWFSEYLFLERSWAKDESTLK  149


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL++L+D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  150  SGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQE  183



>ref|XP_009618579.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Nicotiana 
tomentosiformis]
Length=387

 Score =   231 bits (588),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA C+V+IRP SKSTYRR+NR+FAELLWLELVW++DWWAGVK++
Sbjct  11   PLGVLFFISGLVINLIQATCFVLIRPISKSTYRRLNRIFAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y DP+ F LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGW
Sbjct  71   VYADPKEFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDERTLK  152


 Score = 66.2 bits (160),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_010257310.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nelumbo nucifera]
Length=387

 Score =   230 bits (586),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  70   FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  249
              N IQA+C++++RP SK+ YR+INR+ +ELLW+ELVWLIDWWAGVKVQLYTD ETFKLM
Sbjct  22   MVNIIQAVCFILVRPVSKNMYRKINRVVSELLWVELVWLIDWWAGVKVQLYTDSETFKLM  81

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            GKEHALLI NHRSDIDW+VGWVLAQ SGCLGSTLAVMKKSS +LPVIGWSM+FSEY+FLE
Sbjct  82   GKEHALLICNHRSDIDWLVGWVLAQHSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYVFLE  141

Query  430  RSWAKDESTLK  462
            RSWAKDE+TLK
Sbjct  142  RSWAKDENTLK  152


 Score = 63.9 bits (154),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GLKRL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GLKRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_006421451.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34691.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=282

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+ D ET++LMGKEHAL++SNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  131  SMWFSEYLFLERNWAKDESTLK  152


 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_009767064.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nicotiana sylvestris]
Length=387

 Score =   227 bits (579),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA C+V++RP SKSTYRR+NR+ AELLWLELVW++DWWAGVK++
Sbjct  11   PLGVLFFISGLVINLIQATCFVLVRPISKSTYRRLNRIVAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y DP+ F LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGW
Sbjct  71   VYMDPKEFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDERTLK  152


 Score = 66.2 bits (160),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_002323308.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
 gb|EEF05069.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
Length=435

 Score =   231 bits (588),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++
Sbjct  59   PLGVFFFCSGLIVNLIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  118

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TDPETF+LMGKEHALLI NH+SDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  119  VFTDPETFRLMGKEHALLICNHKSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  178

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDE+TLK
Sbjct  179  SMWFSEYLFLERNWAKDENTLK  200


 Score = 62.4 bits (150),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  201  SGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  234



>ref|XP_004307568.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QAIC++ IRP SK+ +RRINR+ AELLWLELVW++DWWAGVKV++YTDPETF LMGK
Sbjct  24   NLLQAICFIFIRPVSKNVHRRINRVVAELLWLELVWIVDWWAGVKVKVYTDPETFHLMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+I NH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLERS
Sbjct  84   EHALVICNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDEST+K
Sbjct  144  WAKDESTIK  152


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G++RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GIQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_006421453.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34693.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=387

 Score =   228 bits (582),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+ D ET++LMGKEHAL++SNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  131  SMWFSEYLFLERNWAKDESTLK  152


 Score = 63.5 bits (153),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_011033303.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Populus euphratica]
Length=386

 Score =   229 bits (583),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++
Sbjct  10   PLGVFFFCSGFIVNLIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TDPETF+LMGKEHAL++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFTDPETFRLMGKEHALVMCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDE+TLK
Sbjct  130  SMWFSEYLFLERNWAKDENTLK  151


 Score = 62.4 bits (150),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  152  SGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  185



>gb|ABU50327.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Helianthus annuus]
Length=382

 Score =   228 bits (580),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAI +V +RPFSKS +RRINR  AELLWLELVW++DWWAGVKV 
Sbjct  11   PIGVLFFVSGLIVNLIQAIIFVTVRPFSKSLFRRINRQVAELLWLELVWIVDWWAGVKVN  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET K+MGKEHAL+I+NH+SDIDW++GWV AQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LYTDAETLKMMGKEHALVIANHKSDIDWLIGWVFAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDESTLK
Sbjct  131  SMWFSEYLFLERSWAKDESTLK  152


 Score = 63.2 bits (152),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFT+AKLLAAQ+
Sbjct  153  SGLRRLKDYPQPFWLALFVEGTRFTKAKLLAAQE  186



>gb|AGB05602.1| sn-glycerol-3-phosphate acyltransferase [Camellia oleifera]
Length=386

 Score =   227 bits (579),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N IQAIC+V++RP SK+TYR+INR+ AELLWLELVW++DWWAGVK++L+TD ETF+LMG
Sbjct  23   VNLIQAICFVLVRPLSKNTYRKINRVVAELLWLELVWIVDWWAGVKIKLFTDSETFRLMG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL++SNH+SDIDW+VGWVLAQR+GCLGS LAVMKKSS +LP IGWSM+FSEYLFLER
Sbjct  83   KEHALVVSNHKSDIDWLVGWVLAQRAGCLGSALAVMKKSSKFLPAIGWSMWFSEYLFLER  142

Query  433  SWAKDESTLK  462
            SWAKDE TLK
Sbjct  143  SWAKDEITLK  152


 Score = 62.0 bits (149),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+PLPFWLALFVEGTRFTQAKL AAQ+
Sbjct  153  SGLQRLKDFPLPFWLALFVEGTRFTQAKLEAAQE  186



>ref|XP_006493900.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
Length=386

 Score =   225 bits (574),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+ D ET++LMGKEHAL++SNH+SDIDW+VGWVL+QRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+W KDESTLK
Sbjct  131  SMWFSEYLFLERNWVKDESTLK  152


 Score = 63.9 bits (154),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|NP_001105919.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 sp|Q41745.1|LPAT_MAIZE RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
PLS1; AltName: Full=Phospholipid synthesis protein 1 [Zea mays]
 emb|CAA82638.1| 1-acyl-glycerol-3-phosphate acyltransferase (putative) [Zea mays]
 gb|ACG37259.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG40468.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACR38397.1| unknown [Zea mays]
 tpg|DAA42327.1| TPA: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea 
mays]
Length=374

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             NAIQA+ +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MG
Sbjct  23   VNAIQAVLFVTIRPFSKSFYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLER  142

Query  433  SWAKDESTLK  462
            SWAKDE TLK
Sbjct  143  SWAKDEKTLK  152


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_011020321.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Populus 
euphratica]
Length=379

 Score =   225 bits (573),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++
Sbjct  11   PLGVLFFCSGLIVNIIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  71   VFTDKETVRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDE+TLK
Sbjct  131  SMWFSEYLFLERNWAKDENTLK  152


 Score = 57.8 bits (138),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFT  KLLAAQ+
Sbjct  153  SGLQRLKDFPRPFWLALFVEGTRFTLPKLLAAQE  186


 Score = 26.9 bits (58),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   YAAS GLPIPR
Sbjct  180  KLLAAQEYAASQGLPIPR  197



>gb|ACN28103.1| unknown [Zea mays]
 gb|AFW60269.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQAI +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MGK
Sbjct  24   NTIQAILFVTIRPFSKSLYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>gb|AGO14580.1| A-class lysophosphatidate acyltransferase 2 isoform 2 [Echium 
pitardii]
Length=387

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F     F N IQA+ +V++RPFSK+TYRRINR  AELLWLELVW+IDWWAGVK++
Sbjct  11   PLGVLFFISGLFVNLIQAVFFVIVRPFSKNTYRRINRWVAELLWLELVWIIDWWAGVKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ET + MGKEHALLI NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   VFADAETLRSMGKEHALLICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+TLK
Sbjct  131  SMWFSEYLFLERSWAKDENTLK  152


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFW+ALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLKDFPQPFWVALFVEGTRFTQAKLLAAQE  186



>ref|NP_001148618.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG32258.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQAI +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MGK
Sbjct  24   NTIQAILFVTIRPFSKSLYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_004979811.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Setaria italica]
Length=374

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQAI +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MGK
Sbjct  24   NTIQAILFVTIRPFSKSFYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLNDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_002308046.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE91569.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=385

 Score =   224 bits (572),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++
Sbjct  11   PLGVLFFCSGLIVNIIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS +AVMKKSS +LPVIGW
Sbjct  71   VFTDKETVRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSAVAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+TLK
Sbjct  131  SMWFSEYLFLERSWAKDENTLK  152


 Score = 57.8 bits (138),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFT  KLLAAQ+
Sbjct  153  SGLQRLKDFPRPFWLALFVEGTRFTLPKLLAAQE  186


 Score = 25.4 bits (54),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   +AAS GLPIPR
Sbjct  180  KLLAAQEFAASQGLPIPR  197



>ref|XP_002451179.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
 gb|EES10167.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
Length=374

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQAI +V IRPFSKS YRR+NR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MGK
Sbjct  24   NTIQAILFVTIRPFSKSFYRRVNRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_006402859.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
 gb|ESQ44312.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
Length=389

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D ETF  MG
Sbjct  22   VNLVQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFADNETFNRMG  81

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+FSEYLFLER
Sbjct  82   KEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLER  141

Query  433  SWAKDESTLK  462
            +WAKDESTLK
Sbjct  142  NWAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>gb|AGO14579.1| A-class lysophosphatidate acyltransferase 2 isoform 1 [Echium 
pitardii]
Length=387

 Score =   224 bits (572),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F     F N IQA+ +V++RPFSK+TYRRINR  AELLWLELVW+IDWWAGVK++
Sbjct  11   PLGVLFFISGLFVNLIQAVFFVIVRPFSKNTYRRINRWVAELLWLELVWIIDWWAGVKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ET + MG EHALLI NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   VFADAETLRSMGNEHALLICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+TLK
Sbjct  131  SMWFSEYLFLERSWAKDENTLK  152


 Score = 60.8 bits (146),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFW+ALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLKDFPQPFWVALFVEGTRFTQAKLLAAQE  186



>gb|ABP93351.1| lysophosphatidyl acyltransferase 2 [Helianthus annuus]
Length=385

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 132/185 (71%), Gaps = 15/185 (8%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F         +QA+ +V IRPFSKS +RRINR  AELLWLELVW++DWW+GVKV 
Sbjct  12   PIGVLFFVSGLIVTLLQALIFVTIRPFSKSLFRRINRQVAELLWLELVWIVDWWSGVKVN  71

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTDPET  +MGKEHAL+I+NHRSDIDW++GWV AQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  72   LYTDPETLNMMGKEHALVIANHRSDIDWLIGWVFAQRSGCLGSTLAVMKKSSKFLPVIGW  131

Query  397  SMFFSEYLFLERSWAKDESTLKVLKGYRITHFLFGWHFLLKALALHRQSF*LLKICCIYR  576
            SM+FSEYLFLER WAKDESTLK                 L+ L  + Q F L       R
Sbjct  132  SMWFSEYLFLERRWAKDESTLKA---------------GLQRLKDYPQPFWLALFVEGTR  176

Query  577  FTNSK  591
            FTN+K
Sbjct  177  FTNAK  181


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFT AKLLAAQ+
Sbjct  155  GLQRLKDYPQPFWLALFVEGTRFTNAKLLAAQE  187



>ref|XP_010524157.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
 ref|XP_010524167.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=382

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGVLFFVSGLAVNLVQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ETF  MGKEHAL+I NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS +LPVIGW
Sbjct  70   VFTDRETFNQMGKEHALVICNHRSDIDWLVGWMLAQRSGCLGSSLAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            SM+FSEYLFLER+WAKDE+TLK+
Sbjct  130  SMWFSEYLFLERNWAKDENTLKL  152


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  153  GLQRLKDFPQPFWLALFVEGTRFTEAKLKAAQE  185



>emb|CAA88620.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase (putative) [Limnanthes 
douglasii]
Length=377

 Score =   224 bits (570),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 2/140 (1%)
 Frame = +1

Query  49   SFLHFRS--FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLY  222
            S L F S    N IQA+ YV++RP SK TYRRIN L AELLWLELVW+IDWWAGVKVQLY
Sbjct  13   SLLFFMSGLVVNFIQAVFYVLVRPISKDTYRRINTLVAELLWLELVWVIDWWAGVKVQLY  72

Query  223  TDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSM  402
            TD E+F+LMGKEHALLI NHRSDIDW++GWVLAQR GCL S++AVMKKSS +LPVIGWSM
Sbjct  73   TDTESFRLMGKEHALLICNHRSDIDWLIGWVLAQRCGCLSSSIAVMKKSSKFLPVIGWSM  132

Query  403  FFSEYLFLERSWAKDESTLK  462
            +FSEYLFLER+WAKDE+TLK
Sbjct  133  WFSEYLFLERNWAKDENTLK  152


 Score = 60.8 bits (146),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKLLAAQ+
Sbjct  153  SGLQRLNDFPKPFWLALFVEGTRFTKAKLLAAQE  186



>ref|XP_009116469.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGILFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  130  SMWFSEYLFLERNWAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>gb|ADC97478.1| lysophosphatidic acid acyltransferase [Brassica napus]
 gb|ADC97480.1| lysophosphatidic acid acyltransferase [Brassica napus]
 emb|CDY06085.1| BnaA09g36950D [Brassica napus]
 emb|CDX72008.1| BnaC08g28660D [Brassica napus]
Length=390

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGILFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  130  SMWFSEYLFLERNWAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>sp|Q6IWY1.1|LPAT2_BRAOL RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
oleracea]
 gb|AAT36638.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
oleracea]
Length=391

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  11   PLGILFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  71   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  131  SMWFSEYLFLERNWAKDESTLK  152


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  153  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  186



>gb|ADC97479.1| lysophosphatidic acid acyltransferase [Brassica napus]
Length=391

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  11   PLGILFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  71   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  131  SMWFSEYLFLERNWAKDESTLK  152


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  153  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  186



>emb|CDY33810.1| BnaCnng07280D [Brassica napus]
Length=391

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  11   PLGILFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  71   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  131  SMWFSEYLFLERNWAKDESTLK  152


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  153  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  186



>ref|XP_009104068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  130  SMWFSEYLFLERNWAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>gb|ABN09946.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
 gb|ABN09947.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
Length=390

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGILFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTL+
Sbjct  130  SMWFSEYLFLERNWAKDESTLQ  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>emb|CAN83214.1| hypothetical protein VITISV_038716 [Vitis vinifera]
Length=390

 Score =   220 bits (561),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA+C++++RP SKSTYRRINR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFLTSGLVVNLIQAVCFILVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTDPETF+LMGKEHALLISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LYTDPETFRLMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDES +K
Sbjct  131  SMWFSEYLFLERNWAKDESIIK  152


 Score = 62.4 bits (150),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLLRLKDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>gb|AAM61033.1| 1-acylcerol-3-phosphate acyltransferase-like protein [Arabidopsis 
thaliana]
Length=389

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N  QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D ETF  MGK
Sbjct  23   NLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFADNETFNRMGK  82

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+FSEYLFLER+
Sbjct  83   EHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERN  142

Query  436  WAKDESTLK  462
            WAKDESTLK
Sbjct  143  WAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>ref|NP_567052.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
 sp|Q8LG50.2|LPAT2_ARATH RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Arabidopsis 
thaliana]
 gb|ABG48392.1| At3g57650 [Arabidopsis thaliana]
 gb|AEE79683.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
Length=389

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N  QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D ETF  MGK
Sbjct  23   NLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFADNETFNRMGK  82

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+FSEYLFLER+
Sbjct  83   EHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERN  142

Query  436  WAKDESTLK  462
            WAKDESTLK
Sbjct  143  WAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>ref|XP_002283340.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Vitis 
vinifera]
 emb|CBI29878.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   220 bits (561),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA+C++++RP SKSTYRRINR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFLTSGLVVNLIQAVCFILVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTDPETF+LMGKEHALLISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LYTDPETFRLMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDES +K
Sbjct  131  SMWFSEYLFLERNWAKDESIIK  152


 Score = 62.4 bits (150),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLLRLKDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_009387255.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=374

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QAI ++ IRPFSKS YRRINR+ AELLWL+++WL+DWWAGVKVQL+ D +T+ LMGK
Sbjct  24   NLVQAIFFITIRPFSKSLYRRINRVVAELLWLQVIWLVDWWAGVKVQLFADSKTYALMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNH+SDIDW+VGW+L+QRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVIGWSMWFTEYLFLERS  143

Query  436  WAKDESTLK  462
            W KDESTLK
Sbjct  144  WTKDESTLK  152


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL++L+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  153  SGLQQLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_002876428.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52687.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N  QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGLLFFISGLVVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D +TF  MGKEHAL++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFADNDTFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  130  SMWFSEYLFLERNWAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>sp|Q9XFW4.1|LPAT2_BRANA RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
napus]
 emb|CAB09138.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
napus]
Length=390

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTL+
Sbjct  130  SMWFSEYLFLERNWAKDESTLQ  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>gb|ABM92334.2| 1-acylglycerol-3-phosphate acyltransferase [Brassica juncea]
Length=390

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGW
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTL+
Sbjct  130  SMWFSEYLFLERNWAKDESTLQ  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>dbj|BAJ84894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+ ++ IRPFSK  YR+IN   AELLWL+L+WL+DWWAGVKVQ+Y DPET+K+MGK
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGVKVQVYADPETWKVMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHALLISNHRSDIDW+VGW+LAQRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P  FWLALFVEGTRFT AKLLAAQ+
Sbjct  153  SGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQE  186



>gb|KFK35010.1| hypothetical protein AALP_AA5G222500 [Arabis alpina]
Length=389

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV+IRP SKSTYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGLLFFISGLVVNLVQALCYVLIRPLSKSTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSG LGS LAVMKKSS +LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGSLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  130  SMWFSEYLFLERNWAKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>ref|XP_008392182.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Malus 
domestica]
Length=386

 Score =   216 bits (551),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+++IRP SK+TYR+INR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFFVSGLVVNLIQAICFILIRPLSKNTYRKINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTDPETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   VYTDPETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            SM+FSEYLFLERSWAKDE+TLK+
Sbjct  131  SMWFSEYLFLERSWAKDENTLKL  153


 Score = 63.5 bits (153),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GLQRLKDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_010516385.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516386.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516388.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010427647.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
Length=389

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGLLFFISGLVVNLIQALCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGWVLAQRSG LGS LAVMKKSS +LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGSLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+W+KDESTLK
Sbjct  130  SMWFSEYLFLERNWSKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>ref|XP_010504698.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Camelina 
sativa]
Length=389

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGLLFFISGLVVNLIQALCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGWVLAQRSG LGS LAVMKKSS +LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGSLGSALAVMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+W+KDESTLK
Sbjct  130  SMWFSEYLFLERNWSKDESTLK  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  152  SGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQE  185



>ref|XP_010554846.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=387

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW+IDWWAGVK++++TD ETF  MG+
Sbjct  23   NLVQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIIDWWAGVKIRVFTDRETFHQMGR  82

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+I NHRSDIDW+VGWVLAQR+GCLGS LAVMKKSS  LPVIGWSM+FSEYLFLER+
Sbjct  83   EHALVICNHRSDIDWLVGWVLAQRAGCLGSALAVMKKSSKLLPVIGWSMWFSEYLFLERN  142

Query  436  WAKDESTLK  462
            WAKDE+TLK
Sbjct  143  WAKDENTLK  151


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFTQAKL AAQ+
Sbjct  152  SGLQRLYDFPQPFWLALFVEGTRFTQAKLKAAQE  185



>ref|XP_003521190.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
1 [Glycine max]
 gb|KHN07393.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=377

 Score =   215 bits (547),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYVV+RP SKS YRRINR+ AELLWLELVWLIDWWAGVKVQ
Sbjct  11   PLGLLFFASGLLVNLIQAICYVVVRPVSKSLYRRINRVVAELLWLELVWLIDWWAGVKVQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ETF+LMGKEHAL+ISNHRSDIDW+VGWV AQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   IFTDHETFRLMGKEHALVISNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDESTLK
Sbjct  131  SMWFSEYLFLERSWAKDESTLK  152


 Score = 63.9 bits (154),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGIQRLSDFPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_006293344.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
 gb|EOA26242.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
Length=363

