BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028C07

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG08050.1|  40S ribosomal S8                                        277   9e-91   Gossypium arboreum [tree cotton]
ref|XP_007146564.1|  hypothetical protein PHAVU_006G051300g             277   1e-90   Phaseolus vulgaris [French bean]
ref|XP_006373483.1|  hypothetical protein POPTR_0017s14180g             275   5e-90   Populus trichocarpa [western balsam poplar]
ref|XP_011021175.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     275   7e-90   Populus euphratica
ref|XP_011008256.1|  PREDICTED: 40S ribosomal protein S8-like           274   1e-89   Populus euphratica
ref|NP_001105391.1|  40S ribosomal protein S8                           274   1e-89   Zea mays [maize]
gb|KJB62959.1|  hypothetical protein B456_009G445800                    274   2e-89   Gossypium raimondii
gb|KHG04827.1|  40S ribosomal S8                                        274   2e-89   Gossypium arboreum [tree cotton]
gb|KJB84080.1|  hypothetical protein B456_N005000                       273   2e-89   Gossypium raimondii
ref|XP_010252680.1|  PREDICTED: 40S ribosomal protein S8                273   4e-89   Nelumbo nucifera [Indian lotus]
ref|XP_002446216.1|  hypothetical protein SORBIDRAFT_06g004770          273   5e-89   Sorghum bicolor [broomcorn]
ref|XP_010483522.1|  PREDICTED: 40S ribosomal protein S8-2-like         273   5e-89   Camelina sativa [gold-of-pleasure]
ref|XP_006437243.1|  hypothetical protein CICLE_v10032694mg             273   5e-89   Citrus clementina [clementine]
ref|NP_001046866.1|  Os02g0489400                                       272   6e-89   
gb|KDP45274.1|  hypothetical protein JCGZ_15139                         272   7e-89   Jatropha curcas
ref|NP_001052526.1|  Os04g0349500                                       272   8e-89   
ref|XP_010060252.1|  PREDICTED: 40S ribosomal protein S8                272   8e-89   Eucalyptus grandis [rose gum]
gb|KDO36309.1|  hypothetical protein CISIN_1g045444mg                   272   9e-89   Citrus sinensis [apfelsine]
ref|XP_007049644.1|  40S ribosomal protein S8 isoform 1                 272   9e-89   Theobroma cacao [chocolate]
ref|XP_007134162.1|  hypothetical protein PHAVU_010G024600g             272   1e-88   Phaseolus vulgaris [French bean]
gb|KDP39216.1|  hypothetical protein JCGZ_00973                         272   1e-88   Jatropha curcas
ref|XP_006452497.1|  hypothetical protein CICLE_v10009415mg             272   1e-88   Citrus clementina [clementine]
ref|XP_009778867.1|  PREDICTED: 40S ribosomal protein S8-like           271   1e-88   Nicotiana sylvestris
ref|XP_006484807.1|  PREDICTED: 40S ribosomal protein S8-like           271   1e-88   Citrus sinensis [apfelsine]
ref|NP_001132384.1|  uncharacterized protein LOC100193830               271   2e-88   Zea mays [maize]
gb|KJB22170.1|  hypothetical protein B456_004G033000                    271   2e-88   Gossypium raimondii
ref|XP_004510234.1|  PREDICTED: 40S ribosomal protein S8-like           271   2e-88   Cicer arietinum [garbanzo]
dbj|BAA07207.1|  ribosomal protein S8                                   271   2e-88   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008679872.1|  PREDICTED: 40S ribosomal protein S8-like           274   2e-88   
ref|XP_004242427.1|  PREDICTED: 40S ribosomal protein S8                271   2e-88   Solanum lycopersicum
gb|EAY93669.1|  hypothetical protein OsI_15456                          271   2e-88   Oryza sativa Indica Group [Indian rice]
gb|KJB13805.1|  hypothetical protein B456_002G095300                    271   3e-88   Gossypium raimondii
gb|KHM99496.1|  40S ribosomal protein S8                                271   3e-88   Glycine soja [wild soybean]
ref|XP_003532158.1|  PREDICTED: 40S ribosomal protein S8-like           271   3e-88   Glycine max [soybeans]
gb|KHG18510.1|  40S ribosomal S8                                        270   3e-88   Gossypium arboreum [tree cotton]
ref|XP_008657369.1|  PREDICTED: uncharacterized protein LOC100193...    270   4e-88   Zea mays [maize]
ref|XP_009378162.1|  PREDICTED: 40S ribosomal protein S8-like           270   4e-88   Pyrus x bretschneideri [bai li]
ref|XP_002299926.1|  40S ribosomal protein S8                           270   4e-88   Populus trichocarpa [western balsam poplar]
ref|XP_009373606.1|  PREDICTED: 40S ribosomal protein S8                270   4e-88   Pyrus x bretschneideri [bai li]
ref|XP_002269042.2|  PREDICTED: 40S ribosomal protein S8                270   5e-88   Vitis vinifera
ref|XP_009349000.1|  PREDICTED: 40S ribosomal protein S8-like           270   5e-88   Pyrus x bretschneideri [bai li]
ref|XP_008466734.1|  PREDICTED: 40S ribosomal protein S8-2              270   5e-88   Cucumis melo [Oriental melon]
ref|XP_008222788.1|  PREDICTED: 40S ribosomal protein S8                270   6e-88   Prunus mume [ume]
ref|XP_004492266.1|  PREDICTED: 40S ribosomal protein S8-like           270   6e-88   Cicer arietinum [garbanzo]
gb|KCW58021.1|  hypothetical protein EUGRSUZ_H00750                     270   6e-88   Eucalyptus grandis [rose gum]
ref|XP_002452585.1|  hypothetical protein SORBIDRAFT_04g028530          270   7e-88   Sorghum bicolor [broomcorn]
ref|XP_010454644.1|  PREDICTED: 40S ribosomal protein S8-2              270   7e-88   Camelina sativa [gold-of-pleasure]
gb|KJB81679.1|  hypothetical protein B456_013G156600                    270   7e-88   Gossypium raimondii
gb|AFK40150.1|  unknown                                                 270   8e-88   Lotus japonicus
ref|XP_004953910.1|  PREDICTED: 40S ribosomal protein S8-like           269   1e-87   Setaria italica
gb|KHF98591.1|  40S ribosomal S8                                        269   1e-87   Gossypium arboreum [tree cotton]
ref|XP_004148331.1|  PREDICTED: 40S ribosomal protein S8-like           269   1e-87   Cucumis sativus [cucumbers]
gb|KJB84081.1|  hypothetical protein B456_N005000                       270   1e-87   Gossypium raimondii
ref|XP_008792950.1|  PREDICTED: 40S ribosomal protein S8                269   1e-87   Phoenix dactylifera
gb|KJB22659.1|  hypothetical protein B456_004G059300                    269   2e-87   Gossypium raimondii
ref|XP_006281069.1|  hypothetical protein CARUB_v10027092mg             269   2e-87   Capsella rubella
ref|XP_008778380.1|  PREDICTED: 40S ribosomal protein S8-like           269   2e-87   Phoenix dactylifera
gb|AFK37035.1|  unknown                                                 269   2e-87   Lotus japonicus
ref|XP_002275094.1|  PREDICTED: 40S ribosomal protein S8                269   2e-87   Vitis vinifera
ref|XP_006601753.1|  PREDICTED: uncharacterized protein LOC100500...    268   2e-87   
gb|KHN25148.1|  40S ribosomal protein S8                                268   2e-87   Glycine soja [wild soybean]
gb|AFK33351.1|  unknown                                                 268   3e-87   Lotus japonicus
ref|XP_007020644.1|  40S ribosomal protein S8 isoform 1                 268   3e-87   
ref|XP_006373482.1|  hypothetical protein POPTR_0017s14180g             268   3e-87   Populus trichocarpa [western balsam poplar]
ref|XP_004975334.1|  PREDICTED: 40S ribosomal protein S8-like           268   3e-87   Setaria italica
ref|XP_010693327.1|  PREDICTED: 40S ribosomal protein S8-like           268   3e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001240243.1|  uncharacterized protein LOC100813170               268   3e-87   Glycine max [soybeans]
ref|XP_009416597.1|  PREDICTED: 40S ribosomal protein S8                268   4e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008337490.1|  PREDICTED: 40S ribosomal protein S8                268   4e-87   Malus domestica [apple tree]
ref|XP_010913108.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     268   4e-87   Elaeis guineensis
ref|XP_011021176.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     268   4e-87   Populus euphratica
gb|ACJ86093.1|  unknown                                                 267   5e-87   Medicago truncatula
ref|XP_004240435.1|  PREDICTED: 40S ribosomal protein S8-2              268   5e-87   Solanum lycopersicum
emb|CDP15136.1|  unnamed protein product                                270   5e-87   Coffea canephora [robusta coffee]
ref|XP_011025495.1|  PREDICTED: 40S ribosomal protein S8-like           267   5e-87   Populus euphratica
gb|AFK47179.1|  unknown                                                 267   5e-87   Medicago truncatula
ref|XP_009406344.1|  PREDICTED: 40S ribosomal protein S8-like           267   6e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907235.1|  PREDICTED: 40S ribosomal protein S8-like           267   6e-87   Elaeis guineensis
ref|XP_006352667.1|  PREDICTED: 40S ribosomal protein S8-like           267   6e-87   Solanum tuberosum [potatoes]
ref|XP_010675861.1|  PREDICTED: 40S ribosomal protein S8                267   6e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010646836.1|  PREDICTED: 40S ribosomal protein S8                267   7e-87   
ref|XP_009783183.1|  PREDICTED: 40S ribosomal protein S8                267   7e-87   Nicotiana sylvestris
ref|XP_003520991.1|  PREDICTED: 40S ribosomal protein S8-like           267   8e-87   Glycine max [soybeans]
ref|XP_010913109.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     267   8e-87   Elaeis guineensis
ref|XP_009610547.1|  PREDICTED: 40S ribosomal protein S8                267   8e-87   Nicotiana tomentosiformis
ref|XP_008451649.1|  PREDICTED: 40S ribosomal protein S8-like           267   8e-87   Cucumis melo [Oriental melon]
ref|NP_001236970.1|  uncharacterized protein LOC100500112               266   1e-86   
ref|XP_010278451.1|  PREDICTED: 40S ribosomal protein S8-like           266   1e-86   Nelumbo nucifera [Indian lotus]
ref|XP_009413565.1|  PREDICTED: 40S ribosomal protein S8-like           267   1e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003547779.1|  PREDICTED: 40S ribosomal protein S8                266   1e-86   Glycine max [soybeans]
ref|XP_002529032.1|  40S ribosomal protein S8, putative                 266   1e-86   Ricinus communis
gb|ACU19111.1|  unknown                                                 266   1e-86   Glycine max [soybeans]
ref|XP_006833291.1|  hypothetical protein AMTR_s00109p00031400          266   1e-86   Amborella trichopoda
ref|XP_011069406.1|  PREDICTED: 40S ribosomal protein S8                266   1e-86   Sesamum indicum [beniseed]
ref|XP_002534344.1|  40S ribosomal protein S8, putative                 266   2e-86   Ricinus communis
ref|XP_003551567.1|  PREDICTED: 40S ribosomal protein S8                266   2e-86   Glycine max [soybeans]
ref|XP_008679876.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     267   3e-86   Zea mays [maize]
ref|XP_009371092.1|  PREDICTED: 40S ribosomal protein S8-like           266   3e-86   Pyrus x bretschneideri [bai li]
ref|XP_006286561.1|  hypothetical protein CARUB_v10001914mg             265   3e-86   Capsella rubella
ref|XP_011095494.1|  PREDICTED: 40S ribosomal protein S8                265   3e-86   Sesamum indicum [beniseed]
ref|XP_002313320.1|  40S ribosomal protein S8                           265   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_010069614.1|  PREDICTED: 40S ribosomal protein S8-like           265   4e-86   Eucalyptus grandis [rose gum]
ref|NP_001274851.1|  uncharacterized protein LOC102577693               265   5e-86   Solanum tuberosum [potatoes]
ref|NP_200732.2|  40S ribosomal protein S8-2                            265   5e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223947.1|  hypothetical protein PRUPE_ppa011148mg             265   7e-86   Prunus persica
gb|KJB81683.1|  hypothetical protein B456_013G156600                    265   8e-86   Gossypium raimondii
ref|XP_009403610.1|  PREDICTED: 40S ribosomal protein S8-like           265   8e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU16800.1|  unknown                                                 265   8e-86   Glycine max [soybeans]
ref|XP_010905161.1|  PREDICTED: 40S ribosomal protein S8-like           264   1e-85   Elaeis guineensis
gb|EYU33688.1|  hypothetical protein MIMGU_mgv1a013525mg                264   1e-85   Erythranthe guttata [common monkey flower]
sp|O81361.1|RS8_PRUAR  RecName: Full=40S ribosomal protein S8           264   1e-85   Prunus armeniaca
ref|XP_008809644.1|  PREDICTED: 40S ribosomal protein S8                264   2e-85   Phoenix dactylifera
ref|XP_004247043.1|  PREDICTED: 40S ribosomal protein S8                264   2e-85   Solanum lycopersicum
ref|XP_008366424.1|  PREDICTED: 40S ribosomal protein S8                263   2e-85   Malus domestica [apple tree]
ref|XP_007149668.1|  hypothetical protein PHAVU_005G089100g             263   2e-85   Phaseolus vulgaris [French bean]
ref|XP_009596732.1|  PREDICTED: 40S ribosomal protein S8                263   2e-85   Nicotiana tomentosiformis
ref|XP_010243157.1|  PREDICTED: 40S ribosomal protein S8-like iso...    263   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_004160707.1|  PREDICTED: 40S ribosomal protein S8-like           263   2e-85   
gb|ACU16398.1|  unknown                                                 265   2e-85   Glycine max [soybeans]
ref|XP_010270147.1|  PREDICTED: 40S ribosomal protein S8-like           263   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_009361080.1|  PREDICTED: 40S ribosomal protein S8-like           263   3e-85   Pyrus x bretschneideri [bai li]
ref|XP_004149800.1|  PREDICTED: 40S ribosomal protein S8-like           263   3e-85   Cucumis sativus [cucumbers]
ref|XP_009405538.1|  PREDICTED: 40S ribosomal protein S8-like           263   4e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009771719.1|  PREDICTED: 40S ribosomal protein S8                263   4e-85   Nicotiana sylvestris
gb|AGV54796.1|  40S ribosomal protein S8                                263   4e-85   Phaseolus vulgaris [French bean]
ref|XP_010243156.1|  PREDICTED: 40S ribosomal protein S8-like iso...    263   4e-85   Nelumbo nucifera [Indian lotus]
ref|XP_006344091.1|  PREDICTED: 40S ribosomal protein S8-like           263   5e-85   Solanum tuberosum [potatoes]
emb|CDY60374.1|  BnaCnng36150D                                          263   5e-85   Brassica napus [oilseed rape]
ref|XP_006409551.1|  hypothetical protein EUTSA_v10022838mg             263   5e-85   Eutrema salsugineum [saltwater cress]
ref|XP_008227073.1|  PREDICTED: 40S ribosomal protein S8-like           262   6e-85   Prunus mume [ume]
ref|XP_009131790.1|  PREDICTED: 40S ribosomal protein S8-1              262   7e-85   Brassica rapa
gb|KFK31870.1|  hypothetical protein AALP_AA6G169300                    262   8e-85   Arabis alpina [alpine rockcress]
ref|XP_009126438.1|  PREDICTED: 40S ribosomal protein S8-1-like         262   8e-85   Brassica rapa
gb|ACJ83894.1|  unknown                                                 261   9e-85   Medicago truncatula
ref|XP_002873989.1|  ribosomal protein S8                               261   1e-84   Arabidopsis lyrata subsp. lyrata
ref|XP_010420870.1|  PREDICTED: 40S ribosomal protein S8-1-like         261   1e-84   Camelina sativa [gold-of-pleasure]
ref|XP_008364326.1|  PREDICTED: 40S ribosomal protein S8-like           261   1e-84   
ref|XP_006400597.1|  hypothetical protein EUTSA_v10014589mg             261   1e-84   Eutrema salsugineum [saltwater cress]
ref|XP_010493138.1|  PREDICTED: 40S ribosomal protein S8-1              261   1e-84   Camelina sativa [gold-of-pleasure]
emb|CDY45095.1|  BnaA02g04810D                                          262   2e-84   Brassica napus [oilseed rape]
ref|XP_009619873.1|  PREDICTED: 40S ribosomal protein S8-like           261   2e-84   Nicotiana tomentosiformis
gb|ACN31997.1|  unknown                                                 261   2e-84   Zea mays [maize]
gb|KJB62960.1|  hypothetical protein B456_009G445800                    261   2e-84   Gossypium raimondii
ref|XP_007211997.1|  hypothetical protein PRUPE_ppa011067mg             261   2e-84   
ref|XP_009602561.1|  PREDICTED: 40S ribosomal protein S8-like           261   2e-84   Nicotiana tomentosiformis
ref|XP_010541736.1|  PREDICTED: 40S ribosomal protein S8-1-like         260   4e-84   Tarenaya hassleriana [spider flower]
gb|EYU27406.1|  hypothetical protein MIMGU_mgv1a013520mg                259   7e-84   Erythranthe guttata [common monkey flower]
ref|XP_006856815.1|  hypothetical protein AMTR_s00055p00155570          259   8e-84   Amborella trichopoda
ref|XP_009770276.1|  PREDICTED: 40S ribosomal protein S8-like           259   9e-84   Nicotiana sylvestris
gb|KFK26269.1|  hypothetical protein AALP_AA8G225000                    259   1e-83   Arabis alpina [alpine rockcress]
emb|CDP03936.1|  unnamed protein product                                259   1e-83   Coffea canephora [robusta coffee]
ref|XP_009120819.1|  PREDICTED: 40S ribosomal protein S8-1              259   1e-83   Brassica rapa
emb|CDY35814.1|  BnaC09g37460D                                          260   2e-83   Brassica napus [oilseed rape]
gb|ABL85034.1|  ribosomal subunit 8E protein                            258   2e-83   Brachypodium sylvaticum
ref|XP_009765854.1|  PREDICTED: 40S ribosomal protein S8-like           258   2e-83   Nicotiana sylvestris
ref|XP_010235437.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     258   2e-83   Brachypodium distachyon [annual false brome]
ref|XP_010535902.1|  PREDICTED: 40S ribosomal protein S8-1-like         258   2e-83   Tarenaya hassleriana [spider flower]
gb|KJB13806.1|  hypothetical protein B456_002G095300                    258   2e-83   Gossypium raimondii
gb|KJB81682.1|  hypothetical protein B456_013G156600                    257   2e-83   Gossypium raimondii
ref|XP_004290159.1|  PREDICTED: 40S ribosomal protein S8-like           258   2e-83   Fragaria vesca subsp. vesca
ref|XP_003557224.1|  PREDICTED: 40S ribosomal protein S8                258   4e-83   Brachypodium distachyon [annual false brome]
emb|CBI39377.3|  unnamed protein product                                257   4e-83   Vitis vinifera
ref|XP_003574981.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     258   5e-83   Brachypodium distachyon [annual false brome]
emb|CDX92472.1|  BnaA10g15110D                                          258   5e-83   
ref|XP_006652189.1|  PREDICTED: 40S ribosomal protein S8-like           257   5e-83   
ref|XP_002864608.1|  40S ribosomal protein S8                           257   6e-83   
gb|KHG14255.1|  40S ribosomal S8                                        256   7e-83   Gossypium arboreum [tree cotton]
ref|XP_009594581.1|  PREDICTED: 40S ribosomal protein S8-2-like         257   9e-83   Nicotiana tomentosiformis
ref|XP_010097296.1|  40S ribosomal protein S8                           256   1e-82   
emb|CBI26725.3|  unnamed protein product                                256   1e-82   Vitis vinifera
ref|XP_011461093.1|  PREDICTED: 40S ribosomal protein S8                256   2e-82   Fragaria vesca subsp. vesca
gb|EMT18438.1|  40S ribosomal protein S8                                256   2e-82   
gb|EYU39184.1|  hypothetical protein MIMGU_mgv1a013531mg                256   2e-82   Erythranthe guttata [common monkey flower]
emb|CDX88842.1|  BnaA03g08070D                                          256   2e-82   
gb|KJB22660.1|  hypothetical protein B456_004G059300                    255   3e-82   Gossypium raimondii
ref|XP_006648644.1|  PREDICTED: 40S ribosomal protein S8-like           255   3e-82   
ref|XP_003626942.1|  Ribosomal protein S8                               266   5e-82   
ref|NP_197529.1|  40S ribosomal protein S8-1                            254   6e-82   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ89904.1|  predicted protein                                      254   6e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010519957.1|  PREDICTED: 40S ribosomal protein S8-1              254   6e-82   Tarenaya hassleriana [spider flower]