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  88   AICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHAL  267
            A+CYV+IRP SK+TYR++NR+ AE LWLELVW++DWWAGVK+Q++ D ETF  MGKEHAL
Sbjct  1    AVCYVLIRPLSKNTYRKLNRVVAETLWLELVWIVDWWAGVKIQVFADNETFNRMGKEHAL  60

Query  268  LISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKD  447
            ++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGWSM+FSEYLFLER+WAKD
Sbjct  61   VVCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKD  120

Query  448  ESTLK  462
            ESTLK
Sbjct  121  ESTLK  125


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  126  SGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQE  159



>ref|XP_009345032.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score =   214 bits (546),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQ IC++++RP SK+TYRRINR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFFVSGLVVNLIQGICFILVRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTDPETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   VYTDPETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            SM+FSEYLFLERSWAKDE+TLK+
Sbjct  131  SMWFSEYLFLERSWAKDENTLKL  153


 Score = 63.5 bits (153),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GLQRLKDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_009414749.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQA  Y+ IRPFSKS +RRINR+ AELLWL+L+WL+DWWAGVKVQLY D +T++LMGK
Sbjct  24   NLIQATIYITIRPFSKSLFRRINRVVAELLWLQLIWLVDWWAGVKVQLYADSKTYELMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+I NH+SDIDW+VGW+L+QRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVICNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVIGWSMWFTEYLFLERS  143

Query  436  WAKDESTLKV  465
            WAKDE+ L +
Sbjct  144  WAKDENILTL  153


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+ L+D+P PFWLALFVEGTRFT AKL+AAQ+
Sbjct  154  GLQHLKDFPRPFWLALFVEGTRFTPAKLIAAQE  186



>emb|CDX67700.1| BnaA07g17400D [Brassica napus]
Length=391

 Score =   219 bits (557),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLA-QRSGCLGSTLAVMKKSSVYLPVIG  393
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LA QRSGCLGS LAVMKKSS +LPVIG
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQQRSGCLGSALAVMKKSSKFLPVIG  129

Query  394  WSMFFSEYLFLERSWAKDESTLK  462
            WSM+FSEYLFLER+WAKDESTLK
Sbjct  130  WSMWFSEYLFLERNWAKDESTLK  152


 Score = 58.9 bits (141),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFT+AKL AAQ+
Sbjct  153  SGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQE  186



>ref|XP_003575968.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Brachypodium distachyon]
Length=374

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            NAIQA+ +++IRPFSK  YR+IN   AELLWL+L+WL+DWWAGVKVQL+ D ET++ MGK
Sbjct  24   NAIQAVLFLLIRPFSKRLYRQINVFVAELLWLQLIWLVDWWAGVKVQLHADQETYESMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHALLISNHRSDIDW+VGW+LAQRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P  FWLALFVEGTR+T AKLLAAQ+
Sbjct  153  SGLQRLKDFPRSFWLALFVEGTRYTPAKLLAAQE  186



>gb|KCW90238.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=356

 Score =   210 bits (535),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD ETF LMGK
Sbjct  24   NLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDRETFHLMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPV+GWSM+FSEYLFLERS
Sbjct  84   EHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWFSEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDESTLK
Sbjct  144  WAKDESTLK  152


 Score = 65.5 bits (158),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_003554183.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN26342.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=387

 Score =   214 bits (544),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYVV+RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKVQ
Sbjct  11   PLGLLFFASGLLVNLIQAICYVVVRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKVQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ETF LMGKEHAL+ISNHRSDIDW+VGWV AQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   IFTDHETFHLMGKEHALVISNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDESTLK
Sbjct  131  SMWFSEYLFLERSWAKDESTLK  152


 Score = 62.0 bits (149),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G+++L D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGIQQLSDFPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_010057561.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW90237.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=387

 Score =   210 bits (534),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD ETF LMGK
Sbjct  24   NLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDRETFHLMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPV+GWSM+FSEYLFLERS
Sbjct  84   EHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWFSEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDESTLK
Sbjct  144  WAKDESTLK  152


 Score = 65.1 bits (157),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_011078878.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
 ref|XP_011078879.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=386

 Score =   213 bits (541),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYV+IRP SK+TYRRINR  AELLWLELVWL+DWWAGVK++
Sbjct  11   PLGVLFFMSGLVVNLIQAICYVLIRPLSKNTYRRINREVAELLWLELVWLVDWWAGVKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTD ETFKLMGKEHAL+I NHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   IYTDAETFKLMGKEHALVICNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+TLK
Sbjct  131  SMWFSEYLFLERSWAKDENTLK  152


 Score = 62.4 bits (150),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GLQRLRDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>gb|KCW90239.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=291

 Score =   209 bits (533),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD ETF LMGK
Sbjct  24   NLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDRETFHLMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPV+GWSM+FSEYLFLERS
Sbjct  84   EHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWFSEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDESTLK
Sbjct  144  WAKDESTLK  152


 Score = 65.5 bits (158),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_007162250.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
 gb|ESW34244.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
Length=387

 Score =   213 bits (541),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F       N IQAICYVV+RP SK+ YRRINR+ AELLWLELVWLIDW
Sbjct  4    AAAAVVLPLGLLFFASGLLVNLIQAICYVVLRPVSKNLYRRINRVVAELLWLELVWLIDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+Q++TD ETF+LMGKEHAL++SNHRSDIDW+VGWV AQRSGCLGSTLAVMKKSS 
Sbjct  64   WAGVKIQIFTDHETFRLMGKEHALVMSNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDESTL+
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDESTLR  152


 Score = 62.4 bits (150),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G+++L DYPLPFWLALFVEGTRFTQAKLLAA++
Sbjct  153  SGIQQLSDYPLPFWLALFVEGTRFTQAKLLAAKE  186



>ref|XP_009334964.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009334965.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009340151.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score =   213 bits (541),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+++IRP SK+TYRRINR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFFVSGLVINLIQAICFILIRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTDPETF LMGKEHAL++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS  LPVIGW
Sbjct  71   VYTDPETFHLMGKEHALVMCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKLLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            SM+FSEYLFLERSWAKDESTLK+
Sbjct  131  SMWFSEYLFLERSWAKDESTLKL  153


 Score = 61.2 bits (147),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL AAQ+
Sbjct  154  GLQRLKDYPQPFWLALFVEGTRFTQAKLSAAQE  186



>gb|EYU20729.1| hypothetical protein MIMGU_mgv1a008164mg [Erythranthe guttata]
Length=383

 Score =   211 bits (537),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+CYV+IRP SK+TYRRINR  AELLWLELVWLIDWWAGVK++
Sbjct  11   PLGVLFFVSGLVVNLIQAVCYVLIRPVSKNTYRRINRQVAELLWLELVWLIDWWAGVKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ETFKLMGKEHAL+I NH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS  LPVIGW
Sbjct  71   LYADSETFKLMGKEHALVICNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM FSEYLFLERSWAKDESTLK
Sbjct  131  SMCFSEYLFLERSWAKDESTLK  152


 Score = 62.0 bits (149),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLSDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>ref|NP_001280186.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Prunus mume]
 dbj|BAE48660.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus mume]
Length=386

 Score =   211 bits (538),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F       N IQAIC+++IRP SK+ YRRINR+ AELLWLELVWLIDW
Sbjct  4    VAAAVVVPLGLLFFISGLVVNLIQAICFILIRPVSKNLYRRINRVVAELLWLELVWLIDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+Q+YTD ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS 
Sbjct  64   WAGVKIQVYTDHETFNLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDE TLK
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDEGTLK  152


 Score = 61.2 bits (147),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGVQRLKDFPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_010265751.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nelumbo nucifera]
Length=387

 Score =   214 bits (544),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA+C++++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKVQ
Sbjct  11   PLGVLFLFSGIVVNIIQAVCFILVRPLSKNMYRRINRVVAELLWLELVWLIDWWAGVKVQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ETF+ MGKEHALLISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LYTDSETFQSMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEY+FLERSWAKDESTLK
Sbjct  131  SMWFSEYVFLERSWAKDESTLK  152


 Score = 58.9 bits (141),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL RL+D+P PFWLALFVEGTR+T+AKLLAAQ+
Sbjct  154  GLGRLKDFPRPFWLALFVEGTRYTRAKLLAAQE  186



>ref|XP_011075205.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Sesamum 
indicum]
Length=381

 Score =   209 bits (533),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+++IRP SK TYRRINR  A LLWL LVWLIDWWAGVK++
Sbjct  11   PLGVLFFVSGLVINFIQAVCFLLIRPLSKKTYRRINREVAGLLWLGLVWLIDWWAGVKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ETFKLMGKEHAL+I NH+SDIDW+VGWVLA+RSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   LYTDSETFKLMGKEHALVICNHKSDIDWLVGWVLAERSGCLGSTLAVMKKSSRFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDESTLK
Sbjct  131  SMWFSEYLFLERSWAKDESTLK  152


 Score = 62.4 bits (150),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLRDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>emb|CDX88957.1| BnaA04g02290D [Brassica napus]
Length=384

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QAICYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK++
Sbjct  10   PLGLLFFISGLLMNLLQAICYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIK  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAV K S+ +LPVIGW
Sbjct  70   VFADNETFSRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVTKNSNKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSE+LFLER+WAKDEST+K
Sbjct  130  SMWFSEFLFLERNWAKDESTIK  151


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFT+ KL AAQ+
Sbjct  152  SGLQRLKDFPQPFWLALFVEGTRFTETKLKAAQE  185



>gb|KDP37345.1| hypothetical protein JCGZ_06799 [Jatropha curcas]
Length=385

 Score =   209 bits (531),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  19   GGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWW  198
              +   P G  F       N IQAIC+VVIRP SK+TYR+INR  AELLWLELVWL+DWW
Sbjct  5    AAAVILPLGVLFFLSGFVVNLIQAICFVVIRPLSKNTYRKINRAVAELLWLELVWLVDWW  64

Query  199  AGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVY  378
            AG+++QLYTD ETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS  
Sbjct  65   AGIQIQLYTDQETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKL  124

Query  379  LPVIGWSMFFSEYLFLERSWAKDESTLK  462
            LPVIGWSM+FSEYLFLERSWAKDESTLK
Sbjct  125  LPVIGWSMWFSEYLFLERSWAKDESTLK  152


 Score = 62.8 bits (151),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>gb|AEZ56251.1| plastid 1-acylglycerol-phosphate acyltransferase [Jatropha curcas]
Length=385

 Score =   209 bits (531),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  19   GGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWW  198
              +   P G  F       N IQAIC+VVIRP SK+TYR+INR  AELLWLELVWL+DWW
Sbjct  5    AAAVILPLGVLFFLSGFVVNLIQAICFVVIRPLSKNTYRKINRAVAELLWLELVWLVDWW  64

Query  199  AGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVY  378
            AG+++QLYTD ETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS  
Sbjct  65   AGIQIQLYTDQETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKL  124

Query  379  LPVIGWSMFFSEYLFLERSWAKDESTLK  462
            LPVIGWSM+FSEYLFLERSWAKDESTLK
Sbjct  125  LPVIGWSMWFSEYLFLERSWAKDESTLK  152


 Score = 62.8 bits (151),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_007202144.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
 gb|EMJ03343.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
Length=386

 Score =   210 bits (534),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+++IRP SK+ YRRINR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFFISGLVVNLIQAICFILIRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTD ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGS+LAVMKKSS +LPVIGW
Sbjct  71   VYTDHETFNLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDEGTLK  152


 Score = 61.2 bits (147),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGVQRLKDFPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_004249199.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Solanum lycopersicum]
Length=382

 Score =   207 bits (526),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F     F N IQA C+V+IRPFSK+ YRRINR+FAELLWLELVWL+DW AGV+++
Sbjct  11   PMGIIFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY DPETF+LMGKEHALLI+NHRSDIDW+VGWVLAQRS CLGS LAVMKKSS +LPV+GW
Sbjct  71   LYMDPETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSSCLGSALAVMKKSSKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+T+K
Sbjct  131  SMWFSEYLFLERSWAKDENTIK  152


 Score = 63.9 bits (154),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_009387254.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=389

 Score =   212 bits (540),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 119/144 (83%), Gaps = 15/144 (10%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK---------------  210
            N +QAI ++ IRPFSKS YRRINR+ AELLWL+++WL+DWWAGVK               
Sbjct  24   NLVQAIFFITIRPFSKSLYRRINRVVAELLWLQVIWLVDWWAGVKKMRSLRERQLAYEIE  83

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            VQL+ D +T+ LMGKEHAL+ISNH+SDIDW+VGW+L+QRSGCLGSTLAVMKKSS +LPVI
Sbjct  84   VQLFADSKTYALMGKEHALVISNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVI  143

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GWSM+F+EYLFLERSW KDESTLK
Sbjct  144  GWSMWFTEYLFLERSWTKDESTLK  167


 Score = 58.2 bits (139),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL++L+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  168  SGLQQLKDFPRPFWLALFVEGTRFTPAKLLAAQE  201



>ref|XP_004493527.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=387

 Score =   208 bits (529),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA CYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFFVSGLIVNLIQATCYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ETF+LMGKEHAL+ISNHRSDIDW+VGWVLAQRSG LGSTLAVMKKSS +LPVIGW
Sbjct  71   IFTDRETFRLMGKEHALVISNHRSDIDWLVGWVLAQRSGSLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+TLK
Sbjct  131  SMWFSEYLFLERSWAKDENTLK  152


 Score = 62.4 bits (150),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL D+PLPFWLALFVEGTRFTQ KLLAAQ+
Sbjct  153  SGIQRLSDFPLPFWLALFVEGTRFTQVKLLAAQE  186



>ref|XP_010312077.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Solanum lycopersicum]
Length=330

 Score =   206 bits (525),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F     F N IQA C+V+IRPFSK+ YRRINR+FAELLWLELVWL+DW AGV+++
Sbjct  11   PMGIIFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY DPETF+LMGKEHALLI+NHRSDIDW+VGWVLAQRS CLGS LAVMKKSS +LPV+GW
Sbjct  71   LYMDPETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSSCLGSALAVMKKSSKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+T+K
Sbjct  131  SMWFSEYLFLERSWAKDENTIK  152


 Score = 63.5 bits (153),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_006351222.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=382

 Score =   209 bits (532),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F     F N IQA C+V+IRPFSK+ YRRINR+FAELLWLELVWL+DW AGV+++
Sbjct  11   PMGIVFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY DPETF+LMGKEHALLI+NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPV+GW
Sbjct  71   LYMDPETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+T+K
Sbjct  131  SMWFSEYLFLERSWAKDENTIK  152


 Score = 60.5 bits (145),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+ L+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQWLRDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_006852430.1| hypothetical protein AMTR_s00021p00084240 [Amborella trichopoda]
 gb|ERN13897.1| hypothetical protein AMTR_s00021p00084240 [Amborella trichopoda]
Length=387

 Score =   206 bits (525),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQ +CYV+ RP SK+ YRRINR+ AELLWLELVWLIDWW GVKVQLY D ETF+ MGK
Sbjct  24   NLIQIVCYVIFRPLSKNLYRRINRVVAELLWLELVWLIDWWGGVKVQLYADSETFRHMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLERS
Sbjct  84   EHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE+TLK
Sbjct  144  WAKDENTLK  152


 Score = 62.4 bits (150),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_003597431.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
 gb|AES67682.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=376

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQAI +V +RP S+  YRRIN +  E LWLEL+WLIDWWAGVKV+
Sbjct  11   PVGIIFILSGLIINVIQAIFFVFVRPISRYCYRRINNVLTESLWLELIWLIDWWAGVKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLGST+A+MKK   YLPVIGW
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGSTIAIMKKEFKYLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+F+EYLFLER+WAKDES+LK
Sbjct  131  SMWFAEYLFLERNWAKDESSLK  152


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G K L+  P+PFW+ALFVEGTRFT  KLLAAQ+
Sbjct  153  SGFKLLEHKPVPFWVALFVEGTRFTHTKLLAAQE  186



>gb|ACV73676.1| lysophosphatidic acid acyltransferase 2 [Tropaeolum majus]
Length=380

 Score =   204 bits (519),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F       N IQAI YV++RP SKSTYRRINR+ AELLWLELVWLIDW
Sbjct  4    AAAAIVLPLGLLFFFSGLVVNLIQAIFYVLVRPLSKSTYRRINRVVAELLWLELVWLIDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK++L+TD ET   MGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS+LAVMKKSS 
Sbjct  64   WAGVKIKLFTDRETLHQMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDESTLK
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDESTLK  152


 Score = 63.9 bits (154),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGLQRLNDYPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_003625176.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
 gb|AES81394.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=387

 Score =   206 bits (525),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N  QAICYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKV+
Sbjct  11   PLGLLFFASGLIVNFFQAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTD ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   IYTDRETSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+TLK
Sbjct  131  SMWFSEYLFLERSWAKDENTLK  152


 Score = 61.2 bits (147),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL D+PLPFWLALFVEGTRFT  KLLAAQ+
Sbjct  153  SGIRRLNDFPLPFWLALFVEGTRFTNVKLLAAQE  186



>gb|AFK40266.1| unknown [Medicago truncatula]
Length=387

 Score =   206 bits (525),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N  QAICYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKV+
Sbjct  11   PLGLLFFASGLIVNFFQAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTD ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGW
Sbjct  71   IYTDRETSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE+TLK
Sbjct  131  SMWFSEYLFLERSWAKDENTLK  152


 Score = 61.2 bits (147),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL D+PLPFWLALFVEGTRFT  KLLAAQ+
Sbjct  153  SGIRRLNDFPLPFWLALFVEGTRFTNVKLLAAQE  186



>gb|KJB16432.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=350

 Score =   205 bits (522),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F     F N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DW
Sbjct  4    AAATVIVPLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+ ++ D E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS 
Sbjct  64   WAGVKINVFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDE+T+K
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDENTIK  152


 Score = 62.4 bits (150),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  154  GLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQE  186



>ref|XP_002894307.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70566.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
Length=376

 Score =   209 bits (533),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +1

Query  19   GGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWW  198
                + P G  FL      N IQ + ++++RPFS+S YRRIN+  AELLWL+L+WL DWW
Sbjct  5    AALAFIPVGVLFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWW  64

Query  199  AGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVY  378
            A +K+ LY D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + Y
Sbjct  65   ACIKINLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKY  124

Query  379  LPVIGWSMFFSEYLFLERSWAKDESTLK  462
            LP+IGWSM+FS+Y+FLERSWAKDE+TLK
Sbjct  125  LPIIGWSMWFSDYIFLERSWAKDENTLK  152


 Score = 58.2 bits (139),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQD
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQD  186



>gb|KCW90236.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=395

 Score =   202 bits (514),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 8/137 (6%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD ETF LMGK
Sbjct  24   NLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDRETFHLMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP--------VIGWSMFFS  411
            EHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LP        V+GWSM+FS
Sbjct  84   EHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPDLDFPCLQVLGWSMWFS  143

Query  412  EYLFLERSWAKDESTLK  462
            EYLFLERSWAKDESTLK
Sbjct  144  EYLFLERSWAKDESTLK  160


 Score = 65.1 bits (157),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  161  SGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQE  194



>gb|KJB16430.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score =   205 bits (521),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F     F N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DW
Sbjct  4    AAATVIVPLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+ ++ D E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS 
Sbjct  64   WAGVKINVFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDE+T+K
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDENTIK  152


 Score = 62.8 bits (151),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  154  GLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQE  186



>gb|KJB16434.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=286

 Score =   204 bits (520),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F     F N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DW
Sbjct  4    AAATVIVPLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+ ++ D E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS 
Sbjct  64   WAGVKINVFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDE+T+K
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDENTIK  152


 Score = 62.8 bits (151),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  154  GLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQE  186



>gb|KJB36055.1| hypothetical protein B456_006G138600 [Gossypium raimondii]
Length=387

 Score =   205 bits (522),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N IQA+C+V+IRP SK+TYR+INR+ AELLWL+LVWL+DWWAGVK++++ D E+F LMG
Sbjct  23   VNLIQAVCFVLIRPLSKNTYRKINRVLAELLWLQLVWLVDWWAGVKIEVFADHESFNLMG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLER
Sbjct  83   KEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLER  142