ref|XP_006369983.1|  hypothetical protein POPTR_0001s37140g             253   7e-82   
ref|XP_006346168.1|  PREDICTED: 40S ribosomal protein S8-like           254   9e-82   Solanum tuberosum [potatoes]
ref|XP_010926672.1|  PREDICTED: 40S ribosomal protein S8-like iso...    253   2e-81   
ref|XP_010926670.1|  PREDICTED: 40S ribosomal protein S8-like iso...    253   2e-81   
ref|XP_010327196.1|  PREDICTED: 40S ribosomal protein S8                253   2e-81   Solanum lycopersicum
ref|XP_004244061.1|  PREDICTED: 40S ribosomal protein S8-like           253   2e-81   Solanum lycopersicum
gb|ACI15738.1|  putative 40S ribosomal protein S8-like protein          253   2e-81   Picrorhiza kurrooa
ref|XP_007049645.1|  40S ribosomal protein S8 isoform 3                 251   4e-81   
ref|NP_001275100.1|  putative 40S ribosomal protein S8-like protein     251   2e-80   Solanum tuberosum [potatoes]
gb|EYU39185.1|  hypothetical protein MIMGU_mgv1a013531mg                249   3e-80   Erythranthe guttata [common monkey flower]
ref|XP_011089042.1|  PREDICTED: 40S ribosomal protein S8-like           250   3e-80   Sesamum indicum [beniseed]
gb|EMS65111.1|  40S ribosomal protein S8                                252   3e-80   Triticum urartu
ref|XP_010520566.1|  PREDICTED: 40S ribosomal protein S8-1-like         249   6e-80   Tarenaya hassleriana [spider flower]
ref|XP_006352532.1|  PREDICTED: 40S ribosomal protein S8                249   1e-79   
gb|EPS68663.1|  hypothetical protein M569_06106                         247   5e-79   Genlisea aurea
gb|ABK21921.1|  unknown                                                 246   1e-78   Picea sitchensis
ref|XP_001761026.1|  predicted protein                                  245   3e-78   
gb|ABK21933.1|  unknown                                                 244   7e-78   Picea sitchensis
gb|ABK22298.1|  unknown                                                 244   9e-78   Picea sitchensis
gb|AET01418.2|  40S ribosomal protein S8                                244   4e-77   Medicago truncatula
gb|ABR16896.1|  unknown                                                 242   5e-77   Picea sitchensis
gb|EPS68749.1|  hypothetical protein M569_06019                         246   5e-76   Genlisea aurea
ref|XP_001773385.1|  predicted protein                                  238   1e-75   
ref|XP_001777587.1|  predicted protein                                  238   2e-75   
ref|XP_001780988.1|  predicted protein                                  238   2e-75   
ref|XP_001777813.1|  predicted protein                                  236   6e-75   
gb|AES86897.2|  40S ribosomal S8-like protein                           234   8e-74   Medicago truncatula
ref|XP_003604700.1|  Ribosomal protein S8                               234   4e-73   
ref|XP_004516802.1|  PREDICTED: 40S ribosomal protein S8-like           234   1e-72   
ref|XP_008676011.1|  PREDICTED: 40S ribosomal protein S8-like           234   1e-72   
ref|XP_001696201.1|  ribosomal protein S8, component of cytosolic...    229   2e-72   Chlamydomonas reinhardtii
gb|ABA01100.1|  40S ribosomal protein S8                                226   4e-71   Chlamydomonas incerta
ref|XP_002963298.1|  hypothetical protein SELMODRAFT_80565              226   7e-71   
ref|XP_002945874.1|  component of cytosolic 80S ribosome and 40S ...    225   2e-70   Volvox carteri f. nagariensis
gb|EYU33690.1|  hypothetical protein MIMGU_mgv1a013952mg                223   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_010539242.1|  PREDICTED: 40S ribosomal protein S8-1-like         219   9e-69   Tarenaya hassleriana [spider flower]
gb|AFW66128.1|  putative ribosomal protein S8e family protein           214   6e-67   
gb|KJB81680.1|  hypothetical protein B456_013G156600                    212   3e-66   Gossypium raimondii
gb|KHG09566.1|  40S ribosomal protein S8                                213   3e-66   Gossypium arboreum [tree cotton]
ref|XP_008799563.1|  PREDICTED: 40S ribosomal protein S8-like           211   4e-66   
emb|CCA22399.1|  40S ribosomal protein S82 putative                     213   6e-66   Albugo laibachii Nc14
gb|KDD75705.1|  ribosomal protein S8e                                   218   9e-66   Helicosporidium sp. ATCC 50920
emb|CEG02139.1|  Ribosomal protein S8e/ribosomal biogenesis NSA2        213   1e-65   Ostreococcus tauri
ref|XP_011397165.1|  40S ribosomal protein S8                           212   1e-65   Auxenochlorella protothecoides
gb|EPZ31448.1|  40S ribosomal protein S8-B                              212   1e-65   Rozella allomycis CSF55
ref|XP_001422585.1|  Ribosomal protein S8, component of cytosolic...    212   3e-65   Ostreococcus lucimarinus CCE9901
ref|XP_005648786.1|  40S ribosomal protein S8                           212   3e-65   Coccomyxa subellipsoidea C-169
gb|KJB81681.1|  hypothetical protein B456_013G156600                    208   9e-65   Gossypium raimondii
ref|XP_005844426.1|  hypothetical protein CHLNCDRAFT_139122             210   2e-64   Chlorella variabilis
gb|KDO22073.1|  40S ribosomal protein S8                                208   6e-64   Saprolegnia parasitica CBS 223.65
gb|AGE46026.1|  40S ribosomal protein S8                                206   9e-64   Elaeis guineensis
emb|CAA03954.1|  ribosomal protein S8                                   204   1e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008608971.1|  40S ribosomal protein S8                           207   2e-63   Saprolegnia diclina VS20
emb|CCI48864.1|  unnamed protein product                                206   4e-63   Albugo candida
tpg|DAA53686.1|  TPA: putative ribosomal protein S8e family protein     209   4e-63   
gb|ABR25841.1|  40S ribosomal protein S8                                204   8e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_005539190.1|  40S ribosomal protein S8                           202   9e-62   Cyanidioschyzon merolae strain 10D
ref|XP_668115.1|  ribosomal protein S8                                  202   2e-61   Cryptosporidium hominis TU502
ref|XP_002142692.1|  40S ribosomal protein S8                           201   2e-61   Cryptosporidium muris RN66
gb|KHG07290.1|  40S ribosomal S8                                        199   6e-61   Gossypium arboreum [tree cotton]
ref|XP_001745896.1|  hypothetical protein                               201   8e-61   Monosiga brevicollis MX1
ref|XP_627792.1|  40S ribosomal protein S8                              200   9e-61   Cryptosporidium parvum Iowa II
gb|EKD00868.1|  40S ribosomal protein S8                                200   1e-60   Trichosporon asahii var. asahii CBS 8904
gb|AFW61714.1|  putative ribosomal protein S8e family protein           198   1e-60   
ref|XP_008871313.1|  40S ribosomal protein S8                           198   5e-60   Aphanomyces invadans
ref|XP_009831251.1|  40S ribosomal protein S8                           198   6e-60   Aphanomyces astaci
gb|KFH71035.1|  40S ribosomal protein S8                                197   7e-60   Mortierella verticillata NRRL 6337
ref|XP_003083062.1|  RS8_MAIZE 40S ribosomal protein S8 pir||T040...    203   7e-60   
gb|AGH70192.1|  40S ribosomal protein S8                                197   8e-60   Placozoa sp. H4
gb|EJT52835.1|  40S ribosomal protein S8                                197   1e-59   Trichosporon asahii var. asahii CBS 2479
gb|KIO10111.1|  hypothetical protein M404DRAFT_996068                   197   1e-59   Pisolithus tinctorius Marx 270
ref|XP_572078.1|  40S ribosomal protein S8                              197   2e-59   Cryptococcus neoformans var. neoformans JEC21
gb|KIK09143.1|  hypothetical protein K443DRAFT_447984                   197   2e-59   Laccaria amethystina LaAM-08-1
ref|XP_003195106.1|  40S ribosomal protein S8                           196   2e-59   Cryptococcus gattii WM276
gb|AFR96425.1|  small subunit ribosomal protein S8e                     196   3e-59   Cryptococcus neoformans var. grubii H99
gb|AAX48884.1|  S8                                                      196   3e-59   Suberites domuncula
ref|XP_001622696.1|  hypothetical protein NEMVEDRAFT_v1g195152          196   3e-59   Nematostella vectensis
ref|XP_008647178.1|  PREDICTED: 40S ribosomal protein S8-like           195   3e-59   
ref|XP_002602335.1|  hypothetical protein BRAFLDRAFT_268377             196   3e-59   Branchiostoma floridae
gb|KGB76549.1|  40S ribosomal protein S8                                196   3e-59   Cryptococcus gattii VGII R265
ref|XP_002117056.1|  expressed hypothetical protein                     196   4e-59   Trichoplax adhaerens
tpg|DAA53687.1|  TPA: putative ribosomal protein S8e family protein     204   4e-59   
gb|KIR49123.1|  ribosomal protein S8.e                                  196   4e-59   Cryptococcus gattii CA1280
gb|KIK27780.1|  hypothetical protein PISMIDRAFT_169173                  196   5e-59   Pisolithus microcarpus 441
ref|XP_007397269.1|  hypothetical protein PHACADRAFT_258531             196   5e-59   Phanerochaete carnosa HHB-10118-sp
gb|KGG52480.1|  40S ribosomal protein S8                                195   6e-59   Mitosporidium daphniae
ref|XP_007266897.1|  40S ribosomal protein S8                           195   8e-59   Fomitiporia mediterranea MF3/22
ref|XP_009524162.1|  hypothetical protein PHYSODRAFT_285611             194   1e-58   Phytophthora sojae
ref|XP_002158630.1|  PREDICTED: 40S ribosomal protein S8-like iso...    194   1e-58   Hydra vulgaris
gb|KIJ26939.1|  hypothetical protein M422DRAFT_76964                    194   1e-58   Sphaerobolus stellatus SS14
ref|XP_007873882.1|  30S ribosomal protein S8e                          194   2e-58   
gb|KIM64970.1|  hypothetical protein SCLCIDRAFT_1212646                 194   2e-58   Scleroderma citrinum Foug A
ref|XP_001880116.1|  40S ribosomal protein S8                           194   2e-58   Laccaria bicolor S238N-H82
ref|XP_007001047.1|  hypothetical protein TREMEDRAFT_55820              194   2e-58   Tremella mesenterica DSM 1558
ref|XP_003029339.1|  40S ribosomal protein S8                           194   2e-58   Schizophyllum commune H4-8
gb|AFW61715.1|  putative ribosomal protein S8e family protein           195   2e-58   
gb|ETL40555.1|  40S ribosomal protein S8                                194   3e-58   Phytophthora parasitica
ref|XP_003059699.1|  predicted protein                                  194   3e-58   Micromonas pusilla CCMP1545
ref|XP_003707560.1|  PREDICTED: 40S ribosomal protein S8-like           193   3e-58   Megachile rotundata
ref|XP_007311714.1|  40S ribosomal protein S8                           193   4e-58   
ref|XP_003699508.1|  PREDICTED: 40S ribosomal protein S8-like           193   4e-58   
gb|EMD32142.1|  hypothetical protein CERSUDRAFT_88417                   193   4e-58   
ref|XP_009547527.1|  hypothetical protein HETIRDRAFT_440490             193   5e-58   
ref|XP_005702569.1|  40S ribosomal protein S8e                          193   5e-58   
ref|XP_003386813.1|  PREDICTED: 40S ribosomal protein S8-like           193   6e-58   
ref|XP_007843664.1|  40s ribosomal protein s8                           193   6e-58   
ref|XP_009026500.1|  hypothetical protein HELRODRAFT_193555             193   6e-58   
ref|XP_003397407.1|  PREDICTED: 40S ribosomal protein S8-like           192   6e-58   
ref|XP_006461206.1|  hypothetical protein AGABI2DRAFT_136253            193   7e-58   
gb|KDR75758.1|  hypothetical protein GALMADRAFT_226405                  192   8e-58   
gb|KIP11649.1|  hypothetical protein PHLGIDRAFT_27859                   192   8e-58   
gb|EWM25134.1|  40s ribosomal protein s8                                192   9e-58   
gb|EXX59183.1|  ribosomal 40S subunit protein S8B                       192   9e-58   
gb|ETP45024.1|  40S ribosomal protein S8                                192   9e-58   
ref|XP_008905363.1|  40S ribosomal protein S8                           192   9e-58   
ref|XP_007317717.1|  hypothetical protein SERLADRAFT_387784             192   1e-57   
ref|XP_007380781.1|  ribosomal protein S8e                              192   1e-57   
ref|XP_009039782.1|  hypothetical protein AURANDRAFT_30589              192   2e-57   
gb|KDQ27658.1|  hypothetical protein PLEOSDRAFT_1089421                 192   2e-57   
ref|XP_002472702.1|  40S ribosomal protein S8                           192   2e-57   
gb|KIY49072.1|  hypothetical protein FISHEDRAFT_65531                   192   2e-57   
gb|AAX62461.1|  ribosomal protein S8                                    191   2e-57   
gb|KIJ67640.1|  hypothetical protein HYDPIDRAFT_149439                  191   2e-57   
ref|XP_006561561.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     191   2e-57   
gb|KIL68834.1|  hypothetical protein M378DRAFT_157968                   191   2e-57   
ref|XP_003690352.1|  PREDICTED: 40S ribosomal protein S8-like           191   2e-57   
ref|XP_005781609.1|  hypothetical protein EMIHUDRAFT_415402             191   2e-57   
ref|XP_011141954.1|  PREDICTED: 40S ribosomal protein S8                191   3e-57   
ref|XP_005783873.1|  hypothetical protein EMIHUDRAFT_442198             191   3e-57   
gb|EJU03954.1|  40S ribosomal protein S8                                191   3e-57   
sp|Q8WQI5.1|RS8_SPOFR  RecName: Full=40S ribosomal protein S8           191   3e-57   
ref|NP_001037263.1|  ribosomal protein S8                               191   3e-57   
ref|XP_002787865.1|  40S ribosomal protein S8, putative                 191   3e-57   
gb|ABR13294.1|  putative 40S ribosomal protein S8                       188   4e-57   
ref|XP_002771622.1|  40S ribosomal protein S8, putative                 190   4e-57   
gb|KDQ57766.1|  hypothetical protein JAAARDRAFT_35455                   191   4e-57   
ref|XP_008033648.1|  40S ribosomal protein S8                           191   5e-57   
gb|ACY95327.1|  ribosomal protein S8                                    191   5e-57   
dbj|BAN20524.1|  ribosomal protein S8                                   190   5e-57   
gb|KIM92086.1|  hypothetical protein PILCRDRAFT_810109                  190   6e-57   
emb|CBJ28525.1|  conserved unknown protein                              190   6e-57   
gb|AAN05595.1|  ribosomal protein S8                                    190   7e-57   
dbj|BAM18930.1|  ribosomal protein S8                                   190   7e-57   
ref|XP_003725128.1|  PREDICTED: 40S ribosomal protein S8-like           190   8e-57   
gb|ADO27837.1|  40S ribosomal protein s8                                190   9e-57   
gb|KII92951.1|  hypothetical protein PLICRDRAFT_89444                   190   1e-56   
gb|KIK45130.1|  hypothetical protein CY34DRAFT_22712                    190   1e-56   
ref|XP_007864455.1|  ribosomal protein S8e                              190   1e-56   
gb|ABR27879.1|  40S ribosomal protein S8                                189   1e-56   
gb|EHJ65952.1|  40S ribosomal protein S8                                192   1e-56   
ref|XP_010746502.1|  PREDICTED: 40S ribosomal protein S8                189   1e-56   
ref|XP_008365334.1|  PREDICTED: 40S ribosomal protein S8-like           188   1e-56   
gb|AFW73090.1|  putative ribosomal protein S8e family protein           196   1e-56   
gb|KIY67149.1|  40S ribosomal protein S8                                189   1e-56   
ref|XP_007361817.1|  ribosomal protein S8e                              189   1e-56   
ref|NP_001011604.2|  40S ribosomal protein S8                           189   1e-56   
dbj|BAM17705.1|  ribosomal protein S8                                   189   2e-56   
gb|EPT02637.1|  hypothetical protein FOMPIDRAFT_1022771                 189   2e-56   
ref|XP_003742816.1|  PREDICTED: 40S ribosomal protein S8-like           189   2e-56   
ref|XP_003448492.1|  PREDICTED: 40S ribosomal protein S8-like           189   2e-56   
ref|XP_011167792.1|  PREDICTED: 40S ribosomal protein S8                189   2e-56   
ref|XP_008550312.1|  PREDICTED: 40S ribosomal protein S8                189   2e-56   
emb|CAJ17173.1|  ribosomal protein S8e                                  189   2e-56   
ref|XP_008660669.1|  PREDICTED: 40S ribosomal protein S8-like           187   2e-56   
tpg|DAA42540.1|  TPA: putative ribosomal protein S8e family protein     190   2e-56   
gb|ABZ04260.1|  ribosomal protein rps8                                  188   3e-56   
gb|AAC69196.2|  40S ribosomal protein S8                                188   3e-56   
gb|KDQ21918.1|  hypothetical protein BOTBODRAFT_150960                  188   4e-56   
gb|AFJ45046.1|  ribosomal protein S8                                    187   4e-56   
ref|XP_005924603.1|  PREDICTED: 40S ribosomal protein S8-like           188   4e-56   
gb|AFM90620.1|  40S ribosomal protein S8                                188   4e-56   
ref|XP_011258954.1|  PREDICTED: 40S ribosomal protein S8                188   4e-56   
ref|XP_008333134.1|  PREDICTED: 40S ribosomal protein S8                188   5e-56   
gb|AEL28852.1|  ribosomal protein S8                                    188   5e-56   
gb|ACQ57870.1|  40S ribosomal protein S8                                188   5e-56   
gb|AFW85401.1|  putative ribosomal protein S8e family protein           187   5e-56   
ref|XP_005729057.1|  PREDICTED: 40S ribosomal protein S8-like           188   5e-56   
ref|XP_001955491.1|  GF18798                                            187   6e-56   
ref|XP_011338463.1|  PREDICTED: 40S ribosomal protein S8                187   6e-56   
gb|EMS22797.1|  40S ribosomal protein s8                                188   6e-56   
emb|CDW77683.1|  ribosomal protein s8e family protein                   187   6e-56   
ref|NP_001128155.1|  40S ribosomal protein S8                           187   7e-56   
emb|CDO76014.1|  hypothetical protein BN946_scf184665.g6                188   7e-56   
ref|XP_011059444.1|  PREDICTED: 40S ribosomal protein S8                187   7e-56   
gb|KIW06343.1|  40S ribosomal protein S8-A                              187   8e-56   
ref|XP_006881181.1|  PREDICTED: 40S ribosomal protein S8-like           187   8e-56   
ref|XP_007878137.1|  hypothetical protein PFL1_06854                    187   9e-56   
gb|ADT80672.1|  ribosomal protein S8                                    187   9e-56   
gb|AJG43845.1|  ribosomal protein rps8                                  187   1e-55   
gb|AAV84252.1|  ribosomal protein S8                                    187   1e-55   
ref|NP_651740.1|  ribosomal protein S8, isoform C                       187   1e-55   
gb|EMG50668.1|  Ribosomal protein S8                                    186   1e-55   
ref|XP_002552513.1|  40S ribosomal protein S8                           186   1e-55   
dbj|BAF45896.1|  ribosomal protein S8                                   187   1e-55   
ref|XP_003975488.1|  PREDICTED: 40S ribosomal protein S8-like           187   2e-55   
gb|EJY84320.1|  40S ribosomal protein S8-2                              186   2e-55   
gb|AAT08014.1|  putative 40S ribosomal protein S8                       187   2e-55   
emb|CCQ18591.1|  40S ribosomal protein S8                               186   2e-55   
emb|CEG73596.1|  Putative 40S ribosomal protein S8                      186   2e-55   
gb|KIM40224.1|  hypothetical protein M413DRAFT_446389                   186   2e-55   
ref|XP_765516.1|  40S ribosomal protein S8e                             186   2e-55   
ref|NP_001187073.1|  40S ribosomal protein S8                           186   2e-55   
gb|EFX81462.1|  hypothetical protein DAPPUDRAFT_303431                  186   2e-55   
ref|XP_006675830.1|  hypothetical protein BATDEDRAFT_36328              186   2e-55   