Query  433  SWAKDESTLK  462
            SWAKDE+TLK
Sbjct  143  SWAKDENTLK  152


 Score = 62.0 bits (149),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G++RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GIQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_004486964.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X2 [Cicer arietinum]
Length=377

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +QAI +V++RP S+  YRRIN++  E LWLEL+WL+DWWAGVKV+
Sbjct  11   PVGTLFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLG+T+A+MKK   YLPVIGW
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+F+E+LFLER+WAKDE+ LK
Sbjct  131  SMWFAEFLFLERNWAKDEAALK  152


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G K+L+  P+PFW+ALFVEGTRFT  KLLAAQ+
Sbjct  153  SGFKQLEHKPVPFWMALFVEGTRFTHTKLLAAQE  186



>ref|XP_009139024.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Brassica rapa]
Length=385

 Score =   210 bits (534),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +QAICYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK++
Sbjct  10   PLGLLFFISGLLMNLLQAICYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIK  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D ET   MGKEHAL++ N RSDIDW+VGW+LAQRSGCLGS LAV KKS+ +LPVIGW
Sbjct  70   VFADDETLSRMGKEHALVVCNLRSDIDWLVGWILAQRSGCLGSALAVTKKSNKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSE+LFLER+WAKDEST+K
Sbjct  130  SMWFSEFLFLERNWAKDESTIK  151


 Score = 57.0 bits (136),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFT+ KL AAQ+
Sbjct  152  SGLQRLKDFPQPFWLALFVEGTRFTETKLKAAQE  185



>gb|KJB36056.1| hypothetical protein B456_006G138600 [Gossypium raimondii]
Length=314

 Score =   205 bits (522),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N IQA+C+V+IRP SK+TYR+INR+ AELLWL+LVWL+DWWAGVK++++ D E+F LMG
Sbjct  23   VNLIQAVCFVLIRPLSKNTYRKINRVLAELLWLQLVWLVDWWAGVKIEVFADHESFNLMG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLER
Sbjct  83   KEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLER  142

Query  433  SWAKDESTLK  462
            SWAKDE+TLK
Sbjct  143  SWAKDENTLK  152


 Score = 61.6 bits (148),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G++RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GIQRLKDFPRPFWLALFVEGTRFTQAKLLAAQE  186



>gb|KJB16435.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=273

 Score =   204 bits (519),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F     F N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DW
Sbjct  4    AAATVIVPLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+ ++ D E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS 
Sbjct  64   WAGVKINVFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDE+T+K
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDENTIK  152


 Score = 62.8 bits (151),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  154  GLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQE  186



>ref|XP_004486963.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X1 [Cicer arietinum]
Length=390

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +QAI +V++RP S+  YRRIN++  E LWLEL+WL+DWWAGVKV+
Sbjct  11   PVGTLFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLG+T+A+MKK   YLPVIGW
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+F+E+LFLER+WAKDE+ LK
Sbjct  131  SMWFAEFLFLERNWAKDEAALK  152


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G K+L+  P+PFW+ALFVEGTRFT  KLLAAQ+
Sbjct  153  SGFKQLEHKPVPFWMALFVEGTRFTHTKLLAAQE  186



>ref|XP_008443106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Cucumis 
melo]
Length=388

 Score =   204 bits (518),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYV IRP +K+ YRRINR  AELLWLELVWLIDWWAGV+++
Sbjct  11   PLGVLFFFSGLVVNLIQAICYVFIRPITKNGYRRINRFVAELLWLELVWLIDWWAGVQIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ET KLMGKEHAL++SNHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPV+GW
Sbjct  71   VFTDRETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDEITLK  152


 Score = 62.4 bits (150),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYPLPFWLALFVEGTRFT+AKLLAA++
Sbjct  153  SGLLRLKDYPLPFWLALFVEGTRFTEAKLLAAKE  186



>ref|XP_004165747.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
Length=388

 Score =   203 bits (517),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYV +RP +K+ YRRINR  AELLWLELVWLIDWWAGV+++
Sbjct  11   PLGVLFFFSGLVVNLIQAICYVFVRPITKNGYRRINRFVAELLWLELVWLIDWWAGVQIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ET KLMGKEHAL++SNHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPV+GW
Sbjct  71   VFTDRETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDEITLK  152


 Score = 62.8 bits (151),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYPLPFWLALFVEGTRFT+AKLLAA++
Sbjct  153  SGLLRLKDYPLPFWLALFVEGTRFTEAKLLAAKE  186



>gb|KFK35863.1| hypothetical protein AALP_AA4G046700 [Arabis alpina]
Length=376

 Score =   208 bits (529),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  FL      N IQ + ++++RPFS+S Y RIN+  AELLWL+L+WL+DWWA +K
Sbjct  9    FVPVGVLFLVSGLIVNLIQLVFFIIVRPFSRSLYGRINKNVAELLWLQLIWLVDWWACIK  68

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            + LY D ET +LMGKEHAL++ NHRSDIDW++GWV+AQRSGCLGSTLA+MKK + YLP+I
Sbjct  69   INLYADEETLELMGKEHALVLCNHRSDIDWLLGWVMAQRSGCLGSTLAIMKKEAKYLPII  128

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GWSM+FS+Y+FLER+WAKDE+TLK
Sbjct  129  GWSMWFSDYIFLERNWAKDENTLK  152


 Score = 58.2 bits (139),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQD
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQD  186



>ref|XP_004136588.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 gb|KGN59338.1| hypothetical protein Csa_3G812100 [Cucumis sativus]
Length=388

 Score =   203 bits (516),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAICYV++RP +K+ YRR+NR  AELLWLELVWLIDWWAGV+++
Sbjct  11   PLGVLFFFSGLVVNLIQAICYVLVRPITKNGYRRMNRFVAELLWLELVWLIDWWAGVQIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ET KLMGKEHAL++SNHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPV+GW
Sbjct  71   VFTDRETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDE TLK
Sbjct  131  SMWFSEYLFLERSWAKDEITLK  152


 Score = 62.8 bits (151),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL RL+DYPLPFWLALFVEGTRFT+AKLLAA++
Sbjct  153  SGLLRLKDYPLPFWLALFVEGTRFTEAKLLAAKE  186



>gb|KJB16433.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score =   203 bits (516),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F     F N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DW
Sbjct  4    AAATVIVPLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+ ++ D E+F LMG EHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS 
Sbjct  64   WAGVKINVFADNESFSLMGNEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDE+T+K
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDENTIK  152


 Score = 62.8 bits (151),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  154  GLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQE  186



>emb|CDP18472.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   206 bits (524),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQA+ ++++RP SK+ +RRIN+   ELLWLE+VWL DWWA +KV+LYTDPETF+ +GK
Sbjct  23   NFIQALIFILVRPLSKNLFRRINKEVTELLWLEIVWLFDWWANIKVELYTDPETFEFLGK  82

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHALLI NHRSDIDW+VGWVLAQR GCLGSTLA++KK+++YLPV+GWSM+F+ Y+FLERS
Sbjct  83   EHALLICNHRSDIDWLVGWVLAQRFGCLGSTLALIKKAALYLPVLGWSMWFNNYIFLERS  142

Query  436  WAKDESTLK  462
            W KDE TLK
Sbjct  143  WTKDEYTLK  151


 Score = 58.9 bits (141),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+ L D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  152  SGLQGLNDFPRPFWLALFVEGTRFTQAKLLAAQE  185



>ref|NP_175537.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9SYC8.1|LPAT3_ARATH RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
3; AltName: Full=Lysophosphatidyl acyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAD30638.1|AC006085_11 Putative acyl-CoA:1-acylglycerol-3-phosphate acyltransferase 
[Arabidopsis thaliana]
 gb|AEE32642.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Arabidopsis 
thaliana]
Length=376

 Score =   208 bits (530),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +1

Query  28   CYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGV  207
             + P G  FL      N IQ + ++++RPFS+S YRRIN+  AELLWL+L+WL DWWA +
Sbjct  8    VFIPVGVLFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWWACI  67

Query  208  KVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPV  387
            K+ LY D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR GCLGS+LA+MKK + YLP+
Sbjct  68   KINLYVDAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRVGCLGSSLAIMKKEAKYLPI  127

Query  388  IGWSMFFSEYLFLERSWAKDESTLK  462
            IGWSM+FS+Y+FLERSWAKDE+TLK
Sbjct  128  IGWSMWFSDYIFLERSWAKDENTLK  152


 Score = 56.6 bits (135),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQE  186



>gb|KHG04120.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Gossypium arboreum]
Length=381

 Score =   202 bits (514),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  16   CGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDW  195
               +   P G  F       N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DW
Sbjct  4    AAATVIVPLGILFFISGLVVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDW  63

Query  196  WAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
            WAGVK+ ++ D E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS 
Sbjct  64   WAGVKINVFADNESFNLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSK  123

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            +LPVIGWSM+FSEYLFLERSWAKDE+T+K
Sbjct  124  FLPVIGWSMWFSEYLFLERSWAKDENTIK  152


 Score = 62.8 bits (151),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  154  GLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQE  186



>ref|XP_002894308.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70567.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   206 bits (525),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  FL      N+IQ + ++++RPFS+S YRRIN+  AELLWL+L+WL DWWA +K
Sbjct  9    FIPVGILFLVSGLIVNSIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLSDWWACIK  68

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            + LY D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+M K + YLP+I
Sbjct  69   INLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMAKEAKYLPII  128

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GWSM+FS+Y+FLERSWAKDE+TLK
Sbjct  129  GWSMWFSDYIFLERSWAKDENTLK  152


 Score = 58.2 bits (139),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQD
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQD  186



>ref|XP_010479592.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score =   207 bits (527),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  28   CYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGV  207
             + P G  FL      N IQ + ++ +RPFS+S YRRIN+  AELLWL+L+WL DWWA +
Sbjct  8    VFIPVGVLFLISGLIVNIIQLVFFITVRPFSRSLYRRINKTVAELLWLQLIWLFDWWACI  67

Query  208  KVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPV  387
            K+ LY D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+
Sbjct  68   KINLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPI  127

Query  388  IGWSMFFSEYLFLERSWAKDESTLK  462
            IGWSM+FS+Y+FLERSWAKDE+ LK
Sbjct  128  IGWSMWFSDYIFLERSWAKDENNLK  152


 Score = 56.6 bits (135),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQE  186



>ref|XP_011006208.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X2 [Populus euphratica]
Length=382

 Score =   203 bits (517),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y D ETF+L+GKEHAL+ISNH+SD+DW+VGW+LAQRSGCLGS LAVMKK +  LPVIGW
Sbjct  71   VYADDETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+FLERSW KDE TL+
Sbjct  131  SMWFSDYVFLERSWGKDERTLQ  152


 Score = 59.7 bits (143),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G + L+D+P+PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGFEWLEDFPMPFWLALFVEGTRFTQAKLLAAQE  186



>gb|KHN33345.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Glycine soja]
Length=381

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 124/155 (80%), Gaps = 3/155 (2%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA+ +V++RP SK+ Y RIN+L  E LWLEL+WLIDWWAG+K++
Sbjct  11   PLGILFILSGLIVNIIQAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET +LMGKE+AL+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GW
Sbjct  71   LYTDSETLQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKVLKGYR-ITHFLF  498
            SM+F+EY+FLER WAKDE++LK   G+R + H  F
Sbjct  131  SMWFAEYIFLERDWAKDETSLK--SGFRHLEHMPF  163


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G + L+  P PFWLALFVEGTRFTQ KLL AQ+
Sbjct  153  SGFRHLEHMPFPFWLALFVEGTRFTQTKLLQAQE  186



>ref|XP_003547001.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X1 [Glycine max]
Length=381

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 124/155 (80%), Gaps = 3/155 (2%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA+ +V++RP SK+ Y RIN+L  E LWLEL+WLIDWWAG+K++
Sbjct  11   PLGILFILSGLIVNIIQAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET +LMGKE+AL+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GW
Sbjct  71   LYTDSETLQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKVLKGYR-ITHFLF  498
            SM+F+EY+FLER WAKDE++LK   G+R + H  F
Sbjct  131  SMWFAEYIFLERDWAKDETSLK--SGFRHLEHMPF  163


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G + L+  P PFWLALFVEGTRFTQ KLL AQ+
Sbjct  153  SGFRHLEHMPFPFWLALFVEGTRFTQTKLLQAQE  186



>ref|XP_008227141.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Prunus mume]
Length=380

 Score =   204 bits (520),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +Q + ++++RP SK  YR+IN++ AELLWLE +WLIDWWAG+KV+
Sbjct  11   PIGVLFILSGLIVNLMQVVSFILLRPISKKLYRKINKVVAELLWLEPIWLIDWWAGIKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D +TF+LMGKEHAL+I NHRSDIDW+VGW++AQRSGCLGS LA+MKK   +LPVIGW
Sbjct  71   LYVDSDTFQLMGKEHALVICNHRSDIDWLVGWLIAQRSGCLGSALAIMKKEVKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEY FLER W KDE TLK
Sbjct  131  SMWFSEYFFLERRWTKDEITLK  152


 Score = 58.2 bits (139),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G ++L+D+P+PFWLALFVEGTRFTQAKL+ AQ+
Sbjct  153  SGFQQLEDFPMPFWLALFVEGTRFTQAKLMVAQE  186



>ref|XP_011006207.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X1 [Populus euphratica]
Length=382

 Score =   203 bits (516),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y D ETF+L+GKEHAL+ISNH+SD+DW+VGW+LAQRSGCLGS LAVMKK +  LP+IGW
Sbjct  71   VYADDETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+FLERSW KDE TL+
Sbjct  131  SMWFSDYVFLERSWGKDERTLQ  152


 Score = 59.7 bits (143),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G + L+D+P+PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGFEWLEDFPMPFWLALFVEGTRFTQAKLLAAQE  186



>gb|ABA94922.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAH01342.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   203 bits (516),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            NAIQA+ ++ IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 59.7 bits (143),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_011006209.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X3 [Populus euphratica]
Length=340

 Score =   203 bits (516),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y D ETF+L+GKEHAL+ISNH+SD+DW+VGW+LAQRSGCLGS LAVMKK +  LP+IGW
Sbjct  71   VYADDETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+FLERSW KDE TL+
Sbjct  131  SMWFSDYVFLERSWGKDERTLQ  152


 Score = 59.7 bits (143),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G + L+D+P+PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGFEWLEDFPMPFWLALFVEGTRFTQAKLLAAQE  186



>gb|EEC68515.1| hypothetical protein OsI_36790 [Oryza sativa Indica Group]
Length=374

 Score =   202 bits (515),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            NAIQA+ ++ IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 59.7 bits (143),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>gb|EEE52425.1| hypothetical protein OsJ_34550 [Oryza sativa Japonica Group]
Length=409

 Score =   202 bits (515),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            NAIQA+ ++ IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 59.7 bits (143),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_002298406.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE83211.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=382

 Score =   200 bits (509),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y D ETF+L+GKEHAL+ISNH SD+DW+VGW+LAQRSGCLGS LAVMKK +  LP+IGW
Sbjct  71   VYADDETFELLGKEHALVISNHNSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+FLERSW KDE  L+
Sbjct  131  SMWFSDYVFLERSWGKDERILQ  152


 Score = 62.0 bits (149),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G +RL D+P+PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  153  SGFERLADFPMPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_010461958.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Camelina 
sativa]
Length=376

 Score =   206 bits (523),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  19   GGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWW  198
                + P G  FL      N IQ + ++ +RPFS+S YRRIN+  AELLWL+L+WL DWW
Sbjct  5    AALVFIPVGVLFLISGLIVNIIQLVFFITVRPFSRSWYRRINKTVAELLWLQLIWLFDWW  64

Query  199  AGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVY  378
            A +K+ LY D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + Y
Sbjct  65   ACIKINLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKY  124

Query  379  LPVIGWSMFFSEYLFLERSWAKDESTLK  462
            LP+IGWSM+FS+Y+FLERSWAKDE+ LK
Sbjct  125  LPIIGWSMWFSDYIFLERSWAKDENNLK  152


 Score = 56.2 bits (134),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQE  186



>ref|XP_010237505.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X2 [Brachypodium distachyon]
Length=310

 Score =   202 bits (514),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  70   FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  249
              NA+QA+ +V IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D E+++ M
Sbjct  22   IVNAVQAVLFVSIRPFSKSFYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADEESYQSM  81

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            GKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GKEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  430  RSWAKDESTLK  462
            RSWAKDE TLK
Sbjct  142  RSWAKDEKTLK  152


 Score = 60.1 bits (144),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_008813484.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Phoenix dactylifera]
Length=343

 Score =   201 bits (512),  Expect(3) = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQA C+V+IRPFSK+ YR+INR+ AELLWL+LVWL+DWWAGVKV LY D ET+K +GK
Sbjct  24   NLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVHLYADSETYKSLGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+I NHRSDIDW+VGW+LAQRSGCLGST+AVMKKSS +LPVIGWSM+F+EYLFLER+
Sbjct  84   EHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLERN  143

Query  436  WAKDESTLKV  465
            WAKDE+TLK+
Sbjct  144  WAKDENTLKL  153


 Score = 57.0 bits (136),  Expect(3) = 4e-61, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+R +D+P PFWLALFVEGTRFT  KLLAAQ+
Sbjct  154  GLQRFRDFPRPFWLALFVEGTRFTPTKLLAAQE  186


 Score = 24.6 bits (52),  Expect(3) = 4e-61, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 11/18 (61%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   YAAS GLP PR
Sbjct  180  KLLAAQEYAASQGLPTPR  197



>ref|XP_003577308.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Brachypodium distachyon]
Length=374

 Score =   202 bits (513),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            NA+QA+ +V IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D E+++ MGK
Sbjct  24   NAVQAVLFVSIRPFSKSFYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADEESYQSMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  144  WAKDEKTLK  152


 Score = 60.1 bits (144),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>gb|AHC70248.1| lysophosphatidic acid acyltransferase [Sterculia foetida]
Length=387

 Score =   200 bits (508),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+V+IRP SK TYR+IN++ AELLWLEL+WL+DWWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVLIRPLSKKTYRKINKVVAELLWLELIWLVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++ D E+F LMGKEHAL+++NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGW
Sbjct  71   VFADHESFNLMGKEHALVVANHRSDIDWLVGWVLAQRSGCLGSSVAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  131  SMWFSEYLFLERNWAKDESTLK  152


 Score = 62.0 bits (149),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GLQRLKDFPQPFWLALFVEGTRFTQAKLLAAQE  186



>ref|XP_007150370.1| hypothetical protein PHAVU_005G147900g [Phaseolus vulgaris]
 gb|ESW22364.1| hypothetical protein PHAVU_005G147900g [Phaseolus vulgaris]
Length=379

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQAI ++++RP SK+ YRR+N+L  E LWL+L+WLIDWWAG+K++
Sbjct  10   PIGILFILSGLIVNIIQAIFFLLLRPISKNCYRRVNKLLTESLWLQLIWLIDWWAGIKIE  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+TD ETF+LMGKE+AL+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GW
Sbjct  70   LHTDSETFQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEIKFLPVLGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+F+EY+FLER+W KDE++LK
Sbjct  130  SMWFAEYIFLERNWKKDETSLK  151


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
               K L+  PLPFWLALFVEGTRFTQ KLL AQ+
Sbjct  152  SNFKHLEHMPLPFWLALFVEGTRFTQTKLLQAQE  185



>ref|XP_006663068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Oryza brachyantha]
Length=374

 Score =   201 bits (512),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  70   FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  249
              NAIQA+ ++ IRPFSK+ YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K M
Sbjct  22   IVNAIQAVLFLSIRPFSKNLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKSM  81

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            G EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GTEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  430  RSWAKDESTLK  462
            RSWAKDE TLK
Sbjct  142  RSWAKDEKTLK  152