emb|CEG65019.1|  Putative 40S ribosomal protein S8                      186   2e-55   
gb|ADQ00177.1|  40S ribosomal protein S8                                185   2e-55   
ref|XP_002505425.1|  predicted protein                                  186   2e-55   
ref|XP_002000771.1|  GI10411                                            186   2e-55   
ref|NP_593100.1|  40S ribosomal protein S8                              186   2e-55   
ref|XP_005815191.1|  PREDICTED: 40S ribosomal protein S8-like iso...    186   3e-55   
emb|CAH57693.1|  40S ribosomal protein S8                               186   3e-55   
gb|AEE62947.1|  unknown                                                 186   3e-55   
emb|CCO29805.1|  40S ribosomal protein S8-A AltName: Full=RP19          186   3e-55   
ref|NP_594519.1|  40S ribosomal protein S8                              186   3e-55   
ref|XP_001830182.1|  40S ribosomal protein S8                           186   3e-55   
ref|XP_005856295.1|  small subunit ribosomal protein S8e                185   3e-55   
ref|XP_002098521.1|  GE23892                                            186   3e-55   
gb|ESW98222.1|  40S ribosomal protein S8-A                              185   4e-55   
emb|CEP60259.1|  LALA0S01e06612g1_1                                     185   4e-55   
ref|XP_001487630.1|  hypothetical protein PGUG_01007                    185   4e-55   
ref|XP_005303088.1|  PREDICTED: 40S ribosomal protein S8                186   4e-55   
emb|CDS03736.1|  hypothetical protein LRAMOSA01137                      185   4e-55   
gb|ABV60330.1|  40S ribosomal protein S8-like protein                   185   5e-55   
emb|CDS12850.1|  hypothetical protein LRAMOSA05034                      185   5e-55   
dbj|BAD26659.1|  Ribosomal protein S8                                   185   5e-55   
ref|XP_006114784.1|  PREDICTED: 40S ribosomal protein S8                186   5e-55   
ref|XP_004678985.1|  PREDICTED: 40S ribosomal protein S8                185   5e-55   
ref|XP_004995866.1|  40S ribosomal protein S8                           185   5e-55   
ref|XP_009943981.1|  PREDICTED: 40S ribosomal protein S8                186   5e-55   
ref|XP_008290025.1|  PREDICTED: 40S ribosomal protein S8                185   6e-55   
ref|XP_011123171.1|  hypothetical protein AOL_s00081g50                 185   6e-55   
ref|XP_007567486.1|  PREDICTED: 40S ribosomal protein S8                185   6e-55   
gb|EHN03767.1|  Rps8bp                                                  185   6e-55   
ref|XP_002129681.1|  PREDICTED: 40S ribosomal protein S8                185   6e-55   
gb|EJT41679.1|  hypothetical protein SKUD_188904                        185   7e-55   
ref|XP_011107810.1|  hypothetical protein H072_1819                     185   7e-55   
ref|XP_006273333.1|  PREDICTED: 40S ribosomal protein S8                185   8e-55   
emb|CEL58813.1|  40S ribosomal protein S8-B OS=Saccharomyces cere...    186   8e-55   
gb|KIM21886.1|  hypothetical protein M408DRAFT_333202                   185   9e-55   
ref|XP_002908634.1|  40S ribosomal protein S8-2                         185   9e-55   
gb|ABM55665.1|  putative ribosomal protein S8e                          184   9e-55   
gb|EFN82821.1|  40S ribosomal protein S8                                184   9e-55   
ref|XP_011102403.1|  rps8ap                                             184   9e-55   
ref|NP_001239055.1|  40S ribosomal protein S8                           184   1e-54   
ref|XP_001376099.1|  PREDICTED: 40S ribosomal protein S8                184   1e-54   
emb|CDH48276.1|  40s ribosomal protein s8                               184   1e-54   
ref|XP_009227358.1|  40S ribosomal protein S8                           184   1e-54   
ref|XP_003107910.1|  CRE-RPS-8 protein                                  184   1e-54   
gb|ETN60870.1|  40S ribosomal protein S8                                184   1e-54   
ref|XP_008107755.1|  PREDICTED: 40S ribosomal protein S8                184   1e-54   
gb|ABX44780.1|  putative 40S ribosomal protein RPS8                     184   1e-54   
ref|XP_011181207.1|  PREDICTED: 40S ribosomal protein S8                184   1e-54   
ref|XP_009970295.1|  PREDICTED: 40S ribosomal protein S8                185   1e-54   
ref|XP_010714500.1|  PREDICTED: 40S ribosomal protein S8                186   1e-54   
ref|XP_009991314.1|  PREDICTED: 40S ribosomal protein S8                184   1e-54   
gb|ABY87394.1|  ribosomal protein S8                                    184   1e-54   
ref|NP_001232282.1|  putative 40S ribosomal protein S8                  184   1e-54   
gb|ACH44382.1|  putative 40S ribosomal protein S8                       184   1e-54   
gb|AFW85400.1|  putative ribosomal protein S8e family protein           189   2e-54   
ref|XP_002055878.1|  GJ10625                                            184   2e-54   
ref|XP_004197370.1|  Piso0_004620                                       184   2e-54   
ref|XP_010292800.1|  PREDICTED: 40S ribosomal protein S8                184   2e-54   
ref|XP_005717008.1|  40S ribosomal protein S8                           184   2e-54   
gb|KDE09590.1|  40S ribosomal protein S8                                184   2e-54   
ref|XP_002175151.1|  40S ribosomal protein S8                           184   2e-54   
gb|AFM88001.1|  40S ribosomal protein S8                                184   2e-54   
ref|XP_002073028.1|  GK13918                                            184   2e-54   
ref|XP_006634805.1|  PREDICTED: 40S ribosomal protein S8-like           184   2e-54   
ref|XP_009075517.1|  PREDICTED: 40S ribosomal protein S8                184   2e-54   
ref|XP_001357651.1|  GA20600                                            184   2e-54   
ref|XP_010126964.1|  PREDICTED: 40S ribosomal protein S8                184   2e-54   
ref|XP_009958964.1|  PREDICTED: 40S ribosomal protein S8                184   2e-54   
ref|XP_009679268.1|  PREDICTED: 40S ribosomal protein S8                185   2e-54   
ref|XP_951769.1|  40S ribosomal protein S8                              183   2e-54   
ref|XP_004536550.1|  PREDICTED: 40S ribosomal protein S8-like           184   2e-54   
ref|XP_009813094.1|  PREDICTED: 40S ribosomal protein S8                184   2e-54   
gb|EHN02771.1|  Rps8bp                                                  183   2e-54   
gb|EPX70812.1|  40S ribosomal protein S8                                183   2e-54   
ref|XP_010172079.1|  PREDICTED: 40S ribosomal protein S8                184   2e-54   
gb|AFJ45055.1|  ribosomal protein S8                                    182   2e-54   
ref|XP_009323882.1|  PREDICTED: 40S ribosomal protein S8                184   2e-54   
emb|CAH04320.1|  S8e ribosomal protein                                  183   2e-54   
gb|KJA28980.1|  hypothetical protein HYPSUDRAFT_155175                  184   2e-54   
ref|XP_007374865.1|  hypothetical protein SPAPADRAFT_60688              183   3e-54   
ref|XP_004078646.1|  PREDICTED: 40S ribosomal protein S8                183   3e-54   
ref|XP_001604111.1|  PREDICTED: 40S ribosomal protein S8                183   3e-54   
ref|XP_010077725.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
ref|XP_009285726.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
ref|XP_009863870.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
ref|XP_001996113.1|  GH14312                                            183   3e-54   
ref|XP_009477726.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
emb|CDI77661.1|  40S ribosomal protein S8, putative                     183   3e-54   
ref|XP_002173241.1|  40S ribosomal protein S8                           183   3e-54   
emb|CAJ17178.1|  ribosomal protein S8e                                  183   3e-54   
ref|XP_010152828.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
ref|XP_010298650.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
gb|KIK67276.1|  hypothetical protein GYMLUDRAFT_861869                  183   3e-54   
gb|EYB94089.1|  hypothetical protein Y032_0175g487                      183   3e-54   
gb|EHH14717.1|  hypothetical protein EGK_00685                          183   3e-54   
ref|XP_009087131.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
ref|XP_009571612.1|  PREDICTED: 40S ribosomal protein S8                184   3e-54   
ref|XP_007766704.1|  40S ribosomal protein S8                           183   4e-54   
gb|ETN68840.1|  ribosomal protein S8.e                                  183   4e-54   
ref|XP_010186644.1|  PREDICTED: 40S ribosomal protein S8                184   4e-54   
ref|XP_004343838.1|  40S ribosomal protein S8                           183   4e-54   
ref|XP_967339.1|  PREDICTED: 40S ribosomal protein S8                   183   4e-54   
ref|XP_004555428.1|  PREDICTED: 40S ribosomal protein S8-like           185   4e-54   
gb|ADX97198.1|  40S ribosomal protein s8                                183   4e-54   
ref|XP_005423220.1|  PREDICTED: 40S ribosomal protein S8                184   4e-54   
ref|XP_002547240.1|  40S ribosomal protein S8                           182   4e-54   
gb|AFJ45051.1|  ribosomal protein S8                                    182   4e-54   
ref|XP_011444203.1|  PREDICTED: 40S ribosomal protein S8-like           183   5e-54   
emb|CDH55703.1|  40s ribosomal protein s8                               183   5e-54   
ref|XP_002618871.1|  hypothetical protein CLUG_00030                    182   5e-54   
emb|CAJ17175.1|  ribosomal protein S8e                                  182   5e-54   
gb|AFJ45047.1|  ribosomal protein S8                                    182   5e-54   
gb|KIJ19037.1|  hypothetical protein PAXINDRAFT_166933                  183   5e-54   
ref|XP_008432867.1|  PREDICTED: 40S ribosomal protein S8                182   5e-54   
gb|EFX06643.1|  40S ribosomal protein s8e                               182   5e-54   
gb|AFJ45049.1|  ribosomal protein S8                                    182   5e-54   