 Score = 60.1 bits (144),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_009395596.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score =   201 bits (510),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  70   FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  249
              N +QA+C++ IR FSKS YRRINR+ AELLWL+LVWL+DWWAGVK+Q+Y D +TF+ M
Sbjct  22   IVNVVQAVCFITIRLFSKSLYRRINRVLAELLWLQLVWLVDWWAGVKIQVYADSKTFESM  81

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            G+EHAL+ISNHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GEEHALVISNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  430  RSWAKDESTLKV  465
            RSWAKDE+TLK+
Sbjct  142  RSWAKDETTLKL  153


 Score = 60.1 bits (144),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_008813483.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Phoenix dactylifera]
Length=374

 Score =   201 bits (510),  Expect(3) = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQA C+V+IRPFSK+ YR+INR+ AELLWL+LVWL+DWWAGVKV LY D ET+K +GK
Sbjct  24   NLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVHLYADSETYKSLGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL+I NHRSDIDW+VGW+LAQRSGCLGST+AVMKKSS +LPVIGWSM+F+EYLFLER+
Sbjct  84   EHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLERN  143

Query  436  WAKDESTLKV  465
            WAKDE+TLK+
Sbjct  144  WAKDENTLKL  153


 Score = 56.6 bits (135),  Expect(3) = 8e-61, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+R +D+P PFWLALFVEGTRFT  KLLAAQ+
Sbjct  154  GLQRFRDFPRPFWLALFVEGTRFTPTKLLAAQE  186


 Score = 24.6 bits (52),  Expect(3) = 8e-61, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 11/18 (61%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   YAAS GLP PR
Sbjct  180  KLLAAQEYAASQGLPTPR  197



>ref|XP_004503603.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Cicer arietinum]
Length=380

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQ + +V+ RP S+  YR+IN++  E+LWLEL+WL+DWWAGVK++
Sbjct  11   PLGTLFILSGLIVNVIQVVIFVLFRPISRYYYRKINKVLTEILWLELIWLVDWWAGVKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ETF+L+G+E+ALLI NHRSDIDW++GW LAQRSGCLGST+A+MKK   YLPV+GW
Sbjct  71   LYTDSETFELLGRENALLICNHRSDIDWLIGWTLAQRSGCLGSTVAIMKKEVKYLPVLGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+F+++LFLER+WAKDE TLK
Sbjct  131  SMWFADFLFLERNWAKDEVTLK  152


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G K+    P+PFW+ALFVEGTRFTQ+KLLAAQD
Sbjct  154  GFKQQVQNPVPFWMALFVEGTRFTQSKLLAAQD  186



>ref|XP_010673624.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=383

 Score =   203 bits (517),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQAI YV++RP SK+ +RR N++ AELLWLE VWL DWWAGVKV+
Sbjct  11   PVGLLFLMSGLIINLIQAILYVLVRPLSKNMHRRFNKVVAELLWLETVWLFDWWAGVKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+TD ETF LMGKEHALLI NHRSDIDW++GWVLAQR+GCLG T+A+MK    YLPVIGW
Sbjct  71   LHTDSETFHLMGKEHALLICNHRSDIDWLIGWVLAQRAGCLGCTMAIMKDVLKYLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTL  459
            SM+FSEY+F++R W  D+STL
Sbjct  131  SMWFSEYIFIKRRWDVDQSTL  151


 Score = 55.8 bits (133),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
             G + L+D+P+PFWLALFVEGTRFTQ+KLL AQ
Sbjct  153  SGCENLKDFPVPFWLALFVEGTRFTQSKLLDAQ  185



>ref|XP_006304715.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
 gb|EOA37613.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
Length=376

 Score =   202 bits (515),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  FL      N IQ   ++++RPFS+S YRRIN+  AELLWL+L+WL  WWA +K
Sbjct  9    FIPVGVLFLVSGLIVNIIQLFFFIIVRPFSRSLYRRINKTIAELLWLQLIWLFHWWACIK  68

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            + LY D ET + +GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+I
Sbjct  69   INLYADAETLEFIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GWSM+FS+Y+FLERSWAKDE+TL+
Sbjct  129  GWSMWFSDYIFLERSWAKDENTLE  152


 Score = 56.2 bits (134),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQE  186



>ref|XP_003636648.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
Length=438

 Score =   197 bits (501),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 121/136 (89%), Gaps = 4/136 (3%)
 Frame = +1

Query  67   SFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKV----QLYTDPE  234
             + + + AICYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKV    ++YTD E
Sbjct  50   QYIHELHAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVLKQVEIYTDRE  109

Query  235  TFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSE  414
            T +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSE
Sbjct  110  TSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSE  169

Query  415  YLFLERSWAKDESTLK  462
            YLFLERSWAKDE+TLK
Sbjct  170  YLFLERSWAKDENTLK  185


 Score = 61.6 bits (148),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL D+PLPFWLALFVEGTRFT  KLLAAQ+
Sbjct  186  SGIRRLNDFPLPFWLALFVEGTRFTNVKLLAAQE  219



>gb|EPS68644.1| lysophosphatidic acid acyltransferase, partial [Genlisea aurea]
Length=365

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  1    FRHGDCGGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELV  180
            F           P G  F       N IQA+CY++IRP+S++ YR IN+  AELLWLELV
Sbjct  2    FHMATAAALVILPLGVLFFISGLVVNLIQALCYLLIRPWSRNIYRIINKSVAELLWLELV  61

Query  181  WLIDWWAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVM  360
            WL+DWWAGVK+++Y DPE+FK MGKEHAL++SNHRSDIDW+VGWVLAQRSGCLGSTLAVM
Sbjct  62   WLVDWWAGVKIEVYADPESFKFMGKEHALVMSNHRSDIDWLVGWVLAQRSGCLGSTLAVM  121

Query  361  KKSSVYLPVIGWSMFFSEYLFLERSWAKDESTLKVLKGY-RITHF  492
            KKSS++LPVIGWSM+FSEY+FLERSWAKDE+TLKV  GY R++ F
Sbjct  122  KKSSMFLPVIGWSMWFSEYVFLERSWAKDENTLKV--GYQRLSDF  164


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G +RL D+P PFWLALFVEGTRFTQAKL AAQ+
Sbjct  157  GYQRLSDFPRPFWLALFVEGTRFTQAKLFAAQE  189



>ref|XP_010500700.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score =   202 bits (515),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +1

Query  28   CYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGV  207
             + P G  FL      N IQ + ++ +RPFS+S YRRIN+  AELLWL+L+WL DWWA +
Sbjct  8    VFIPVGVLFLISGLIVNIIQLVFFITVRPFSRSLYRRINKTVAELLWLQLIWLFDWWACI  67

Query  208  KVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPV  387
            K+ LY D ET + +GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+
Sbjct  68   KINLYADAETLERIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPI  127

Query  388  IGWSMFFSEYLFLERSWAKDESTLK  462
            IGWSM+FS+Y FLERSWAKDE+ LK
Sbjct  128  IGWSMWFSDYSFLERSWAKDENNLK  152


 Score = 55.1 bits (131),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL  AQ+
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEVAQE  186



>ref|XP_010672763.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=391

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 127/144 (88%), Gaps = 4/144 (3%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA C+V++RP SKSTYRRINRL AELLWLELVWL+DWWA V+V+++TDPETF+ MGK
Sbjct  24   NVLQATCFVLVRPLSKSTYRRINRLVAELLWLELVWLVDWWARVQVKVFTDPETFRQMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL++ NH+SDIDW+VGWVLAQR+GCLGSTLAVMKKSS  LPVIGWSM+FSEYLFLERS
Sbjct  84   EHALVVCNHKSDIDWLVGWVLAQRAGCLGSTLAVMKKSSKMLPVIGWSMWFSEYLFLERS  143

Query  436  WAKDESTLKV----LKGYRITHFL  495
            WAKDEST+K+    LK Y +  +L
Sbjct  144  WAKDESTIKLGLERLKDYPLPFWL  167


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  154  GLERLKDYPLPFWLALFVEGTRFTQAKLLAAQE  186



>gb|ADE75797.1| unknown [Picea sitchensis]
Length=385

 Score =   196 bits (498),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA+CY+++RPFSK+ YR  NR+ AELLWLELVWL DWWAGVK++
Sbjct  11   PMGALFLLSGLIVNCIQALCYIILRPFSKNLYRMANRVVAELLWLELVWLFDWWAGVKIR  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y DP   + MGKEHAL+ISNHRSD+DW+VGWVLAQRSGCLGS LAVMKKSS +LPV+GW
Sbjct  71   IYADPGILQHMGKEHALVISNHRSDVDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVMGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEY+FLER+WAKDE+TLK
Sbjct  131  SMWFSEYVFLERNWAKDETTLK  152


 Score = 60.8 bits (146),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GLK+L+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  153  SGLKKLRDFPRPFWLALFVEGTRFTNAKLLAAQE  186



>ref|XP_010102333.1| Xanthine dehydrogenase [Morus notabilis]
 gb|EXB93294.1| Xanthine dehydrogenase [Morus notabilis]
Length=1731

 Score =   190 bits (483),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +QA+ ++++RP SK TYRRIN++ AELLWLEL+WLIDWWAG+K++
Sbjct  11   PIGILFIFSGFLVNFLQAMLFILVRPISKRTYRRINKVIAELLWLELIWLIDWWAGIKIE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQR+GCLGS LA+MKK + +LP+IGW
Sbjct  71   VHTDSETFSLMGKEHALVISNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPIIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKVLKGYR  480
            SM+FS+Y+FLER WA DESTLK   G+R
Sbjct  131  SMWFSDYVFLERKWAIDESTLK--SGFR  156


 Score = 64.7 bits (156),  Expect(2) = 5e-59, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            G +RL+D+P+PFWLALFVEGTRFTQAKL AAQ
Sbjct  154  GFRRLEDFPMPFWLALFVEGTRFTQAKLAAAQ  185



>ref|XP_010031802.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Eucalyptus grandis]
Length=380

 Score =   195 bits (495),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +QA  YV+IRP SK TYR+IN++ AELL LEL+WL DWWAG+KV+
Sbjct  11   PIGMLFILSGLLVNLVQAFFYVLIRPLSKKTYRKINKVVAELLLLELIWLFDWWAGIKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D +TF++MGKEHALLI NHRSDIDW+VGWV+AQR+GCLGS LA+MKK + +LPV+GW
Sbjct  71   LYMDSQTFEMMGKEHALLICNHRSDIDWLVGWVIAQRAGCLGSALAIMKKEAKFLPVVGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+F++R WAKDE+TLK
Sbjct  131  SMWFSDYVFVDRCWAKDENTLK  152


 Score = 59.3 bits (142),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G +RL D+P+PFWLALFVEGTRFTQAKL AAQ+
Sbjct  153  SGFERLSDFPMPFWLALFVEGTRFTQAKLQAAQE  186



>ref|XP_006597258.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X2 [Glycine max]
Length=450

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 6/174 (3%)
 Frame = +1

Query  85   QAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHA  264
            QA+ +V++RP SK+ Y RIN+L  E LWLEL+WLIDWWAG+K++LYTD ET +LMGKE+A
Sbjct  96   QAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIELYTDSETLQLMGKENA  155

Query  265  LLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAK  444
            L+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GWSM+F+EY+FLER WAK
Sbjct  156  LVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGWSMWFAEYIFLERDWAK  215

Query  445  DESTLKVLKGYR-ITHFLFGWHFLLKALALHRQSF*LLKICCIYRFTNSKDVLI  603
            DE++LK   G+R + H  F +     AL +    F   K+     F  SK + I
Sbjct  216  DETSLK--SGFRHLEHMPFPFWL---ALFVEGTRFTQTKLLQAQEFAASKGLPI  264


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G + L+  P PFWLALFVEGTRFTQ KLL AQ+
Sbjct  223  GFRHLEHMPFPFWLALFVEGTRFTQTKLLQAQE  255



>ref|XP_007028850.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
 gb|EOY09352.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
Length=401

 Score =   194 bits (492),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 14/156 (9%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+V+IRP SK+TYR+INR+ AELLWLELVWL+DWWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQALCFVLIRPLSKNTYRKINRVVAELLWLELVWLVDWWAGVKIK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP----  384
            ++ DPE+F LMGKEHAL+++NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LP    
Sbjct  71   VFMDPESFNLMGKEHALVVANHRSDIDWLVGWLLAQRSGCLGSALAVMKKSSKFLPVYVV  130

Query  385  ----------VIGWSMFFSEYLFLERSWAKDESTLK  462
                      VIGWSM+FSEYLFLERSWAKDE+TLK
Sbjct  131  VICLKFQLSIVIGWSMWFSEYLFLERSWAKDENTLK  166


 Score = 58.9 bits (141),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLA FVEGTRFTQAK LAAQ+
Sbjct  168  GLQRLKDFPRPFWLAFFVEGTRFTQAKFLAAQE  200



>ref|XP_002526730.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|ACC59198.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ricinus communis]
 gb|EEF35644.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|AFR42413.1| A-class lysophosphatidate acyltransferase-2 [Ricinus communis]
Length=395

 Score =   194 bits (492),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N  QAIC+V+IRP SKS+YR INR  AELLWLELVWL+DWWA +K+Q
Sbjct  11   PLGVLFFLSGLVVNLFQAICFVLIRPISKSSYRMINRALAELLWLELVWLVDWWAKIKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTD ET  LMGKEHAL+++NHRSDIDW+VGW+LAQR+GCLGS LAVMKKSS +LPVIGW
Sbjct  71   VYTDRETLCLMGKEHALILANHRSDIDWLVGWMLAQRAGCLGSALAVMKKSSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLERSWAKDESTLK
Sbjct  131  SMWFSEYLFLERSWAKDESTLK  152


 Score = 58.2 bits (139),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
             G++RL+D+P PFWL LFVEGTRFT+AKLLAAQ
Sbjct  153  SGIQRLKDFPRPFWLGLFVEGTRFTKAKLLAAQ  185



>ref|XP_010909860.1| PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-glycerol-3-phosphate 
acyltransferase PLS1-like [Elaeis guineensis]
Length=373

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 8/159 (5%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N IQA C+V+IRPFSK+ YR+INR+ AELLWL+LVWL+DWWAGVKVQLY D ET+K +G
Sbjct  23   VNLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVQLYADSETYKSLG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL+I NH+SDIDW+V W+LAQRSGCLGST+AVMKKSS +L VIGWSM+F+EYLFLER
Sbjct  83   KEHALVICNHKSDIDWLVRWILAQRSGCLGSTVAVMKKSSKFLRVIGWSMWFAEYLFLER  142

Query  433  SWAKDESTLKV-LKGYR-------ITHFLFGWHFLLKAL  525
            SWAKDE+TLK+ L+ +R       +  F+ G HF L  L
Sbjct  143  SWAKDENTLKLGLQRFRDFPRPFWLALFVEGTHFTLAKL  181


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+R +D+P PFWLALFVEGT FT AKLLAAQ+
Sbjct  154  GLQRFRDFPRPFWLALFVEGTHFTLAKLLAAQE  186



>ref|XP_002513487.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|EEF48890.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
Length=381

 Score =   189 bits (480),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N IQA+ ++++RP SKS +RRIN++ AELLWLEL+WL+DWWA +K+++Y D ETF+LMG
Sbjct  23   VNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIWLVDWWAHLKIEVYADDETFELMG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHALLI NHRSDIDW+VGW+LAQRSGCLGS LAVMKK +  LP+IGWSM+FS+YLFLER
Sbjct  83   KEHALLICNHRSDIDWLVGWILAQRSGCLGSALAVMKKQAKVLPIIGWSMWFSDYLFLER  142

Query  433  SWAKDESTLK  462
            SWAKDE+TLK
Sbjct  143  SWAKDETTLK  152


 Score = 60.8 bits (146),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G KRL+D+P+PFWLALFVEGTRFT+AKL AAQ+
Sbjct  153  SGFKRLEDFPMPFWLALFVEGTRFTEAKLQAAQE  186



>ref|XP_010906759.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Elaeis guineensis]
Length=374

 Score =   191 bits (486),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N IQA C+V+IRP SK+ YRRINR+ AELLWLELVWL+DWWAGVKVQLY D ET+  +G
Sbjct  23   VNLIQATCFVMIRPLSKNLYRRINRVVAELLWLELVWLLDWWAGVKVQLYADSETYASLG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL+I NHRSDIDW+VGW+LAQRSGCLGST+AVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLER  142

Query  433  SWAKDESTLKV  465
            SWAKDESTLK+
Sbjct  143  SWAKDESTLKL  153


 Score = 58.5 bits (140),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+R +D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRFRDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_011080283.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=377

 Score =   189 bits (481),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  19   GGSCYRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWW  198
              + + P G  FL      N IQA+ +V+IRP SKS YRRIN+   ELLWLEL+WL DWW
Sbjct  4    AAAVFLPLGILFLLSGFIVNLIQAVLFVLIRPVSKSAYRRINKEIIELLWLELIWLFDWW  63

Query  199  AGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVY  378
            A +KV+L+ D ETF L+GKE ALLI NHRSDIDW+VGWVLAQR+GCLGS+LA++KKSS++
Sbjct  64   ANIKVELFVDQETFDLLGKERALLICNHRSDIDWLVGWVLAQRAGCLGSSLAMIKKSSLF  123

Query  379  LPVIGWSMFFSEYLFLERSWAKDESTLK  462
            LPVIGWSM+FS+Y+FLERSWAKDE+TLK
Sbjct  124  LPVIGWSMWFSDYIFLERSWAKDENTLK  151


 Score = 59.7 bits (143),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL  L DYPLPFWLALFVEGTRFTQAKL AAQ+
Sbjct  152  SGLVALNDYPLPFWLALFVEGTRFTQAKLEAAQE  185



>ref|XP_006393066.1| hypothetical protein EUTSA_v10011593mg [Eutrema salsugineum]
 gb|ESQ30352.1| hypothetical protein EUTSA_v10011593mg [Eutrema salsugineum]
Length=365

 Score =   190 bits (482),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  FL      N IQ + ++++RPFS+S YRRIN+  AELLWL+L+WLIDWWA +K
Sbjct  9    FIPVGVLFLISGLIVNLIQLVFFIIVRPFSRSLYRRINKTVAELLWLQLIWLIDWWACIK  68

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            + LY D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+I
Sbjct  69   INLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GWSM+FS+Y+FLERSWAKDE+TLK
Sbjct  129  GWSMWFSDYIFLERSWAKDENTLK  152


 Score = 58.2 bits (139),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KRL+D+P+ FWLALFVEGTRFTQ KL AAQD
Sbjct  154  GFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQD  186



>ref|XP_008801931.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X2 [Phoenix dactylifera]
Length=343

 Score =   189 bits (481),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA C+V+IRP SK+ YR+INR+ AELLWL+LVWL+DWWAGVKVQ
Sbjct  11   PIGLLFLLSGLVVNLIQATCFVMIRPLSKNLYRKINRVVAELLWLQLVWLLDWWAGVKVQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ET+  +GKEHAL+I NHRSDIDW+VGW+LAQRSGCLGS +AVMKK+S +LPVIGW
Sbjct  71   LYADSETYASLGKEHALVICNHRSDIDWLVGWILAQRSGCLGSAIAVMKKTSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            SM+F+EYLFLERSWAKDE+TLK+
Sbjct  131  SMWFAEYLFLERSWAKDENTLKL  153


 Score = 58.5 bits (140),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+R +D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRFRDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_008801930.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Phoenix dactylifera]
Length=374

 Score =   189 bits (479),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA C+V+IRP SK+ YR+INR+ AELLWL+LVWL+DWWAGVKVQ
Sbjct  11   PIGLLFLLSGLVVNLIQATCFVMIRPLSKNLYRKINRVVAELLWLQLVWLLDWWAGVKVQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ET+  +GKEHAL+I NHRSDIDW+VGW+LAQRSGCLGS +AVMKK+S +LPVIGW
Sbjct  71   LYADSETYASLGKEHALVICNHRSDIDWLVGWILAQRSGCLGSAIAVMKKTSKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            SM+F+EYLFLERSWAKDE+TLK+
Sbjct  131  SMWFAEYLFLERSWAKDENTLKL  153


 Score = 58.2 bits (139),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+R +D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLQRFRDFPRPFWLALFVEGTRFTPAKLLAAQE  186



>ref|XP_009375057.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Pyrus 
x bretschneideri]
Length=380

 Score =   186 bits (471),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +Q +C++++RP SKS YR+IN++ AELLWLEL+WLIDWWAG+KV+
Sbjct  11   PVGVLFILSGLIVNLMQIVCFLLVRPVSKSMYRKINKVVAELLWLELIWLIDWWAGIKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D +TF+LMG+EHAL+ISNH+SDIDW+VGW++AQR+GCLGS LA++KK  ++LPVIGW
Sbjct  71   LYVDSKTFQLMGQEHALVISNHKSDIDWLVGWLVAQRTGCLGSALAIIKKEIMFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKVLKGYR  480
            SM+FS+Y+FLER W KDESTLK   G+R
Sbjct  131  SMWFSDYVFLERRWTKDESTLK--SGFR  156


 Score = 61.2 bits (147),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G +RL+D+P+PFWLALFVEGTRFTQAKL+ AQ+
Sbjct  153  SGFRRLEDFPMPFWLALFVEGTRFTQAKLMVAQE  186



>ref|XP_002443267.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
 gb|EES17105.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
Length=374

 Score =   189 bits (479),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             NAIQAI  V +RP SKS YRRINR   ELLWL+L+WL+DWWA VKVQL+ D ET++LMG
Sbjct  23   VNAIQAILLVSVRPLSKSLYRRINRFLVELLWLQLIWLLDWWAVVKVQLHADQETYQLMG  82

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLA+MKKSS +LPVIGWSM+FSEYLFLER
Sbjct  83   KEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAIMKKSSKFLPVIGWSMWFSEYLFLER  142

Query  433  SWAKDESTLK  462
            SWAKDE TLK
Sbjct  143  SWAKDEKTLK  152


 Score = 57.8 bits (138),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P  FWLALFVEGTRFT AKLLAAQ+
Sbjct  154  GLRRLKDFPRSFWLALFVEGTRFTPAKLLAAQE  186



>emb|CDY65469.1| BnaA08g29540D [Brassica napus]
Length=358

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQ + ++ +RP S++ YRR N    ELLWL+L+WL+DWWA +K+ 
Sbjct  43   PFGLLFLVSGLIINLIQLVLFIFVRPVSRNVYRRTNTSVVELLWLQLIWLVDWWAFMKIN  102

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D E  +L+GKEHAL++SNHR DIDW+VGWV+AQRSGCLGSTLA+M+K + Y P+IGW
Sbjct  103  LYADAEALELLGKEHALVLSNHRGDIDWLVGWVMAQRSGCLGSTLAIMRKEAKYFPIIGW  162

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            SM+FSEY+FLE++WAKDE  LK 
Sbjct  163  SMWFSEYIFLEKNWAKDEKILKA  185



>ref|XP_006470598.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=426

 Score =   183 bits (464),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N+IQA+ ++++RP SK  YRRIN++  ELLWLEL+WLIDWWA +KV+
Sbjct  48   PIGMLFILSGLIVNSIQAVLFILVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVE  107

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ETF+LMGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGW
Sbjct  108  LYADAETFQLMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGW  167

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEY+FLER W KDE TLK
Sbjct  168  SMWFSEYVFLERRWNKDEQTLK  189


 Score = 60.8 bits (146),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G KRL D+P+PFWLAL+VEGTRFT+AKLLAAQ+
Sbjct  190  SGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQE  223



>ref|XP_006446109.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59349.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=390

 Score =   183 bits (464),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N+IQA+ +V++RP SK  YRRIN++  ELLWLEL+WLIDWWA +KV+
Sbjct  11   PIGMLFILSGLIVNSIQAVLFVLVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ETF+LMGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGW
Sbjct  71   LYADAETFQLMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEY+FLER W KDE TLK
Sbjct  131  SMWFSEYVFLERRWNKDEQTLK  152


 Score = 60.8 bits (146),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G KRL D+P+PFWLAL+VEGTRFT+AKLLAAQ+
Sbjct  153  SGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQE  186



>ref|XP_006361745.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Solanum tuberosum]
Length=377

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA+ ++++RPFS + +RRIN+  AELLWLE+VWL DWWA VKV+
Sbjct  10   PIGLLFLLSGLIINFIQALLFILVRPFSNNIFRRINKEVAELLWLEIVWLFDWWANVKVE  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET+ +MGKE AL+ISNHRSDIDW+VGWVLAQR GCLG+T+A+ KKS  YLPV+GW
Sbjct  70   LYTDQETYGIMGKEPALIISNHRSDIDWLVGWVLAQRVGCLGNTIALAKKSLSYLPVLGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS  + LERSW KDE+ LK
Sbjct  130  SMWFSCCISLERSWNKDENILK  151


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G + L D+  PFWLA+FVEGTRFT  KLLAAQ+
Sbjct  152  SGFQELNDFHQPFWLAVFVEGTRFTHTKLLAAQE  185



>ref|XP_010545584.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
 ref|XP_010545585.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
Length=380

 Score =   188 bits (478),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  112  PFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALLISNHRSD  291
            P S++ YRRIN+   ELLW++L+WL+DWWA  KV LY D ET + +GKEHALLI NHRSD
Sbjct  36   PISRNLYRRINKAVVELLWMQLIWLVDWWAATKVNLYIDAETLESLGKEHALLICNHRSD  95

Query  292  IDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDESTLK  462
            IDW++GWVLAQR+GCLGS+LA+MKK + YLP+IGWSM+FSEY+FLERSW+KDE+TLK
Sbjct  96   IDWLIGWVLAQRAGCLGSSLAMMKKEAKYLPIIGWSMWFSEYIFLERSWSKDETTLK  152


 Score = 54.7 bits (130),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GLK+L+++P PFWLALFVEGTRFTQ KL AA++
Sbjct  154  GLKQLENFPTPFWLALFVEGTRFTQQKLEAAKE  186



>ref|XP_004250948.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Solanum lycopersicum]
Length=377

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQ + ++++RPFSK+ +RRIN+  AELLWLE++WL DWWA VKV+
Sbjct  10   PIGLIFLLSGLIINFIQVVLFILVRPFSKNIFRRINKEVAELLWLEIIWLFDWWANVKVE  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET+ ++GKE AL+ISNHRSDIDW+VGWVLAQR GCLG T+A+ KKS  YLPV+GW
Sbjct  70   LYTDQETYGILGKEPALIISNHRSDIDWLVGWVLAQRVGCLGYTIALAKKSLSYLPVLGW  129

Query  397  SMFFSEYLFLERSWAKDESTLKVLKGYR  480
            SM+FS  + LERSW KDE+ LK   G+R
Sbjct  130  SMWFSSLISLERSWNKDENILK--SGFR  155



>ref|XP_007015031.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
 gb|EOY32650.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
Length=379

 Score =   181 bits (458),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA+  V++RP SKS YRR N++  ELLWLEL+WLIDWWA +K+ 
Sbjct  11   PVGVLFILSGLIVNLIQAVLLVLLRPLSKSLYRRTNKVIVELLWLELIWLIDWWASIKID  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD  TF+LMGKEHAL+I NHRSDIDW+VGWVLAQRS CLGS LA++K+S+ +LP+IGW
Sbjct  71   LYTDAATFQLMGKEHALVICNHRSDIDWLVGWVLAQRSSCLGSALAIIKRSAKFLPIIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+FLERSWAKD+ TLK
Sbjct  131  SMWFSDYVFLERSWAKDKETLK  152


 Score = 61.2 bits (147),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G K+L+D+P+PFWLALFVEGTRFTQAKLL AQD
Sbjct  154  GFKQLEDFPMPFWLALFVEGTRFTQAKLLLAQD  186



>ref|XP_007214575.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
 gb|EMJ15774.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
Length=380

 Score =   182 bits (463),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +Q + ++++RP SK  YR+IN++ AELLWLEL+WLIDWWAG+KV+
Sbjct  11   PIGVVFILSGLIVNLMQVVSFILLRPISKKLYRKINKVVAELLWLELIWLIDWWAGIKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D +TF+LMGKEHAL+I NHRSDIDW+VGW++AQRSGCLGS LA+MKK  ++LPVIGW
Sbjct  71   LYVDSDTFQLMGKEHALVICNHRSDIDWLVGWLVAQRSGCLGSALAIMKKEVMFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEY FLER W KDE TLK
Sbjct  131  SMWFSEYFFLERRWTKDEITLK  152


 Score = 58.5 bits (140),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G ++L+D+P+PFWLALFVEGTRFTQAKL+ AQ+
Sbjct  153  SGFQQLEDFPMPFWLALFVEGTRFTQAKLMVAQE  186



>emb|CDY35563.1| BnaC05g27180D [Brassica napus]
Length=376

 Score =   185 bits (469),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  FL      N IQ + ++++RPFSKS YRRIN+   ELLWL+L+WLIDWWA +K
Sbjct  9    FVPVGVLFLVSGLIVNLIQLVFFIIVRPFSKSLYRRINKNVVELLWLQLIWLIDWWACIK  68

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            V LY D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+I
Sbjct  69   VNLYADAETLQLLGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  391  GWSMFFSEYLFLERSWAKDESTL  459
            GWSM+FS+Y+FLERSW KDE TL
Sbjct  129  GWSMWFSDYIFLERSWDKDEKTL  151


 Score = 55.5 bits (132),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQDMLHLQ  575
            G KR +D+P+ FWLALFVEGTRFTQ KL AAQ+  +++
Sbjct  154  GFKRFEDFPMTFWLALFVEGTRFTQEKLEAAQEYAYIR  191



>emb|CDY03631.1| BnaC03g68900D [Brassica napus]
Length=378

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQ + ++ +RP S+S YR IN    ELLWL+L+WL+DWWA +KV LY D ET +L+GK
Sbjct  54   NLIQLVLFIFVRPVSRSLYRGINTSVVELLWLQLIWLVDWWAFIKVNLYADAETLELLGK  113

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHAL++SNHR DIDW+VGWV+AQ SGCLGSTLA+M+K + Y P+IGWSM+FSEY+ LE++
Sbjct  114  EHALVLSNHRGDIDWLVGWVMAQHSGCLGSTLAIMRKEAKYFPIIGWSMWFSEYIILEKN  173

Query  436  WAKDESTLKV----LKGYRITHFL  495
            WAKDE  LK     LK +  T +L
Sbjct  174  WAKDEKILKAGFNQLKDFPTTFWL  197



>ref|XP_009144912.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Brassica 
rapa]
 emb|CDY29625.1| BnaA05g15450D [Brassica napus]
Length=376

 Score =   184 bits (466),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  FL      N IQ + ++++RPFSKS YRRIN+   ELLWL+L+WLIDWWA +K
Sbjct  9    FVPVGVLFLVSGLIVNLIQLVFFIIVRPFSKSLYRRINKNVVELLWLQLIWLIDWWACIK  68

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            V +Y D ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+I
Sbjct  69   VNIYADAETLQLLGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  391  GWSMFFSEYLFLERSWAKDESTL  459
            GWSM+FS+Y+FLERSW KDE TL
Sbjct  129  GWSMWFSDYIFLERSWDKDEKTL  151


 Score = 54.7 bits (130),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G KR +D+P+ FWLALFVEGTRFTQ KL AAQ+
Sbjct  154  GFKRFEDFPMTFWLALFVEGTRFTQEKLEAAQE  186



>ref|XP_004139036.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 ref|XP_004154631.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 gb|KGN66490.1| hypothetical protein Csa_1G613620 [Cucumis sativus]
Length=380

 Score =   186 bits (471),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA  +V++RP SK  YRRIN++ AELLWLEL+WLIDWWA  KV+
Sbjct  11   PLGLLFILSGLIVNVIQAFIFVLVRPISKCLYRRINKVVAELLWLELIWLIDWWAEAKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +YTD  TF+LMGKEHAL++ NHRSDIDW+VGWVLAQR+GCLGS LA+MKK + +LPVIGW
Sbjct  71   VYTDQATFQLMGKEHALVLCNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+FLERSWAKDESTL+
Sbjct  131  SMWFSDYIFLERSWAKDESTLE  152


 Score = 50.4 bits (119),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
               + L D+ +PFWLALFVEGTRFTQ KLLA+Q+
Sbjct  153  SSFQSLMDFSMPFWLALFVEGTRFTQQKLLASQE  186


 Score = 23.1 bits (48),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   YAA+ GLP+P+
Sbjct  180  KLLASQEYAAARGLPVPK  197



>ref|XP_008363711.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Malus domestica]
 ref|XP_008363731.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Malus domestica]
Length=169

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G +FL F    N IQAIC++ IRP SKS +R+IN   A  LWL+L+WL++WW G+KV+
Sbjct  11   PFGLTFLLFGLAINLIQAICFLTIRPLSKSAFRQINGAVASFLWLDLIWLMEWWGGLKVK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET++LMGKEHALL+ NH  D D ++G +LA RSGCL S L V+KKSS YLPV GW
Sbjct  71   LYTDLETYRLMGKEHALLMPNHICDADILMGLLLANRSGCLRSALMVVKKSSKYLPVFGW  130

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
            + +F E++FL+RSW KDES LKV
Sbjct  131  TSWFLEFVFLDRSWEKDESNLKV  153



>ref|XP_008377433.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Malus 
domestica]
Length=380

 Score =   180 bits (456),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +1

Query  70   FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  249
              N +Q +  +++RP SKS YR+IN++ AELLWLEL+WLIDWWAG+KV+LY D ETF+LM
Sbjct  22   IVNLMQIVFSILVRPVSKSMYRKINKVVAELLWLELIWLIDWWAGIKVELYVDSETFQLM  81

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            GKE ALLISNH+SDIDW+VGW++AQRSGCLGSTLA+MKK  +++P IGWSM+FSEY+FLE
Sbjct  82   GKERALLISNHKSDIDWLVGWLVAQRSGCLGSTLAIMKKEIMFIPFIGWSMWFSEYVFLE  141

Query  430  RSWAKDESTLK  462
            R W KDE TLK
Sbjct  142  RQWTKDEKTLK  152


 Score = 56.6 bits (135),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  468  KRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            +RL+D+P PFWLALFVEGTRFTQAKL+ AQ+
Sbjct  156  RRLEDFPGPFWLALFVEGTRFTQAKLMVAQE  186



>ref|XP_008450418.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis melo]
Length=380

 Score =   181 bits (460),  Expect(3) = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQA  +V++RP SK  +RRIN++ AELLWLEL+WLIDWWA  KV+
Sbjct  11   PLGLLFILSGLIVNIIQAFIFVLVRPISKCLFRRINKVVAELLWLELIWLIDWWAEAKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD  TF+LMGKEHAL++ NHRSDIDW+VGWVLAQR+GCLGS LA+MKK + +LPVIGW
Sbjct  71   VFTDQATFQLMGKEHALVLCNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPVIGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS+Y+FLERSWAKDE+TL+
Sbjct  131  SMWFSDYIFLERSWAKDENTLE  152


 Score = 50.4 bits (119),  Expect(3) = 2e-53, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
               + L D+ +PFWLALFVEGTRFTQ KLLA+Q+
Sbjct  153  SSFQSLMDFSMPFWLALFVEGTRFTQQKLLASQE  186


 Score = 25.0 bits (53),  Expect(3) = 2e-53, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   YAAS GLPIP+
Sbjct  180  KLLASQEYAASRGLPIPK  197



>ref|XP_002268451.2| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Vitis vinifera]
Length=386

 Score =   179 bits (454),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQ   Y+++RP SK+ YRRIN++  ELLWLEL+WLIDWWAGVKV+
Sbjct  16   PLGLLFILSGLVVNLIQVAFYILVRPMSKNLYRRINKVVVELLWLELIWLIDWWAGVKVE  75

Query  217  LYT-DPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIG  393
            ++  D ETF+LMGKEH+L+I NHRSDIDW+VGWVLAQRS CLGSTLAVMKKS  +LP+IG
Sbjct  76   VFAADSETFELMGKEHSLVICNHRSDIDWLVGWVLAQRSNCLGSTLAVMKKSLKFLPIIG  135

Query  394  WSMFFSEYLFLERSWAKDESTLK  462
            WSM+FS+Y+F+ERSWAKDE TLK
Sbjct  136  WSMWFSDYVFVERSWAKDERTLK  158


 Score = 55.1 bits (131),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            GL+RL+D+P PFWLALFVEGTRFT  KL AA+
Sbjct  160  GLERLEDFPRPFWLALFVEGTRFTHTKLSAAR  191



>ref|XP_006470599.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
 gb|KDO61277.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=392

 Score =   173 bits (439),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +1

Query  64   RSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFK  243
            R   N+  A+ ++++RP SK  YRRIN++  ELLWLEL+WLIDWWA +KV+LY D ETF+
Sbjct  25   RQIPNS--AVLFILVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVELYADAETFQ  82

Query  244  LMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLF  423
            LMGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+FSEY+F
Sbjct  83   LMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVF  142

Query  424  LERSWAKDESTLK  462
            LER W KDE TLK
Sbjct  143  LERRWNKDEQTLK  155


 Score = 60.5 bits (145),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G KRL D+P+PFWLAL+VEGTRFT+AKLLAAQ+
Sbjct  156  SGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQE  189



>emb|CBI21663.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   179 bits (453),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N IQ   Y+++RP SK+ YRRIN++  ELLWLEL+WLIDWWAGVKV+
Sbjct  11   PLGLLFILSGLVVNLIQVAFYILVRPMSKNLYRRINKVVVELLWLELIWLIDWWAGVKVE  70

Query  217  LYT-DPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIG  393
            ++  D ETF+LMGKEH+L+I NHRSDIDW+VGWVLAQRS CLGSTLAVMKKS  +LP+IG
Sbjct  71   VFAADSETFELMGKEHSLVICNHRSDIDWLVGWVLAQRSNCLGSTLAVMKKSLKFLPIIG  130

Query  394  WSMFFSEYLFLERSWAKDESTLK  462
            WSM+FS+Y+F+ERSWAKDE TLK
Sbjct  131  WSMWFSDYVFVERSWAKDERTLK  153


 Score = 55.1 bits (131),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            GL+RL+D+P PFWLALFVEGTRFT  KL AA+
Sbjct  155  GLERLEDFPRPFWLALFVEGTRFTHTKLSAAR  186



>ref|XP_001754626.1| predicted protein [Physcomitrella patens]
 gb|EDQ80596.1| predicted protein [Physcomitrella patens]
Length=554

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  1    FRHGDCGGSCYR-PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLEL  177
             R  + GGS    P G  F+    F N +Q I  + I PFS+  YR +N +  E LW EL
Sbjct  124  LRAMEGGGSLIALPLGLMFIFSGLFINGLQVISVLFILPFSRRAYRVVNMIMMEALWSEL  183

Query  178  VWLIDWWAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAV  357
            VWL+DWWAGVKV++YT  ET + +GKE AL+ISNHRSDIDW+VGW++AQR GCLG T AV
Sbjct  184  VWLLDWWAGVKVKVYTPRETSEHLGKERALVISNHRSDIDWLVGWIIAQRLGCLGGTRAV  243

Query  358  MKKSSVYLPVIGWSMFFSEYLFLERSWAKDESTLKVLK  471
            MKKS+ +LPVIGWSM+FSEY+FL R+W KDE  LKVL+
Sbjct  244  MKKSTKFLPVIGWSMWFSEYVFLSRNWTKDEKVLKVLR  281



>ref|XP_009615949.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Nicotiana tomentosiformis]
Length=377

 Score =   179 bits (453),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA+ ++++RP SK+ YRRIN+   ELLWLEL+WL DWWA VKV+
Sbjct  10   PIGLLFLLSGLIINFIQALLFILVRPCSKNMYRRINKEVTELLWLELIWLFDWWANVKVE  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET+ LMGKEHAL+ISNHRSDIDW+VGWV+AQR GCLGST+A+ KKS  YLPV+GW
Sbjct  70   LYTDQETYGLMGKEHALVISNHRSDIDWLVGWVIAQRVGCLGSTIALAKKSLSYLPVLGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS Y+ LERSWAKDE+TLK
Sbjct  130  SMWFSGYISLERSWAKDENTLK  151