>gb|KHG08050.1| 40S ribosomal S8 [Gossypium arboreum]
Length=218

 Score =   277 bits (708),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKAAA  +   E    A EE KKSNHV RKLEKRQ+ RKLDSH+EEQFGSGRL+A
Sbjct  121  DIGRKKKAAAAAKKEGEEGETATEEVKKSNHVLRKLEKRQQSRKLDSHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  181  CISSRPGQCGRADGYIL  197



>ref|XP_007146564.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
 gb|ESW18558.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
Length=218

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK  A  +   E    A EE KKSNHV RKLEKR++ R LDSH+EEQFG GRL+A
Sbjct  121  DIGRKKKIVASAKKEGEDGEAATEEVKKSNHVLRKLEKRKQSRVLDSHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR+DGYIL
Sbjct  181  CISSRPGQCGRSDGYIL  197



>ref|XP_006373483.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51280.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=220

 Score =   275 bits (703),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKA  KKET E+      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAVVKKETPEQEGEATTEETKKSNHVIRKLEKRQQVRKLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  SISSRPGQCGRADGYIL  197



>ref|XP_011021175.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Populus euphratica]
Length=218

 Score =   275 bits (702),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKA  KKET E+      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAVVKKETPEQEGEATTEETKKSNHVIRKLEKRQQGRKLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  SISSRPGQCGRADGYIL  197



>ref|XP_011008256.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
 ref|XP_011015899.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=220

 Score =   274 bits (701),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK A   +   E    A EE KKSNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKTAPAAKKEGEDGEAAVEEEKKSNHVQRKLEKRQQTRKLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  SISSRPGQCGRADGYIL  197



>ref|NP_001105391.1| 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679873.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679875.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679877.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Zea mays]
 sp|Q08069.2|RS8_MAIZE RecName: Full=40S ribosomal protein S8 [Zea mays]
 gb|AAB06330.1| ribosomal protein S8 [Zea mays]
 gb|ACF80433.1| unknown [Zea mays]
 gb|ACG24637.1| 40S ribosomal protein S8 [Zea mays]
 gb|AFW66125.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66129.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66130.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66138.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66142.1| putative ribosomal protein S8e family protein [Zea mays]
Length=221

 Score =   274 bits (701),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakke--taeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK  A K+     +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL
Sbjct  121  DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>gb|KJB62959.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=218

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKAAA  +   E    A EE KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAAAGAKKEGEEGETATEEVKKSSHVLRKLEKRQQSRTLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  181  CISSRPGQCGRADGYIL  197



>gb|KHG04827.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A K+ A E   VA EETKKSNHVQRK EKRQKER LD+H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKTAAKKEATEEGEVAVEETKKSNHVQRKHEKRQKERTLDAHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>gb|KJB84080.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=219

 Score =   273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 186/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A K+ A E   VAAEETKKSNHV RKLEKRQKER LD+H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKTAAKKEATEDGEVAAEETKKSNHVLRKLEKRQKERTLDAHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_010252680.1| PREDICTED: 40S ribosomal protein S8 [Nelumbo nucifera]
Length=220

 Score =   273 bits (698),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK++A  +   E      EE KKSNHV RKLEKRQ+  KLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKSSASAKKEGEDGEATTEEAKKSNHVLRKLEKRQQGHKLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  AISSRPGQCGRADGYIL  197



>ref|XP_002446216.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
 gb|EES10544.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
Length=220

 Score =   273 bits (697),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKK   AKK+ AE +     AEETKKSNHVQRKLEKRQ+ R LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKVPVAKKDAAEGQEGEAIAEETKKSNHVQRKLEKRQQGRALDTHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_010483522.1| PREDICTED: 40S ribosomal protein S8-2-like [Camelina sativa]
Length=220

 Score =   273 bits (697),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKAAA K+  EE + VA E+ KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGRKKKAAASKKEGEEGDAVATEDVKKSNHVQRKLEIRQEGRALDSHLEEQFSSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  181  CISSRPGQCGRADGYIL  197



>ref|XP_006437243.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
 gb|ESR50483.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
Length=223

 Score =   273 bits (697),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 187/199 (94%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketa--eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKKA  KKET    E+   AAEETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL
Sbjct  121  DIGRKKKAVTKKETTEEGESAAAAAEETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|NP_001046866.1| Os02g0489400 [Oryza sativa Japonica Group]
 sp|P49199.2|RS8_ORYSJ RecName: Full=40S ribosomal protein S8 [Oryza sativa Japonica 
Group]
 pdb|3J60|I Chain I, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD21871.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAD21876.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAF08780.1| Os02g0489400 [Oryza sativa Japonica Group]
 dbj|BAG95703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73196.1| hypothetical protein OsI_07259 [Oryza sativa Indica Group]
 gb|EEE57012.1| hypothetical protein OsJ_06781 [Oryza sativa Japonica Group]
Length=220

 Score =   272 bits (696),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKKA A K+ AE +      EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKKAPAAKKDAEGQDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|KDP45274.1| hypothetical protein JCGZ_15139 [Jatropha curcas]
Length=221

 Score =   272 bits (696),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 187/200 (94%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaee---tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            DIGRKKK  AKKET EE        AEE KKSNHVQRKLEKRQK+RKLD H+EEQFG+GR
Sbjct  121  DIGRKKKTVAKKETTEEGDAAAPATAEEAKKSNHVQRKLEKRQKDRKLDPHIEEQFGAGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGRADGYIL
Sbjct  181  LLACISSRPGQCGRADGYIL  200



>ref|NP_001052526.1| Os04g0349500 [Oryza sativa Japonica Group]
 emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa Japonica Group]
 dbj|BAF14440.1| Os04g0349500 [Oryza sativa Japonica Group]
 gb|EAZ30323.1| hypothetical protein OsJ_14370 [Oryza sativa Japonica Group]
 dbj|BAG90858.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   272 bits (696),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKKA A K+ A   +    A EE KKSNHV RKLEKRQ+ R LDSH+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDAAEGQEGEAATEEAKKSNHVVRKLEKRQQTRTLDSHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_010060252.1| PREDICTED: 40S ribosomal protein S8 [Eucalyptus grandis]
 gb|KCW66870.1| hypothetical protein EUGRSUZ_F00627 [Eucalyptus grandis]
Length=219

 Score =   272 bits (695),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK  A  +   E     AEE KKS+HV RKLEKRQ ERKLD H+EEQF SGRL+A
Sbjct  121  DIGRKKKNQASAKKEGEEAEAPAEEVKKSSHVLRKLEKRQTERKLDQHIEEQFSSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  SISSRPGQCGRADGYIL  197



>gb|KDO36309.1| hypothetical protein CISIN_1g045444mg, partial [Citrus sinensis]
 gb|KDO60870.1| hypothetical protein CISIN_1g044642mg, partial [Citrus sinensis]
Length=217

 Score =   272 bits (695),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakk--etaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKKA  KK      E    AAEETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL
Sbjct  121  DIGRKKKAVTKKETTEEGEGAAAAAEETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_007049644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOX93801.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=219