 Score = 49.7 bits (117),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G ++L D+  PFWLA+FVEGTRFT  KLLAAQ+
Sbjct  152  SGFQQLNDFHQPFWLAVFVEGTRFTHTKLLAAQE  185


 Score = 25.0 bits (53),  Expect(3) = 2e-52, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 11/18 (61%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   YA S GLPIPR
Sbjct  179  KLLAAQEYATSAGLPIPR  196



>ref|XP_010673625.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   176 bits (447),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  130  YRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVG  309
            +RR N++ AELLWLE VWL DWWAGVKV+L+TD ETF LMGKEHALLI NHRSDIDW++G
Sbjct  2    HRRFNKVVAELLWLETVWLFDWWAGVKVELHTDSETFHLMGKEHALLICNHRSDIDWLIG  61

Query  310  WVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDESTL  459
            WVLAQR+GCLG T+A+MK    YLPVIGWSM+FSEY+F++R W  D+STL
Sbjct  62   WVLAQRAGCLGCTMAIMKDVLKYLPVIGWSMWFSEYIFIKRRWDVDQSTL  111


 Score = 55.8 bits (133),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
             G + L+D+P+PFWLALFVEGTRFTQ+KLL AQ
Sbjct  113  SGCENLKDFPVPFWLALFVEGTRFTQSKLLDAQ  145



>ref|XP_009773917.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nicotiana sylvestris]
Length=377

 Score =   177 bits (450),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQA+ ++++RP SK+ YR IN+   ELLWLEL+WL DWWA VKV+
Sbjct  10   PIGLLFLLSGLIINFIQALLFILVRPCSKNIYRGINKEVTELLWLELIWLFDWWANVKVE  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ETF LMGKEHAL+ISNHRSDIDW+VGWV+AQR GCLGST+A+ KKS  YLPV+GW
Sbjct  70   LYTDQETFGLMGKEHALVISNHRSDIDWLVGWVIAQRVGCLGSTIALAKKSLSYLPVLGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FS Y+ LERSWAKDE+TLK
Sbjct  130  SMWFSGYISLERSWAKDENTLK  151


 Score = 49.7 bits (117),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G ++L D+  PFWLA+FVEGTRFT  KLLAAQ+
Sbjct  152  SGFQQLNDFHQPFWLAVFVEGTRFTHTKLLAAQE  185


 Score = 25.0 bits (53),  Expect(3) = 5e-52, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 11/18 (61%), Gaps = 0/18 (0%)
 Frame = +2

Query  539  KAFSCSRYAASTGLPIPR  592
            K  +   YA S GLPIPR
Sbjct  179  KLLAAQEYATSAGLPIPR  196



>gb|EYU46266.1| hypothetical protein MIMGU_mgv1a026523mg, partial [Erythranthe 
guttata]
Length=351

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 123/157 (78%), Gaps = 4/157 (3%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N +QAI  V++RP SK+ YRRIN+   ELLWLEL+WL DWWA +KV+
Sbjct  10   PIGLMFLLSGLIVNLLQAILLVLVRPLSKNAYRRINKQLIELLWLELIWLFDWWANIKVE  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+ D ETF ++GKE ALLI NHRSDIDW+VGWVLAQR+GCLGS+LA++KKSS++LPVIGW
Sbjct  70   LFADEETFAMLGKEPALLICNHRSDIDWLVGWVLAQRAGCLGSSLAMIKKSSLFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLK----VLKGYRITHFL  495
            SM+FS ++FLER+WAKDE+T+K     L G+ I  +L
Sbjct  130  SMWFSGFIFLERNWAKDENTMKSGFEALNGFPIPFWL  166


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G + L  +P+PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  152  SGFEALNGFPIPFWLALFVEGTRFTQAKLLAAQE  185



>ref|XP_004486965.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X3 [Cicer arietinum]
Length=365

 Score =   173 bits (439),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+      N +QAI +V++RP S+  YRRIN++  E LWLEL+WL+DWWAGVKV+
Sbjct  11   PVGTLFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVE  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LY D ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLG+T+A+MKK   YLPVIG+
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGF  130


 Score = 53.9 bits (128),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G K+L+  P+PFW+ALFVEGTRFT  KLLAAQ+
Sbjct  129  GFKQLEHKPVPFWMALFVEGTRFTHTKLLAAQE  161



>ref|XP_007212911.1| hypothetical protein PRUPE_ppa022232mg [Prunus persica]
 gb|EMJ14110.1| hypothetical protein PRUPE_ppa022232mg [Prunus persica]
Length=381

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F+    F N +QAIC++ IRP SKSTYR+IN   A LLWL+ +WL++WWAG+KV+
Sbjct  11   PFGVIFVVLGLFVNLLQAICFLTIRPLSKSTYRKINGTIASLLWLDHIWLLEWWAGLKVK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            LYTD ET++LMG+EHALL+ NH  D D ++G++LAQR GCL S L VMKKS+ +LP+ GW
Sbjct  71   LYTDLETYRLMGEEHALLMPNHMCDADILIGFLLAQRLGCLRSALMVMKKSAKFLPIFGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            + +F  ++FL RSW KDES LK
Sbjct  131  TSWFLGFVFLNRSWEKDESNLK  152



>ref|XP_001764965.1| predicted protein [Physcomitrella patens]
 gb|EDQ70181.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = +1

Query  13   DCGGSCYR-PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLI  189
            + GGS    P G  FL    F N +Q +  + I PFS+  YR +N +  E+LW EL+WL+
Sbjct  2    EGGGSIIALPLGLMFLFSGFFINILQLLSVLFILPFSRRAYRVVNMIMMEVLWSELIWLL  61

Query  190  DWWAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKS  369
            DWWA VKV   +   +  L GKEHALLI NHRSDIDW+VGW++AQR GCLG T AVMKKS
Sbjct  62   DWWANVKVSRLSGSLSISLFGKEHALLICNHRSDIDWLVGWIIAQRLGCLGGTRAVMKKS  121

Query  370  SVYLPVIGWSMFFSEYLFLERSWAKDESTLK----VLKGYRIT  486
            + +LPVIGWSM+FSEY+FL R WAKDE  LK     LKG+  T
Sbjct  122  TKFLPVIGWSMWFSEYVFLSRDWAKDEKVLKNGYSSLKGFPRT  164



>emb|CDY52093.1| BnaC04g55420D [Brassica napus]
Length=496

 Score =   163 bits (412),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 96/142 (68%), Gaps = 25/142 (18%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F  F    N + AICY                         LVW++DWWAGV ++
Sbjct  10   PLGLLFFIFGLLVNLLLAICY-------------------------LVWIVDWWAGVTIK  44

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            ++TD ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAV KKSS +LPV GW
Sbjct  45   VFTDNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVTKKSSKFLPVKGW  104

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+W KDEST+K
Sbjct  105  SMWFSEYLFLERNWVKDESTIK  126


 Score = 57.4 bits (137),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFT+ KL AAQ+
Sbjct  127  SGLQRLKDFPQPFWLALFVEGTRFTETKLKAAQE  160



>ref|XP_002986838.1| hypothetical protein SELMODRAFT_124776 [Selaginella moellendorffii]
 gb|EFJ12168.1| hypothetical protein SELMODRAFT_124776 [Selaginella moellendorffii]
Length=372

 Score =   169 bits (429),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N +Q +C +V+ PFS+  +R +N    EL   +LVW+++WWAGV+V+
Sbjct  11   PLGLMFFCSGFVVNLLQ-VCSLVLLPFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVR  69

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            +Y D ET K  GKEHAL+ISNHRSDIDW+VGW+ A R GCL  T A+MKKSS +LPVIGW
Sbjct  70   IYADEETRKHFGKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGW  129

Query  397  SMFFSEYLFLERSWAKDESTLKV  465
             M+F+EY+FLER W KDE+TLK+
Sbjct  130  GMWFTEYIFLERKWEKDENTLKI  152


 Score = 47.0 bits (110),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G +R +++P   W+ALFVEGTRFT+AKL AAQ+
Sbjct  153  GFQRWKNFPRVLWVALFVEGTRFTEAKLKAAQE  185



>ref|XP_007015028.1| Lysophosphatidyl acyltransferase 2, putative isoform 2 [Theobroma 
cacao]
 gb|EOY32647.1| Lysophosphatidyl acyltransferase 2, putative isoform 2 [Theobroma 
cacao]
Length=374

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P    F+   +  N IQ  CY+ IRP SKST+RRIN   +E+LWLELVWL++WW+G +V+
Sbjct  11   PLSLMFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGCEVK  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+TD +T++LMGKEHALL+ NH +D D ++ W+LAQR GCL S L + KKS+ YLP+ GW
Sbjct  71   LHTDLKTYRLMGKEHALLMPNHVADADTMLVWLLAQRMGCLRSALIISKKSTQYLPIFGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            + +F E++F++R+WAKD S LK
Sbjct  131  TTWFYEFIFVDRNWAKDGSKLK  152



>gb|EMT23643.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Aegilops 
tauschii]
Length=439

 Score =   159 bits (403),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 95/129 (74%), Gaps = 13/129 (10%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+ ++ IRPFSK  YR+IN   AELLWL+L+WL+DWWAG+KVQ+Y DPET+KLM  
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGIKVQVYADPETWKLMVH  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
                 + +              QRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   YDESPVFD-------------GQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  130

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  131  WAKDEKTLK  139


 Score = 56.6 bits (135),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P  FWLALFVEGTRFT AKLLAAQ+
Sbjct  140  SGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQE  173



>ref|XP_002969275.1| hypothetical protein SELMODRAFT_146320 [Selaginella moellendorffii]
 gb|EFJ29363.1| hypothetical protein SELMODRAFT_146320 [Selaginella moellendorffii]
Length=358

 Score =   169 bits (427),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +1

Query  70   FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  249
            F   +  +C +V+ PFS+  +R +N    EL   +LVW+++WWAGV+V++Y D ET K  
Sbjct  7    FVVNLLQVCSLVLLPFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVRIYADEETRKHF  66

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            GKEHAL+ISNHRSDIDW+VGW+ A R GCL  T A+MKKSS +LPVIGW M+F+EY+FLE
Sbjct  67   GKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGWGMWFTEYIFLE  126

Query  430  RSWAKDESTLKV  465
            R W KDE+TLK+
Sbjct  127  RKWEKDENTLKI  138


 Score = 47.0 bits (110),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            G +R +++P   W+ALFVEGTRFT+AKL AAQ+
Sbjct  139  GFQRWKNFPRVLWVALFVEGTRFTEAKLKAAQE  171



>ref|XP_008227143.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Prunus mume]
Length=381

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QAIC++ IRP SKS YR+IN   A LLWL  + L++WWAG+KV+LYTD ET++LMGK
Sbjct  24   NLLQAICFLTIRPLSKSAYRKINGTVASLLWLVHICLLEWWAGLKVKLYTDLETYRLMGK  83

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHALL+ NH  D D ++G++LAQR GCL S L VMKKS+ YLP+ GW+ +F  ++FL RS
Sbjct  84   EHALLMPNHMCDADVLIGFLLAQRLGCLRSALMVMKKSAKYLPIFGWTSWFLGFVFLNRS  143

Query  436  WAKDESTLK  462
            W KDES LK
Sbjct  144  WEKDESNLK  152



>ref|XP_006493899.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=413

 Score =   149 bits (376),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  205  VKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP  384
            ++++L+ D ET++LMGKEHAL++SNH+SDIDW+VGWVL+QRSGCLGSTLAVMKKSS +LP
Sbjct  94   LQIKLFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMKKSSKFLP  153

Query  385  VIGWSMFFSEYLFLERSWAKDESTLK  462
            VIGWSM+FSEYLFLER+W KDESTLK
Sbjct  154  VIGWSMWFSEYLFLERNWVKDESTLK  179


 Score = 63.9 bits (154),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  180  SGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  213



>ref|XP_006421452.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34692.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=349

 Score =   147 bits (370),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 88/142 (62%), Gaps = 38/142 (27%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK  
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVK--  68

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
                                                RSGCLGSTLAVMKKSS +LPVIGW
Sbjct  69   ------------------------------------RSGCLGSTLAVMKKSSKFLPVIGW  92

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            SM+FSEYLFLER+WAKDESTLK
Sbjct  93   SMWFSEYLFLERNWAKDESTLK  114


 Score = 63.5 bits (153),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  115  SGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  148



>ref|XP_002513486.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Ricinus 
communis]
 gb|EEF48889.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Ricinus 
communis]
Length=376

 Score =   160 bits (404),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  FL      N IQ  CY++++P SK+ +RRI     E+LWLE ++L+DWW+G KV 
Sbjct  11   PFGFVFLFSGLIINLIQGACYILVQPLSKTAHRRIIGAVTEILWLEFIFLMDWWSGFKVH  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
            L+TD ET++LMGKEHALL+ NH  D D  + W+LAQRS CL   L V+K+SS+Y+P+ GW
Sbjct  71   LHTDFETYQLMGKEHALLMPNHICDADIFIMWLLAQRSSCLRGALMVVKRSSMYIPIYGW  130

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            + +F+E++F+ R+W KDE  LK
Sbjct  131  ATWFAEHVFVSRNWGKDEEVLK  152


 Score = 48.9 bits (115),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  474  LQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            LQD+P PFWL LFVEGTR T  KL+AAQ+
Sbjct  158  LQDFPRPFWLTLFVEGTRMTSDKLVAAQN  186



>gb|EMS63864.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Triticum 
urartu]
Length=347

 Score =   151 bits (381),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 27/129 (21%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +QA+ ++ IRPFSK  YR+IN   AELLWL+L+WL+DWWAG+KVQ+Y DP T+KLMG 
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGIKVQVYADPATWKLMG-  82

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
                                      CLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  83   --------------------------CLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  116

Query  436  WAKDESTLK  462
            WAKDE TLK
Sbjct  117  WAKDEKTLK  125


 Score = 57.0 bits (136),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P  FWLALFVEGTRFT AKLLAAQ+
Sbjct  126  SGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQE  159



>gb|AAF20003.1|AF213937_1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus dulcis]
Length=306

 Score =   139 bits (350),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGS+LAVMKKSS +LPVIGWSM+FSEYLFL
Sbjct  1    MGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  427  ERSWAKDESTLK  462
            ERSWAKDE TLK
Sbjct  61   ERSWAKDEGTLK  72


 Score = 61.2 bits (147),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL+D+P PFWLALFVEGTRFTQAKLLAAQ+
Sbjct  73   SGVQRLKDFPQPFWLALFVEGTRFTQAKLLAAQE  106



>gb|KJB16431.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=301

 Score =   136 bits (342),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+FSEYLFL
Sbjct  1    MGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  427  ERSWAKDESTLK  462
            ERSWAKDE+T+K
Sbjct  61   ERSWAKDENTIK  72


 Score = 62.4 bits (150),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  74   GLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQE  106



>tpg|DAA42326.1| TPA: hypothetical protein ZEAMMB73_334173 [Zea mays]
Length=294

 Score =   137 bits (346),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFL
Sbjct  1    MGKEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFL  60

Query  427  ERSWAKDESTLK  462
            ERSWAKDE TLK
Sbjct  61   ERSWAKDEKTLK  72


 Score = 60.1 bits (144),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  74   GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  106



>ref|XP_007015027.1| Lysophosphatidyl acyltransferase 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOY32646.1| Lysophosphatidyl acyltransferase 2, putative isoform 1 [Theobroma 
cacao]
Length=367

 Score =   154 bits (390),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 7/142 (5%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P    F+   +  N IQ  CY+ IRP SKST+RRIN   +E+LWLELVWL++WW+G    
Sbjct  11   PLSLMFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGYL--  68

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGW  396
                 +T++LMGKEHALL+ NH +D D ++ W+LAQR GCL S L + KKS+ YLP+ GW
Sbjct  69   -----KTYRLMGKEHALLMPNHVADADTMLVWLLAQRMGCLRSALIISKKSTQYLPIFGW  123

Query  397  SMFFSEYLFLERSWAKDESTLK  462
            + +F E++F++R+WAKD S LK
Sbjct  124  TTWFYEFIFVDRNWAKDGSKLK  145


 Score = 43.1 bits (100),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  474  LQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            L+D+P+PFW+ +F EGTR T  KLL AQ
Sbjct  151  LKDFPIPFWVTIFAEGTRLTPDKLLEAQ  178



>gb|AFW60270.1| hypothetical protein ZEAMMB73_783506 [Zea mays]
Length=294

 Score =   137 bits (346),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFL
Sbjct  1    MGKEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFL  60

Query  427  ERSWAKDESTLK  462
            ERSWAKDE TLK
Sbjct  61   ERSWAKDEKTLK  72


 Score = 59.7 bits (143),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  74   GLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQE  106



>gb|ACU18782.1| unknown [Glycine max]
Length=297

 Score =   133 bits (335),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHAL+ISNHR DIDW+VG V AQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFL
Sbjct  1    MGKEHALVISNHRGDIDWLVGRVSAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  427  ERSWAKDESTLK  462
            ERSWAKDESTLK
Sbjct  61   ERSWAKDESTLK  72


 Score = 63.9 bits (154),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G++RL D+PLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  73   SGIQRLSDFPLPFWLALFVEGTRFTQAKLLAAQE  106



>gb|KCW51192.1| hypothetical protein EUGRSUZ_J00779 [Eucalyptus grandis]
Length=308

 Score =   133 bits (335),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  226  DPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMF  405
            D +TF++MGKEHALLI NHRSDIDW+VGWV+AQR+GCLGS LA+MKK + +LPV+GWSM+
Sbjct  2    DSQTFEMMGKEHALLICNHRSDIDWLVGWVIAQRAGCLGSALAIMKKEAKFLPVVGWSMW  61

Query  406  FSEYLFLERSWAKDESTLK  462
            FS+Y+F++R WAKDE+TLK
Sbjct  62   FSDYVFVDRCWAKDENTLK  80


 Score = 58.9 bits (141),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G +RL D+P+PFWLALFVEGTRFTQAKL AAQ+
Sbjct  81   SGFERLSDFPMPFWLALFVEGTRFTQAKLQAAQE  114



>ref|XP_002314068.2| hypothetical protein POPTR_0009s05930g [Populus trichocarpa]
 gb|EEE88023.2| hypothetical protein POPTR_0009s05930g [Populus trichocarpa]
Length=423

 Score =   145 bits (365),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  F         IQA C+++I P S++TYRRI     E+L+LE+++L+DW AG++
Sbjct  10   FMPFGMVFCLTGVLITIIQAACFLIIWPLSRNTYRRIVGAVTEILFLEMIFLMDWLAGLE  69

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            V+L+TD ET++L+GKE+AL++ NH  D D ++ W+LA+R  CL   L VMKKSS YLP+ 
Sbjct  70   VRLHTDLETYELIGKENALVMPNHICDADVLIMWLLAERFNCLRGALMVMKKSSKYLPIY  129

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GW+ +F+  +FL R+WAKDE  LK
Sbjct  130  GWANWFNGAVFLNRNWAKDEGKLK  153


 Score = 43.9 bits (102),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
               + L+D+P  FWL +FVEGTR T  KLLAAQ+
Sbjct  154  SSFQELKDFPGSFWLTIFVEGTRITPDKLLAAQE  187



>gb|EYU39879.1| hypothetical protein MIMGU_mgv1a010933mg [Erythranthe guttata]
Length=297

 Score =   127 bits (320),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHAL+I NH+SDIDW+VGWVLAQRSGCLGS+ AVMKKS   LPVIGW+M+FSE+LFL
Sbjct  1    MGKEHALVICNHKSDIDWLVGWVLAQRSGCLGSSFAVMKKSMKVLPVIGWAMWFSEHLFL  60

Query  427  ERSWAKDESTLK  462
            ERSWA DESTLK
Sbjct  61   ERSWATDESTLK  72


 Score = 60.8 bits (146),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P PFWLALFVEGTRFT AKLLAAQ+
Sbjct  73   SGLQRLKDFPQPFWLALFVEGTRFTHAKLLAAQE  106



>ref|XP_011025520.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Populus euphratica]
Length=378

 Score =   142 bits (358),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  F       N IQA C+++I P SK+TYRRI     E+ +L + +L++W+AG++
Sbjct  10   FLPLGMVFCLTGIAINIIQAACFLIIWPLSKNTYRRIVGAVTEIFFLVMTFLVNWFAGLE  69

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            V L+TD ET++L+GKE+AL++ NH  D+D ++ W+LA+R  CL   L VMKKSS YLP+ 
Sbjct  70   VHLHTDLETYELIGKENALVMPNHICDVDVLMMWLLAERFNCLRGVLMVMKKSSKYLPIY  129

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GW+ +F+  +FL+R+WAKDE  LK
Sbjct  130  GWANWFNGAVFLDRNWAKDEGKLK  153


 Score = 44.3 bits (103),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
               + L+D+P  FWL +FVEGTR T  KLLAAQ+
Sbjct  154  SSFRELKDFPGSFWLTIFVEGTRMTPDKLLAAQE  187



>ref|XP_011025521.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Populus euphratica]
Length=371

 Score =   142 bits (357),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = +1

Query  31   YRPSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            + P G  F       N IQA C+++I P SK+TYRRI     E+ +L + +L++W+AG++
Sbjct  10   FLPLGMVFCLTGIAINIIQAACFLIIWPLSKNTYRRIVGAVTEIFFLVMTFLVNWFAGLE  69

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            V L+TD ET++L+GKE+AL++ NH  D+D ++ W+LA+R  CL   L VMKKSS YLP+ 
Sbjct  70   VHLHTDLETYELIGKENALVMPNHICDVDVLMMWLLAERFNCLRGVLMVMKKSSKYLPIY  129

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GW+ +F+  +FL+R+WAKDE  LK
Sbjct  130  GWANWFNGAVFLDRNWAKDEGKLK  153


 Score = 44.3 bits (103),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
               + L+D+P  FWL +FVEGTR T  KLLAAQ+
Sbjct  154  SSFRELKDFPGSFWLTIFVEGTRMTPDKLLAAQE  187



>ref|XP_006446108.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59348.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=310

 Score =   123 bits (308),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+FSEY+FL
Sbjct  1    MGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVFL  60

Query  427  ERSWAKDESTLK  462
            ER W KDE TLK
Sbjct  61   ERRWNKDEQTLK  72


 Score = 60.5 bits (145),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G KRL D+P+PFWLAL+VEGTRFT+AKLLAAQ+
Sbjct  73   SGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQE  106



>gb|KDO61278.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
 gb|KDO61279.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=309

 Score =   123 bits (308),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  247  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  426
            MGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+FSEY+FL
Sbjct  1    MGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVFL  60

Query  427  ERSWAKDESTLK  462
            ER W KDE TLK
Sbjct  61   ERRWNKDEQTLK  72


 Score = 60.5 bits (145),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G KRL D+P+PFWLAL+VEGTRFT+AKLLAAQ+
Sbjct  73   SGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQE  106



>ref|XP_008363635.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Malus domestica]
Length=385

 Score =   119 bits (297),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 101/155 (65%), Gaps = 11/155 (7%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK--  210
            P G  F+      N +Q +C++++RP SK  YR+IN+L AELLWLEL+WLIDWWAG+K  
Sbjct  11   PVGVLFILSGLIVNLMQIVCFLLVRPVSKRMYRKINKLVAELLWLELIWLIDWWAGIKAC  70

Query  211  -----VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSV  375
                 V +Y    T  L+    A L  + RS  +    W++ QRSGC GS LA++KK  +
Sbjct  71   FFLKVVHIYAF--TSHLLNNIIADLSFSSRSFFEINAQWIVQQRSGCXGSALAIIKKEIM  128

Query  376  YLPVIGWSMFFSEYLFLERSWAKDESTLKVLKGYR  480
            +LPVIGWSM+FSEY+FL+R W KDE TLK   G+R
Sbjct  129  FLPVIGWSMWFSEYVFLQRRWTKDEXTLK--SGFR  161


 Score = 63.2 bits (152),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             G +RL+D+P+PFWLALFVEGTRFTQAKL+AAQ+
Sbjct  158  SGFRRLEDFPMPFWLALFVEGTRFTQAKLMAAQE  191



>gb|AAP80656.1|AF479037_1 1-acy1-glycerol-3-phosphate acyltransferase, partial [Triticum 
aestivum]
Length=237

 Score =   124 bits (312),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  259  HALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSW  438
             ALLISNHRSDIDW+VGW+LAQRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERSW
Sbjct  2    DALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERSW  61

Query  439  AKDESTLK  462
            AKDE TLK
Sbjct  62   AKDEKTLK  69


 Score = 56.6 bits (135),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
             GL+RL+D+P  FWLALFVEGTRFT AKLLAAQ+
Sbjct  70   SGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQE  103



>ref|NP_001068336.2| Os11g0637800 [Oryza sativa Japonica Group]
 dbj|BAF28699.2| Os11g0637800, partial [Oryza sativa Japonica Group]
Length=100

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            G EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  11   GNEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  70

Query  430  RSWAKDESTLK  462
            RSWAKDE TLK
Sbjct  71   RSWAKDEKTLK  81



>gb|KHG13155.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 -like protein 
[Gossypium arboreum]
Length=311

 Score =   129 bits (325),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 92/144 (64%), Gaps = 24/144 (17%)
 Frame = +1

Query  43   GRSFLHFRSFT----NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK  210
            G  F+    FT    N IQ  CY+ I P SKST+RRIN    ELLWLE+VWL++WW+G +
Sbjct  9    GIPFISLFIFTGILVNLIQVSCYLTIWPVSKSTFRRINGAITELLWLEVVWLMEWWSGFE  68

Query  211  VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVI  390
            V+++TD +T +LMGKEHA+++ NH SD D ++ W+LAQ                    V 
Sbjct  69   VKVHTDAKTCQLMGKEHAIIMPNHVSDSDTLLTWILAQ--------------------VF  108

Query  391  GWSMFFSEYLFLERSWAKDESTLK  462
            GW+ +FSE +FL+R+WAKDES LK
Sbjct  109  GWTNWFSESIFLDRNWAKDESKLK  132


 Score = 45.1 bits (105),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQDMLHLQVY  581
               + L DYP PFW+ +FVEGTR T  KL+ AQ     + Y
Sbjct  133  SSFEALSDYPTPFWMTIFVEGTRLTADKLVEAQSFASSKGY  173



>ref|XP_008337106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Malus domestica]
Length=123

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  37   PSGRSFLHFRSFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQ  216
            P G  F       N IQAIC+++IRP SK+TYRRINR+ AELLWLELVWLIDWWAGVK+Q
Sbjct  11   PLGLLFFVSGLXVNLIQAICFILIRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  217  LYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQ  324
            +YTDPETF LMGKEHAL++ NHRSDIDW+VGWVLAQ
Sbjct  71   VYTDPETFCLMGKEHALVMCNHRSDIDWLVGWVLAQ  106



>ref|XP_010672762.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 95/139 (68%), Gaps = 18/139 (13%)
 Frame = +1

Query  133  RRINRLFAE--LLWLELVWLIDWWAG--VKVQLYTDPET----------FKLMGKEHALL  270
            RR +R  AE  LLW  +V     W G  + + L    E+          ++  GKEHAL+
Sbjct  100  RRGDRSLAEAQLLWRLMVKPPLIWLGEYIDIGLSEGEESTLSCSLKVSWYQPSGKEHALV  159

Query  271  ISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDE  450
            + NH+SDIDW+VGWVLAQR+GCLGSTLAVMKKSS  LPVIGWSM+FSEYLFLERSWAKDE
Sbjct  160  VCNHKSDIDWLVGWVLAQRAGCLGSTLAVMKKSSKMLPVIGWSMWFSEYLFLERSWAKDE  219

Query  451  STLKV----LKGYRITHFL  495
            ST+K+    LK Y +  +L
Sbjct  220  STIKLGLERLKDYPLPFWL  238


 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  249
            N +QA C+V++RP SKSTYRRINRL AELLWLELVWL+DWWA V+V+++TDPETF+ M
Sbjct  24   NVLQATCFVLVRPLSKSTYRRINRLVAELLWLELVWLVDWWARVQVKVFTDPETFRQM  81


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            GL+RL+DYPLPFWLALFVEGTRFTQAKLLAAQ+
Sbjct  225  GLERLKDYPLPFWLALFVEGTRFTQAKLLAAQE  257



>ref|XP_002590323.1| hypothetical protein BRAFLDRAFT_121375 [Branchiostoma floridae]
 gb|EEN46334.1| hypothetical protein BRAFLDRAFT_121375 [Branchiostoma floridae]
Length=373

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 102/172 (59%), Gaps = 15/172 (9%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N  QA  Y+++RP S + YR++   F  + W +LV+L +WWAG  + +Y        +GK
Sbjct  29   NIFQAAGYLLLRPISLTAYRKLAAFFTNMHWSQLVFLNEWWAGSTINMYGTDADIGRIGK  88

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            E+A+L+ NH+ + D + GW + +R GCLG++ A++K+S  YLPV+GW+MFF E+LFL+R 
Sbjct  89   ENAVLLMNHKYETDMISGWTVCERFGCLGTSRALIKESVKYLPVVGWTMFFIEFLFLKRD  148

Query  436  WAKDESTLKVLKGYRITHFLFGWHFLLKALALHRQSF*LLKICCIYRFTNSK  591
            + +D+ T  ++K              LK L  +  +F LL  C   RFT  K
Sbjct  149  YEEDKRT--IIKQ-------------LKELQNYPDNFWLLLFCEGTRFTAEK  185



>ref|XP_001621942.1| predicted protein [Nematostella vectensis]
 gb|EDO29842.1| predicted protein [Nematostella vectensis]
Length=385

 Score =   116 bits (291),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 3/133 (2%)
 Frame = +1

Query  73   TNAIQAICYVVIRP---FSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFK  243
            T  I  I  V I P   F+K+ YR IN     L W +L +L+DWW+   ++LY + E F+
Sbjct  25   TGMIINIIQVAILPLWTFNKTLYRWINMHVVYLHWSQLTFLVDWWSETDLRLYGNEEDFR  84

Query  244  LMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLF  423
              GKE A+ ++NHRSD+DW++GWV+A R   LG+T   MK    YLP++G+S   SEY F
Sbjct  85   YFGKESAICVANHRSDVDWLIGWVMADRVDTLGTTKCYMKGYLKYLPIMGFSWLSSEYAF  144

Query  424  LERSWAKDESTLK  462
            + R+W KD+  L+
Sbjct  145  VSRNWQKDQRVLQ  157


 Score = 45.4 bits (106),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAKLLAA  554
              L  LQD+P PFW+A+F EGTR TQ KL A+
Sbjct  158  NSLDTLQDFPYPFWIAIFAEGTRLTQEKLQAS  189



>ref|XP_010366228.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Rhinopithecus roxellana]
Length=320

 Score =   115 bits (287),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VIEGLR  160


 Score = 43.1 bits (100),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>gb|KDP22082.1| hypothetical protein JCGZ_25913 [Jatropha curcas]
Length=406

 Score =   114 bits (284),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  205  VKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP  384
            V++ L+TD ET+KLMGKEHAL++ NH SD D  + W+LAQR  CL S L V+KKSS+Y+P
Sbjct  97   VQIHLFTDSETYKLMGKEHALVMPNHISDADIFILWLLAQRFNCLRSALMVVKKSSMYIP  156

Query  385  VIGWSMFFSEYLFLERSWAKDESTLK  462
            + GW+ +F EY+F+ RSWAKDE  LK
Sbjct  157  IFGWAAWFMEYVFMSRSWAKDEKNLK  182


 Score = 43.9 bits (102),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  474  LQDYPLPFWLALFVEGTRFTQAKLLAAQD  560
            LQD+P PFWL +F EGTR T  KL+A+Q 
Sbjct  188  LQDFPWPFWLTIFTEGTRLTPDKLVASQK  216



>ref|XP_003927614.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Saimiri boliviensis boliviensis]
 ref|XP_010336526.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Saimiri boliviensis boliviensis]
 ref|XP_010336527.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Saimiri boliviensis boliviensis]
 ref|XP_010336528.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Saimiri boliviensis boliviensis]
Length=376

 Score =   115 bits (288),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAIIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VIEGLR  160


 Score = 42.7 bits (99),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_006608633.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X2 [Apis dorsata]
Length=371

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 1/131 (1%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLM  249
            TN  Q   Y  +RPFS+  YR+IN       + +LV+LI+WW+G    LY D     K  
Sbjct  46   TNFFQCFLYFGLRPFSRYCYRKINYYLCYSFYTQLVFLIEWWSGSDFILYMDRNDLEKHF  105

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            G+EH  ++ NH  +IDW++GWVL +R G LG+  A +KKS  Y+P +GW   FSEY+FLE
Sbjct  106  GEEHGYILMNHSYEIDWLIGWVLCERKGILGNCKAYVKKSLQYIPTLGWGWKFSEYIFLE  165

Query  430  RSWAKDESTLK  462
            R+W KD+  ++
Sbjct  166  RNWEKDKEIIR  176



>ref|XP_008985009.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Callithrix jacchus]
Length=376

 Score =   115 bits (287),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VIEGLR  160


 Score = 42.7 bits (99),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>gb|KFZ60093.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Podiceps 
cristatus]
Length=376

 Score =   117 bits (292),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D  T    GK
Sbjct  29   NFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVNTFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V+KG R
Sbjct  148  WEEDRDT--VIKGLR  160


 Score = 40.4 bits (93),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            I+GL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IKGLRRLADYPEYMWFLLYCEGTRFTETK  184



>ref|XP_010366226.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Rhinopithecus roxellana]
 ref|XP_010366227.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Rhinopithecus roxellana]
Length=376

 Score =   114 bits (286),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VIEGLR  160


 Score = 42.7 bits (99),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_006724095.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X6 [Homo sapiens]
Length=265

 Score =   114 bits (286),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 42.4 bits (98),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_005261216.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Homo sapiens]
Length=463

 Score =   114 bits (286),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  116  NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  174

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  175  EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  234

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  235  WEEDRDT--VVEGLR  247


 Score = 42.0 bits (97),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  243  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  271



>ref|XP_003823897.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan paniscus]
 ref|XP_003823899.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan paniscus]
 ref|XP_008975810.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan paniscus]
Length=376

 Score =   114 bits (286),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 42.0 bits (97),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_003277406.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 1 [Nomascus leucogenys]
 ref|XP_003277407.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 2 [Nomascus leucogenys]
 ref|XP_003277408.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 3 [Nomascus leucogenys]
 ref|XP_004092377.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Nomascus leucogenys]
Length=376

 Score =   114 bits (285),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDEATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 42.0 bits (97),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_011143319.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 ref|XP_011143320.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 ref|XP_011143321.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 ref|XP_011143322.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 gb|EFN82046.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Harpegnathos 
saltator]
Length=387

 Score =   117 bits (294),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q + Y  +RPFSK  YR+IN       + +LV++ +WWAG  V LY D + F K  G
Sbjct  29   NFFQCVLYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDVILYIDKKDFDKYYG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
             EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   NEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTLK  462
            SW KD+  +K
Sbjct  149  SWEKDKENIK  158


 Score = 38.5 bits (88),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +3

Query  450  EHIEG-LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            E+I+G ++ L +YP   WL L+ EGTRFT  KL A+Q
Sbjct  155  ENIKGQIRELVEYPDTIWLLLYPEGTRFTSKKLEASQ  191



>ref|NP_064517.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Homo sapiens]
 ref|NP_001032642.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Homo sapiens]
 ref|XP_005261217.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Homo sapiens]
 ref|XP_006724092.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X3 [Homo sapiens]
 ref|XP_006724093.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X4 [Homo sapiens]
 sp|Q9NRZ7.1|PLCC_HUMAN RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
gamma; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 
3; Short=1-AGP acyltransferase 3; Short=1-AGPAT 3; AltName: 
Full=Lysophosphatidic acid acyltransferase gamma; Short=LPAAT-gamma 
[Homo sapiens]
 gb|AAF80336.1|AF156774_1 lysophosphatidic acid acyltransferase-gamma1 [Homo sapiens]
 dbj|BAB18943.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Homo sapiens]
 gb|AAH11971.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Homo sapiens]
 gb|AAH63552.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Homo sapiens]
 gb|AAH40603.1| AGPAT3 protein [Homo sapiens]
 gb|EAX09461.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 gb|EAX09463.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 gb|EAX09464.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 gb|EAX09465.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 dbj|BAJ17860.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [synthetic construct]
 gb|ADQ31993.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [synthetic construct]
 gb|AIC51937.1| AGPAT3, partial [synthetic construct]
 gb|AIC56809.1| AGPAT3, partial [synthetic construct]
Length=376

 Score =   114 bits (285),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 42.0 bits (97),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_001146797.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_001146861.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_009438696.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_009438806.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_009438849.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
Length=376

 Score =   114 bits (285),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 42.0 bits (97),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_006608632.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Apis dorsata]
Length=404

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 1/131 (1%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLM  249
            TN  Q   Y  +RPFS+  YR+IN       + +LV+LI+WW+G    LY D     K  
Sbjct  46   TNFFQCFLYFGLRPFSRYCYRKINYYLCYSFYTQLVFLIEWWSGSDFILYMDRNDLEKHF  105

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            G+EH  ++ NH  +IDW++GWVL +R G LG+  A +KKS  Y+P +GW   FSEY+FLE
Sbjct  106  GEEHGYILMNHSYEIDWLIGWVLCERKGILGNCKAYVKKSLQYIPTLGWGWKFSEYIFLE  165

Query  430  RSWAKDESTLK  462
            R+W KD+  ++
Sbjct  166  RNWEKDKEIIR  176



>ref|NP_001127407.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Pongo abelii]
 sp|Q5RA57.1|PLCC_PONAB RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
gamma; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 
3; Short=1-AGP acyltransferase 3; Short=1-AGPAT 3; AltName: 
Full=Lysophosphatidic acid acyltransferase gamma; Short=LPAAT-gamma 
[Pongo abelii]
 emb|CAH91353.1| hypothetical protein [Pongo abelii]
Length=376

 Score =   114 bits (285),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 42.0 bits (97),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_003689806.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Apis florea]
Length=404

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 1/131 (1%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLM  249
            TN  Q   Y  +RPFS+  YR+IN       + +LV+LI+WW+G    LY D     K  
Sbjct  46   TNFFQCFLYFGLRPFSRYCYRKINYYLCYSFYTQLVFLIEWWSGSDFILYMDKNDLEKHF  105

Query  250  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            G+EH  ++ NH  ++DW++GWVL +R G LG+  A +KKS  Y+P +GW   FSEY+FLE
Sbjct  106  GEEHGYILMNHSYEVDWLIGWVLCERKGILGNCKAYVKKSLQYIPTLGWGWKFSEYIFLE  165

Query  430  RSWAKDESTLK  462
            R+W KD+  ++
Sbjct  166  RNWEKDKEIIR  176



>gb|KDR11829.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Zootermopsis 
nevadensis]
Length=398

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N IQA+ Y  +RPFSK  YR+IN      L+ +LV++ +WWA   + +Y D E   +  G
Sbjct  30   NLIQALLYCGLRPFSKYLYRKINYYVCYSLYCQLVFMAEWWASTDLIIYIDKEDLERYYG  89

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEH  LI NHR ++DW++GWVL  R   LG+     KKS  Y+P +GW+  F+E +FLER
Sbjct  90   KEHGFLIMNHRYEVDWLMGWVLCDRVNILGNCKTYAKKSIQYVPTMGWAWMFAESVFLER  149