 Score =   272 bits (695),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A K+ A E     AEETKKSNHV RKLEKRQK+RKLD+H+EEQFG+GRL+A
Sbjct  121  DIGR-KKKTAAKKEATEEGEGVAEETKKSNHVVRKLEKRQKDRKLDAHIEEQFGAGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_007134162.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
 gb|ESW06156.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
Length=218

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK AAKK++AEE +  AAEE KKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+A
Sbjct  121  DIGRKKKTAAKKDSAEEGDAAAAEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  181  CISSRPGQCGRCDGYIL  197



>gb|KDP39216.1| hypothetical protein JCGZ_00973 [Jatropha curcas]
Length=219

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A  +   E    A EE KKSNHV RKLEKRQ+ RKLD H+EEQF  GRLMA
Sbjct  121  DIGR-KKKVAATKKEGEEGEGATEEVKKSNHVLRKLEKRQQTRKLDPHIEEQFAGGRLMA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_006452497.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
 ref|XP_006474961.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
 gb|ESR65737.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
Length=223

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 185/200 (93%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketa---eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            DIGRKKKAAA   T    EE E  A EE KKSNHV RKLEKRQK+R LD H+EEQFGSGR
Sbjct  121  DIGRKKKAAAAATTKKEGEEGEAPATEEAKKSNHVSRKLEKRQKDRTLDPHIEEQFGSGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACI+SRPGQCGRADGYIL
Sbjct  181  LLACIASRPGQCGRADGYIL  200



>ref|XP_009778867.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=223

 Score =   271 bits (694),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkk-aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK A+ K+ T E       EE KKSNHV RKLEKRQK+RKLD HLEEQFGSGRL 
Sbjct  121  DIGRKKKGASKKETTEEGEAAAPVEEAKKSNHVARKLEKRQKDRKLDPHLEEQFGSGRLY  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_006484807.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
Length=223

 Score =   271 bits (694),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakk--etaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKKA  KK      E    AAEETKKSNHV RKLEKRQK+R LD H+EEQFG+GRL
Sbjct  121  DIGRKKKAVTKKETTEEGEGAAAAAEETKKSNHVVRKLEKRQKDRTLDPHIEEQFGAGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|NP_001132384.1| uncharacterized protein LOC100193830 [Zea mays]
 gb|ACF81204.1| unknown [Zea mays]
Length=221

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK   A K  T  +     AEETKKSNHVQRK+EKRQ++R LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKVPVAKKDATEGQEGEAIAEETKKSNHVQRKIEKRQQDRALDTHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACIS+RPGQCGRADGYIL
Sbjct  181  LACISARPGQCGRADGYIL  199



>gb|KJB22170.1| hypothetical protein B456_004G033000 [Gossypium raimondii]
Length=216

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 176/197 (89%), Gaps = 2/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR  K     +   E      EE KKSNHV RK+EKRQ+ RKLD H+E+QF SGRL+A
Sbjct  121  DIGR--KKKTAAKKEGEEGETGTEEVKKSNHVLRKMEKRQQNRKLDPHIEDQFASGRLLA  178

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  179  CISSRPGQCGRADGYIL  195



>ref|XP_004510234.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=217

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 182/197 (92%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK  A K+ A E      EE KKSNHVQRKLE RQKER+LDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKTASKKDAPEEAEAVTEEAKKSNHVQRKLETRQKERQLDSHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>dbj|BAA07207.1| ribosomal protein S8 [Oryza sativa Japonica Group]
Length=220

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakket-aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK          +      EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKKEPPHPRGCCGQDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_008679872.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=301

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  81   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  140

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  141  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  200

Query  370  DIGRkkkaaakke--taeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK  A K+     +    AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL
Sbjct  201  DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL  260

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  261  LACISSRPGQCGRADGYIL  279



>ref|XP_004242427.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=220

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeet-egvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK AA K+   E  +G A EETKKSNHV RK+EKRQ ERKLDSHLEEQF SGRL 
Sbjct  121  DIGRKKKGAAAKKETAEEGDGAATEETKKSNHVLRKIEKRQAERKLDSHLEEQFSSGRLY  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|EAY93669.1| hypothetical protein OsI_15456 [Oryza sativa Indica Group]
Length=221

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKKA A K+ A   +    A EE KKSNHV RKLEKRQ+ R LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDAAEGQEGEAATEEAKKSNHVVRKLEKRQQTRTLDAHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>gb|KJB13805.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
 gb|KJB13807.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=219

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            D+GRKKK  A     + E     AEE KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+
Sbjct  121  DLGRKKKTLAAATKKDGEEGETVAEEAKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|KHM99496.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASVKKEGEDGEAATEEVKKSNHVVRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_003532158.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
Length=219

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASVKKEGEDGEAATEEVKKSNHVVRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|KHG18510.1| 40S ribosomal S8 [Gossypium arboreum]
Length=216

 Score =   270 bits (691),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 176/197 (89%), Gaps = 2/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR  K     +   E      EE KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+A
Sbjct  121  DIGR--KKKTAAKKEGEEGETGTEEVKKSNHVLRKLEKRQQNRKLDPHIEDQFASGRLLA  178

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  179  CISSRPGQCGRADGYIL  195



>ref|XP_008657369.1| PREDICTED: uncharacterized protein LOC100193830 isoform X1 [Zea 
mays]
Length=223

 Score =   270 bits (691),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK   A K  T  +     AEETKKSNHVQRK+EKRQ++R LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKVPVAKKDATEGQEGEAIAEETKKSNHVQRKIEKRQQDRALDTHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACIS+RPGQCGRADGYIL
Sbjct  181  LACISARPGQCGRADGYIL  199



>ref|XP_009378162.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   270 bits (691),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGRKKK+ A K+   +      EE +KSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRKKKSGAAKKDTPDEGEGTTEEARKSNHVTRKLEKRQEGRTLDPHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGY+L
Sbjct  181  CISSRPGQCGRCDGYVL  197



>ref|XP_002299926.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92677.1| unknown [Populus trichocarpa]
 gb|EEE84731.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=220

 Score =   270 bits (691),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK A   +   E    A EE KKS HVQRKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKTAPAAKKEGEDGEAAVEEEKKSKHVQRKLEKRQQTRKLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  SISSRPGQCGRADGYIL  197



>ref|XP_009373606.1| PREDICTED: 40S ribosomal protein S8 [Pyrus x bretschneideri]
Length=221

 Score =   270 bits (691),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGRKKK+A  K+   E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRKKKSAVAKKDTPEEGEGTTEEAKKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  181  CISSRPGQCGRCDGYIL  197



>ref|XP_002269042.2| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
 emb|CAN64937.1| hypothetical protein VITISV_011515 [Vitis vinifera]
Length=221

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK  AKKET EE EG A EETKKSNHV RKLEKRQ++ +LD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKTTAKKETTEEGEGGATEETKKSNHVLRKLEKRQQDHRLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  SISSRPGQCGRADGYIL  197



>ref|XP_009349000.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGRKKK+ A K+   +      EE +KSNHV RK EKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRKKKSGAAKKDNPDEGEGTTEEARKSNHVTRKREKRQEGRTLDPHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGY+L
Sbjct  181  CISSRPGQCGRCDGYVL  197



>ref|XP_008466734.1| PREDICTED: 40S ribosomal protein S8-2 [Cucumis melo]
Length=220

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK AA  +  EE +  AAEE KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRLMA
Sbjct  121  DIGRKKKTAASTKKDEEGDAAAAEEVKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRLMA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  181  CISSRPGQCGRADGYIL  197



>ref|XP_008222788.1| PREDICTED: 40S ribosomal protein S8 [Prunus mume]
Length=221

 Score =   270 bits (690),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGRKKK AA K+   E      EE KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+A
Sbjct  121  EIGRKKKTAAAKKDTPEEGEATTEEAKKSNHVARKLEKRQQGRTLDAHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  181  CISSRPGQCGRADGYIL  197



>ref|XP_004492266.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=218

 Score =   270 bits (689),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGRKKK+AA K+ + E    A EE KKSNHVQRKLE RQK+R+LDSH+EEQFG GRL+A
Sbjct  121  EIGRKKKSAAAKKDSVEEVEAATEEAKKSNHVQRKLENRQKDRQLDSHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  181  CISSRPGQCGRADGYIL  197



>gb|KCW58021.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=221

 Score =   270 bits (690),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKAAA K+ A E E   AEE KKS HV RKLEKRQK+R+LD+H+EEQFGSGRL+A
Sbjct  121  DIGRKKKAAAAKKEATEGEAAPAEEAKKSAHVLRKLEKRQKDRQLDAHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR+DGYIL
Sbjct  181  CISSRPGQCGRSDGYIL  197



>ref|XP_002452585.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
 gb|EES05561.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
Length=221

 Score =   270 bits (689),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGR--kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGR  K  AA K+    +    AAEE KKSNHV+RKLEKRQ+ R+LD+H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKEAAEGQEGEAAAEEAKKSNHVKRKLEKRQEGRELDAHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_010454644.1| PREDICTED: 40S ribosomal protein S8-2 [Camelina sativa]
Length=218

 Score =   270 bits (689),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 178/197 (90%), Gaps = 2/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR  K  A     +E + VA EE KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGR--KKKAAAAATKEGDAVATEEVKKSNHVQRKLETRQEGRALDSHLEEQFSSGRLLA  178

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  179  CISSRPGQCGRADGYIL  195



>gb|KJB81679.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=217

 Score =   270 bits (689),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK +A  +   E    A EE KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKSAAAKKEGEEGETATEEVKKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>gb|AFK40150.1| unknown [Lotus japonicus]
Length=217

 Score =   270 bits (689),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELV+TQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK  A K+ + E     AE+TKKSNHVQRKLE RQK+R LDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKTAAKKDSTEEGEAVAEDTKKSNHVQRKLENRQKDRTLDSHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_004953910.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakke--taeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKKA A K+     +    AAEETKKSNHVQRKLEKR+  R LD H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDGAEGQEGEAAAEETKKSNHVQRKLEKRKDGRALDPHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACI+SRPGQCGRADGYIL
Sbjct  181  LACIASRPGQCGRADGYIL  199