Query  433  SWAKDESTL  459
            +W KD+ T+
Sbjct  150  NWEKDKETI  158



>gb|AAQ89067.1| AGPAT3 [Homo sapiens]
Length=368

 Score =   114 bits (285),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 42.0 bits (97),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_001849976.1| 1-acylglycerol-3-phosphate acyltransferase [Culex quinquefasciatus]
 gb|EDS31134.1| 1-acylglycerol-3-phosphate acyltransferase [Culex quinquefasciatus]
Length=370

 Score =   119 bits (297),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q I Y  ++PF+K  YR+I        + +LV+L DWW+G  + +Y   E  K  GK
Sbjct  30   NTVQCILYFGLKPFNKRLYRKIGYYLCYSFYSQLVFLADWWSGSTLYVYISDEDLKYCGK  89

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH LL+ NH  +IDW+VGWV  ++ G LG+  A  KK   Y+P IGW+  F+E++FLERS
Sbjct  90   EHVLLLMNHTYEIDWLVGWVFCEKVGVLGNCKAYAKKVIQYIPTIGWAWKFAEFVFLERS  149

Query  436  WAKDESTL  459
            + KD+  +
Sbjct  150  FDKDKEII  157


 Score = 37.0 bits (84),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  465  LKRLQDYPLPFWLALFVEGTRFTQAKLLAA  554
            +K + DYP P WL L  EGTRFT+ K  A+
Sbjct  161  IKEIMDYPDPVWLLLNAEGTRFTEKKHEAS  190



>dbj|BAG62268.1| unnamed protein product [Homo sapiens]
Length=370

 Score =   114 bits (285),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T +  GK
Sbjct  29   NFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D  T  V++G R
Sbjct  148  WEEDRDT--VVEGLR  160


 Score = 41.6 bits (96),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +EGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VEGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>ref|XP_001944534.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta-like 
[Acyrthosiphon pisum]
Length=386

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 87/140 (62%), Gaps = 1/140 (1%)
 Frame = +1

Query  73   TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  252
             N +Q + ++ + P +K  +R+IN  F+ +++ ELV+L DWWAG+    Y + E +K  G
Sbjct  29   VNLLQLLFFITLWPLNKDLFRKINYYFSYIIYSELVFLSDWWAGIPYYFYINKEDYKFFG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQR-SGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  429
            KEHA+ I NH+ +IDW+  WV+  R  G LG+  A  K S  Y+PVIGW+ +F E+LFL+
Sbjct  89   KEHAIFIINHKYEIDWLTAWVVHDRIGGILGNCKAFAKNSLKYMPVIGWAWWFGEFLFLQ  148

Query  430  RSWAKDESTLKVLKGYRITH  489
            R   KD+ T++   G    H
Sbjct  149  RDLVKDKHTIETKLGKLFEH  168



>ref|XP_011161524.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Solenopsis invicta]
Length=387

 Score =   117 bits (292),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D + F K  G
Sbjct  29   NFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDKQDFDKYFG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
             EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   NEHGYLLMNHSYETDWLLGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTLK  462
            SW KD+  +K
Sbjct  149  SWEKDKENIK  158


 Score = 38.5 bits (88),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +3

Query  450  EHIEG-LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            E+I+G +K L +YP   WL L+ EGTRFT  KL A+Q
Sbjct  155  ENIKGQIKELVEYPDTMWLLLYPEGTRFTPKKLEASQ  191



>ref|XP_011261943.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Camponotus floridanus]
Length=387

 Score =   117 bits (294),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D + F K  G
Sbjct  29   NFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSNLILYIDKKDFDKYFG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
             EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   NEHGYLLMNHSYETDWLIGWLLCDRVKLLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTLK  462
            SW KD+  +K
Sbjct  149  SWEKDKENIK  158


 Score = 37.4 bits (85),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = +3

Query  450  EHIEG-LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            E+I+  +K L +YP   WL L+ EGTRFT  KL A+Q
Sbjct  155  ENIKNQIKELVEYPDTMWLLLYPEGTRFTSKKLEASQ  191



>ref|XP_003798130.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Otolemur garnettii]
Length=376

 Score =   114 bits (284),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  91   ICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALL  270
            +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD  T    GKEHA++
Sbjct  33   LCMLALWPLSKQLYRRVNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVDRFGKEHAVI  92

Query  271  ISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDE  450
            I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R W +D 
Sbjct  93   ILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDR  152

Query  451  STL  459
             T+
Sbjct  153  DTV  155


 Score = 41.2 bits (95),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            I GLKRL DYP   W  L+ EGTRFT+ K
Sbjct  156  IAGLKRLSDYPEYMWFLLYCEGTRFTETK  184



>gb|EFN64501.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Camponotus 
floridanus]
Length=360

 Score =   117 bits (294),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D + F K  G
Sbjct  29   NFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSNLILYIDKKDFDKYFG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
             EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   NEHGYLLMNHSYETDWLIGWLLCDRVKLLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTLK  462
            SW KD+  +K
Sbjct  149  SWEKDKENIK  158


 Score = 37.4 bits (85),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = +3

Query  450  EHIEG-LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            E+I+  +K L +YP   WL L+ EGTRFT  KL A+Q
Sbjct  155  ENIKNQIKELVEYPDTMWLLLYPEGTRFTSKKLEASQ  191



>ref|XP_003705225.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Megachile rotundata]
Length=386

 Score =   117 bits (293),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 83/126 (66%), Gaps = 1/126 (1%)
 Frame = +1

Query  85   QAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMGKEH  261
            Q + Y  +RPFS+  YR+IN      L+ +LV++ +WW+G    ++ D + F K  GKEH
Sbjct  32   QCLLYFGLRPFSRYFYRKINYYLCYSLFSQLVFVAEWWSGTDPIMHIDKKEFEKYFGKEH  91

Query  262  ALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWA  441
            A L+ NHR +IDW++GW+  +R   LG+  A  KKS  Y+P+IGW+  F+E++FLER+W 
Sbjct  92   AYLVMNHRYEIDWLMGWIFCERISSLGNCKAYSKKSLQYVPIIGWTWKFAEFIFLERNWT  151

Query  442  KDESTL  459
            KD+  +
Sbjct  152  KDKEII  157


 Score = 37.4 bits (85),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  465  LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            +K L +YP   WL L+ EGTRFT+ KL A+Q
Sbjct  161  IKELCEYPDNIWLLLYPEGTRFTEKKLEASQ  191



>ref|XP_001607215.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214892.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214893.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214894.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214895.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
Length=387

 Score =   118 bits (296),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (63%), Gaps = 1/129 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q I Y  +RPFSK  YR+IN       + +LV++ +WW+G  V +Y D + F K  G
Sbjct  29   NFFQCILYFGLRPFSKYLYRKINYYLCYSFYSQLVFMAEWWSGTDVIIYIDKKDFEKYYG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEH  L+ NH  +IDW++GW+  +R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   KEHGYLVMNHSYEIDWLMGWMFCERIRMLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTL  459
            SW KD+ T+
Sbjct  149  SWDKDKETI  157


 Score = 36.6 bits (83),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +3

Query  465  LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            ++ L DYP   WL L+ EGTRFT  K  A+Q
Sbjct  161  IRELADYPDTMWLLLYAEGTRFTPEKAEASQ  191



>ref|XP_008545546.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Microplitis demolitor]
Length=387

 Score =   116 bits (291),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 81/129 (63%), Gaps = 1/129 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N +Q I Y+ ++PFSK  YR+IN       + +LV++ +WW+G  + +Y D   F K  G
Sbjct  29   NVLQCILYLGLKPFSKYYYRKINYYLCYSFYSQLVFMAEWWSGTDLIIYIDKNDFDKYYG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
            KEH  L+ NH  +IDW++GW+   R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   KEHGYLLMNHSYEIDWLMGWMFCDRIKMLGNCKAYAKKSIQYVPTLGWAWKFAESVFLER  148

Query  433  SWAKDESTL  459
            SW KD+ T+
Sbjct  149  SWEKDKETI  157


 Score = 37.7 bits (86),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +3

Query  465  LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            +  L DYP   WL L+ EGTRFT  KL A+Q
Sbjct  161  ISELGDYPDTMWLLLYAEGTRFTAEKLEASQ  191



>gb|EFZ17110.1| hypothetical protein SINV_05410 [Solenopsis invicta]
Length=172

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D + F K  G
Sbjct  29   NFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDKQDFDKYFG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
             EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   NEHGYLLMNHSYETDWLLGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTLK  462
            SW KD+  +K
Sbjct  149  SWEKDKENIK  158



>ref|XP_011338106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Cerapachys biroi]
 ref|XP_011338107.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Cerapachys biroi]
Length=513

 Score =   117 bits (294),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D + F K  G
Sbjct  29   NFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDKDDFAKYFG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
             EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   NEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTLK  462
            SW KD+  +K
Sbjct  149  SWEKDKEKIK  158


 Score = 37.0 bits (84),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +3

Query  465  LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            +K L +YP   WL L+ EGTRFT  KL A+Q
Sbjct  161  IKELVEYPDTMWLLLYPEGTRFTPKKLEASQ  191



>ref|XP_005323500.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Ictidomys tridecemlineatus]
Length=376

 Score =   111 bits (278),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +1

Query  91   ICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALL  270
            +C + + P +K  YRR+N   A  LW +LV L++WW+  +  L+TD  T    GKEH ++
Sbjct  33   LCTLALWPINKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVDRFGKEHVVI  92

Query  271  ISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDE  450
            I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R W +D 
Sbjct  93   ILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDR  152

Query  451  STLKVLKGYR  480
             T  V++G R
Sbjct  153  DT--VIEGLR  160


 Score = 42.0 bits (97),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IEGLRRLADYPEYMWFLLYCEGTRFTETK  184



>gb|EZA54711.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Cerapachys 
biroi]
Length=387

 Score =   117 bits (292),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMG  252
            N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D + F K  G
Sbjct  29   NFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDKDDFAKYFG  88

Query  253  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  432
             EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F+E +FLER
Sbjct  89   NEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKFAESIFLER  148

Query  433  SWAKDESTLK  462
            SW KD+  +K
Sbjct  149  SWEKDKEKIK  158


 Score = 36.6 bits (83),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +3

Query  465  LKRLQDYPLPFWLALFVEGTRFTQAKLLAAQ  557
            +K L +YP   WL L+ EGTRFT  KL A+Q
Sbjct  161  IKELVEYPDTMWLLLYPEGTRFTPKKLEASQ  191



>ref|XP_003962129.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Takifugu rubripes]
Length=377

 Score =   111 bits (278),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 85/138 (62%), Gaps = 5/138 (4%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQ +C  V+ P +K  YRRIN   +  LW +LV +++WW+G    LYTD  T  + GK
Sbjct  29   NFIQ-LCTCVLWPINKQLYRRINCRLSYSLWSQLVMMLEWWSGTDCTLYTDQATADMFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH ++I NH  +ID++ GW + +R G LGS+  + K   + +P+IGW+ +F E +F +R 
Sbjct  88   EHVIIILNHNFEIDFLCGWTICERFGVLGSSKVLAKHELLKVPLIGWTWYFLEIVFCKRR  147

Query  436  WAKDEST----LKVLKGY  477
            W +D +T    LK L+ Y
Sbjct  148  WEEDRNTVFTGLKRLQDY  165


 Score = 42.0 bits (97),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 27/44 (61%), Gaps = 5/44 (11%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQDMLHLQVYQFQG  593
            GLKRLQDYP   W  L+ EGTRFT+ K       + +QV + +G
Sbjct  158  GLKRLQDYPECMWFLLYCEGTRFTEKK-----HQISMQVAESKG  196



>gb|AAI58874.1| Agpat3 protein [Rattus norvegicus]
Length=356

 Score =   112 bits (281),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +1

Query  91   ICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALL  270
            +C + + P SK+ YRRIN   A  LW +LV L++WW+  +  L+TD  T    GKEH ++
Sbjct  13   LCTLALWPISKNLYRRINCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVNHFGKEHVVV  72

Query  271  ISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDE  450
            I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F E +F +R W +D 
Sbjct  73   ILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVFCKRKWEEDR  132

Query  451  STLKVLKGYR  480
             T  V++G R
Sbjct  133  DT--VIEGLR  140


 Score = 40.8 bits (94),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL +YP   W  L+ EGTRFT+ K
Sbjct  136  IEGLRRLANYPEYMWFLLYCEGTRFTETK  164



>ref|NP_001099848.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Rattus 
norvegicus]
 ref|XP_006256305.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Rattus norvegicus]
 ref|XP_006256306.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Rattus norvegicus]
 gb|EDL97048.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform 
CRA_b [Rattus norvegicus]
 gb|EDL97049.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform 
CRA_b [Rattus norvegicus]
 gb|EDL97051.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform 
CRA_b [Rattus norvegicus]
 gb|EDL97052.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform 
CRA_b [Rattus norvegicus]
Length=376

 Score =   112 bits (281),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +1

Query  91   ICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALL  270
            +C + + P SK+ YRRIN   A  LW +LV L++WW+  +  L+TD  T    GKEH ++
Sbjct  33   LCTLALWPISKNLYRRINCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVNHFGKEHVVV  92

Query  271  ISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDE  450
            I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F E +F +R W +D 
Sbjct  93   ILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVFCKRKWEEDR  152

Query  451  STLKVLKGYR  480
             T  V++G R
Sbjct  153  DT--VIEGLR  160


 Score = 40.8 bits (94),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL +YP   W  L+ EGTRFT+ K
Sbjct  156  IEGLRRLANYPEYMWFLLYCEGTRFTETK  184



>ref|XP_004410719.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Odobenus rosmarus divergens]
Length=376

 Score =   111 bits (278),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N +Q +C +V+ P +K  YRR+N   A  LW +LV L++WW+  +  L+TD  T    GK
Sbjct  29   NFVQ-LCTLVLWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVDRFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHVVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTL  459
            W +D+ T+
Sbjct  148  WEEDQDTV  155


 Score = 41.6 bits (96),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            IEGL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IEGLERLSDYPEYMWFLLYCEGTRFTEKK  184



>ref|XP_004264654.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Orcinus orca]
 ref|XP_004317505.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Tursiops truncatus]
Length=376

 Score =   112 bits (281),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 86/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N+IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+  +  L+TD  T    GK
Sbjct  29   NSIQ-LCTLVLWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVGHFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHVVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D     V+KG R
Sbjct  148  WEEDRDA--VIKGLR  160


 Score = 40.0 bits (92),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            I+GL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IKGLRRLADYPEYVWFLLYCEGTRFTEKK  184



>ref|XP_001745510.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89481.1| predicted protein [Monosiga brevicollis MX1]
Length=367

 Score =   109 bits (272),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 75/115 (65%), Gaps = 0/115 (0%)
 Frame = +1

Query  115  FSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALLISNHRSDI  294
            FS+  YR  N    +L W EL+W+++ W+G ++ +Y   E  +LMG E ++ + NH S++
Sbjct  36   FSRKHYRLANSAIVQLYWTELLWMLEQWSGCRLVVYGKDEDLELMGTESSVALCNHVSNV  95

Query  295  DWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDESTL  459
            DW++GW+LA + G LG    ++KK   +LPV+GWS +F EY ++ R+W KDE  +
Sbjct  96   DWLIGWLLADKFGVLGGAKCLLKKDLAFLPVLGWSWWFLEYTYISRNWEKDEKKI  150


 Score = 43.5 bits (101),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  459  EGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            +GL RLQDYPLPFW  ++ EGTR T  K
Sbjct  152  QGLSRLQDYPLPFWEVIYAEGTRKTPEK  179



>ref|XP_007452559.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Lipotes vexillifer]
Length=376

 Score =   112 bits (281),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 86/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N+IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+  +  L+TD  T    GK
Sbjct  29   NSIQ-LCTLVLWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVGHFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHVVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYR  480
            W +D     V+KG R
Sbjct  148  WEEDRDA--VIKGLR  160


 Score = 40.0 bits (92),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            I+GL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  IKGLRRLADYPEYVWFLLYCEGTRFTEKK  184



>ref|XP_008565934.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Galeopterus variegatus]
Length=403

 Score =   111 bits (278),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +1

Query  91   ICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALL  270
            +C +V+ P +K  YRR+N   A  LW +LV L++WW+  +  L+TD       GKEH ++
Sbjct  33   LCTLVLWPINKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQAAVDHFGKEHVVI  92

Query  271  ISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDE  450
            I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R W +D 
Sbjct  93   ILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDR  152

Query  451  STLKVLKGYR  480
             T  V++G R
Sbjct  153  DT--VVQGLR  160


 Score = 40.8 bits (94),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  IEGLKRLQDYPLPFWLALFVEGTRFTQAK  542
            ++GL+RL DYP   W  L+ EGTRFT+ K
Sbjct  156  VQGLRRLSDYPEYMWFLLYCEGTRFTETK  184



>gb|AGG54998.1| acyltransferase AGPAT6 [Heliothis virescens]
Length=383

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   IQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETF-KLMGKE  258
            IQA+ Y  ++PF+KS YR+IN   A   + +LV++ +WW+  K+ +Y   + + K  GKE
Sbjct  31   IQAVLYFGLKPFNKSLYRKINYYLAYSFYSQLVFMSEWWSNTKLSIYIKKDEYEKFYGKE  90

Query  259  HALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSW  438
            H  LI NH  +IDW++GW      G LG+  A  KKS  YLP IGW   FSE++FLERS+
Sbjct  91   HGYLIMNHSYEIDWLMGWHFCNTIGVLGNCKAYAKKSIQYLPPIGWMWKFSEFVFLERSY  150

Query  439  AKDESTLK  462
             KD+ T+K
Sbjct  151  EKDKETIK  158



>ref|XP_008498571.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Calypte anna]
 gb|KFP05918.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Calypte 
anna]
Length=376

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 100/172 (58%), Gaps = 16/172 (9%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D  T K  GK
Sbjct  29   NFIQ-LCTLVLWPVNKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVKTFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH ++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F E +F +R 
Sbjct  88   EHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTLKVLKGYRITHFLFGWHFLLKALALHRQSF*LLKICCIYRFTNSK  591
            W +D  T  V++G             LK LA + +    L  C   RFT +K
Sbjct  148  WEEDRDT--VIEG-------------LKRLADYPEYMWFLLYCEGTRFTETK  184



>ref|XP_003419084.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Loxodonta africana]
Length=376

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 101/172 (59%), Gaps = 16/172 (9%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQ +C +++ P +K  YRR+N   A  LW +LV L++WW+  +  L+TD  T   +GK
Sbjct  29   NFIQ-LCTLILWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATIDRLGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EH ++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P++GW+ +F EY+F +R 
Sbjct  88   EHVIIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLVGWTWYFLEYVFCKRK  147

Query  436  WAKDESTLKVLKGYRITHFLFGWHFLLKALALHRQSF*LLKICCIYRFTNSK  591
            W +D  T  V++G             LK L+ + + F  L  C   RFT +K
Sbjct  148  WEEDRQT--VIEG-------------LKRLSDYPEPFWFLLYCEGTRFTETK  184



>ref|XP_008275417.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Stegastes partitus]
 ref|XP_008275418.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Stegastes partitus]
Length=377

 Score =   113 bits (283),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 81/128 (63%), Gaps = 1/128 (1%)
 Frame = +1

Query  76   NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  255
            N IQ +C  V+ P +K  YRRIN   +  LW +LV L++WW+G    LYTD  T    GK
Sbjct  29   NFIQ-LCTCVLWPINKQLYRRINCRLSYSLWSQLVMLLEWWSGTDCTLYTDQATVDKFGK  87

Query  256  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  435
            EHA++I NH  +ID++ GW + +R G LGS+  + K   + +P+IGW+ +F E +F +R 
Sbjct  88   EHAIIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVFCKRK  147

Query  436  WAKDESTL  459
            W +D +T+
Sbjct  148  WEEDRNTV  155


 Score = 38.1 bits (87),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 5/44 (11%)
 Frame = +3

Query  462  GLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQDMLHLQVYQFQG  593
            GL RL+DYP   W  L+ EGTRFT+ K       + +QV + +G
Sbjct  158  GLGRLKDYPEYMWFLLYCEGTRFTEKK-----HQISMQVAESKG  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370