>gb|KHF98591.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSVHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            D+GRKKK  A     E E     AEE KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+
Sbjct  121  DLGRKKKTPAAATKKEGEEGETVAEEAKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_004148331.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 ref|XP_004162922.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN61144.1| hypothetical protein Csa_2G059750 [Cucumis sativus]
Length=219

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  +     EE      EE KKSNHVQRK+EKRQ++RKLD H+EEQF SGRLMA
Sbjct  121  DIGR-KKKTSASVKKEEEGDAGTEEVKKSNHVQRKIEKRQQDRKLDPHIEEQFSSGRLMA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>gb|KJB84081.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=259

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = +1

Query  13   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  192
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL
Sbjct  42   GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  101

Query  193  DTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVD  372
            DTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGVD
Sbjct  102  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  161

Query  373  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  552
            IGR KK  A K+ A E   VAAEETKKSNHV RKLEKRQKER LD+H+EEQFGSGRL+AC
Sbjct  162  IGR-KKKTAAKKEATEDGEVAAEETKKSNHVLRKLEKRQKERTLDAHIEEQFGSGRLLAC  220

Query  553  ISSRPGQCGRADGYIL  600
            ISSRPGQCGRADGYIL
Sbjct  221  ISSRPGQCGRADGYIL  236



>ref|XP_008792950.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=222

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWY+QHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYIQHYGV  120

Query  370  DIGRkkkaaakketaeeteg--vaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            +IGRKKK  A K+ A E +    AAEE KKS+HV RKLEKRQ+ R+LD H+EEQFGSGRL
Sbjct  121  EIGRKKKTPAAKKEATEGQEGDGAAEEVKKSSHVLRKLEKRQQGRQLDPHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>gb|KJB22659.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=219

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 182/197 (92%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRR+TGGK+KAWRKKRKYELGRQP NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A K+ A E    AAEETK+S HV RKLEKRQK+RKLD H+EEQFG GRL+A
Sbjct  121  DIGR-KKKMASKKEATEEPEGAAEETKRSKHVARKLEKRQKDRKLDPHVEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_006281069.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
 gb|EOA13967.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
Length=220

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKKWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSE VTRKTRILDV YNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKAAA K+  E  + V  EE KKSNHVQRKLE RQ++R +DSHLEEQF SGRL+A
Sbjct  121  DIGRKKKAAATKKEGEGGDAVTTEEVKKSNHVQRKLEMRQEDRAIDSHLEEQFSSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGRADGYIL
Sbjct  181  CIASRPGQCGRADGYIL  197



>ref|XP_008778380.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=222

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaa-kketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGRKKKA A  K+ A E    A EE KKSNHV RKL+KRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAGTKKEATEEGEGATEEAKKSNHVLRKLDKRQQGRKLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|AFK37035.1| unknown [Lotus japonicus]
Length=218

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSE VTRKTRILDVVYNASNNELV+TQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            D+GRKKK A   +   E    A EE KKSNHV RKLEKR + R LD+H+EEQFG GRL+A
Sbjct  121  DLGRKKKGATAAKKEGEDVETATEEAKKSNHVLRKLEKRTENRTLDAHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR+DGYIL
Sbjct  181  CISSRPGQCGRSDGYIL  197



>ref|XP_002275094.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=219

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKKA+A  +   E     AEETKKSNHV RKLEKRQ+E KLD H+EEQFGSGRL+A
Sbjct  121  DIGRKKKASATAKKEGEEGDGPAEETKKSNHVVRKLEKRQQEHKLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  AISSRPGQCGRADGYIL  197



>ref|XP_006601753.1| PREDICTED: uncharacterized protein LOC100500112 isoform X1 [Glycine 
max]
 gb|KHN21285.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVK+AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK  A K+ + E    AAEETKKSNHVQRKLEKRQK+RKLDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKVASKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRKLDSHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>gb|KHN25148.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGR KK AA K+   E    VA EE KKSNH+QRKLEKRQK+RKLD+H+EEQFGSGRL+
Sbjct  121  EIGRKKKTAAKKETAEEGAAAVAVEEAKKSNHLQRKLEKRQKDRKLDAHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|AFK33351.1| unknown [Lotus japonicus]
Length=218

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWR+KRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRRKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSE VTRKTRILDVVYNASNNELV+TQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            D+GRKKK A   +   E      EE KKSNHV RKLEKR + R LD+H+EEQFG GRL+A
Sbjct  121  DLGRKKKGATAAKKEGEDVETVTEEAKKSNHVLRKLEKRTENRTLDAHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR+DGYIL
Sbjct  181  CISSRPGQCGRSDGYIL  197



>ref|XP_007020644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 ref|XP_007020645.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12169.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12170.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=220

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae--etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK AA     E  E   +A EE KKS HV RKLEKRQ  RKLDSH+EEQFGSGRL
Sbjct  121  DIGRKKKTAAAAAKKEGGEDGEIATEEVKKSGHVLRKLEKRQLNRKLDSHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_006373482.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51279.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=219

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK A  K+   E      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKAVVKKETPEEGEATTEETKKSNHVIRKLEKRQQVRKLDPHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  180  SISSRPGQCGRADGYIL  196



>ref|XP_004975334.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketaee--tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKKA A K+ A E       AEETKKSNHV RKLEKR+  R+LD H+EEQFGSGRL
Sbjct  121  DIGRKKKAPAAKKDAAEGQEGEAVAEETKKSNHVTRKLEKRKVGRQLDPHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACI+SRPGQCGRADGYIL
Sbjct  181  LACIASRPGQCGRADGYIL  199



>ref|XP_010693327.1| PREDICTED: 40S ribosomal protein S8-like [Beta vulgaris subsp. 
vulgaris]
Length=217

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            D+GR KK AA     E  EG   EE KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+A
Sbjct  121  DVGR-KKKAAAAAKKETEEGETTEEAKKSNHVARKLEKRQQNRTLDAHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|NP_001240243.1| uncharacterized protein LOC100813170 [Glycine max]
 gb|ACU18370.1| unknown [Glycine max]
 gb|KHN10948.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 184/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPF+QWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK  A K+ + E    AAEETKKSNHVQRKLEKRQK+R LDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKVAAKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRNLDSHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_009416597.1| PREDICTED: 40S ribosomal protein S8 [Musa acuminata subsp. malaccensis]
Length=223

 Score =   268 bits (685),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD GNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaee--tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            +IGRKKKA A K+ A E      A EE  KSNHV RKLEKRQ+ RKLD+H+EEQF SGRL
Sbjct  121  EIGRKKKAPAVKKEATEGQEAEPATEEANKSNHVTRKLEKRQQGRKLDAHIEEQFSSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGY+L
Sbjct  181  LACISSRPGQCGRADGYVL  199



>ref|XP_008337490.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=221

 Score =   268 bits (685),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR+KK+A  K+   E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGRRKKSAVAKKDTPEEGEGTTEEAKKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  181  CISSRPGQCGRCDGYIL  197



>ref|XP_010913108.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Elaeis guineensis]
Length=224

 Score =   268 bits (685),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 181/200 (91%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegv---aaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            +IGRKKKA A  +           A EE KKSNHV RKLEKRQ+ RKLD H+EEQFGSGR
Sbjct  121  EIGRKKKAPAATKKEATEGQEGEGATEEPKKSNHVLRKLEKRQQGRKLDPHIEEQFGSGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGRADGYIL
Sbjct  181  LLACISSRPGQCGRADGYIL  200



>ref|XP_011021176.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Populus euphratica]
Length=217

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK A  K+   E      EETKKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKAVVKKETPEEGEATTEETKKSNHVIRKLEKRQQGRKLDPHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  180  SISSRPGQCGRADGYIL  196



>gb|ACJ86093.1| unknown [Medicago truncatula]
 gb|AFK33939.1| unknown [Medicago truncatula]
 gb|KEH22555.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=217

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++GR KK  A K+ + E   V AEE KKS+HVQRKLE+RQK+R+LDSH+EEQFG GRL+A
Sbjct  121  EVGR-KKKTAAKKDSAEEAEVVAEEVKKSSHVQRKLEQRQKDRQLDSHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_004240435.1| PREDICTED: 40S ribosomal protein S8-2 [Solanum lycopersicum]
Length=220

 Score =   268 bits (684),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DI  +KK  A K+     EG AAEE KKSNHV RK+EKRQK+R LDSHLEEQF SGRL A
Sbjct  121  DI-GRKKKGAAKKETTTEEGDAAEEAKKSNHVVRKIEKRQKDRTLDSHLEEQFSSGRLYA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>emb|CDP15136.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   270 bits (689),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = +1

Query  1    ALAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWR  180
            A+ MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSS+KTVRRIRVRGGNVKWR
Sbjct  52   AVNMGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSDKTVRRIRVRGGNVKWR  111

Query  181  ALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQH  360
            ALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQH
Sbjct  112  ALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQH  171

Query  361  YGVDIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  537
            YGVDIGR KK    KKE  E     A EETKKSNHV RK+EKRQKERKLD+H+EEQFGSG
Sbjct  172  YGVDIGRKKKAVVVKKEGEEGEAAAATEETKKSNHVLRKIEKRQKERKLDAHIEEQFGSG  231

Query  538  RLMACISSRPGQCGRADGYIL  600
            RL+ACISSRPGQCGRADGYIL
Sbjct  232  RLLACISSRPGQCGRADGYIL  252



>ref|XP_011025495.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=219

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK  A  +   E    AA E  K+SNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKTTAASKKEGEEGEAAATEEVKQSNHVQRKLEKRQQTRKLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  181  ASISSRPGQCGRADGYIL  198



>gb|AFK47179.1| unknown [Medicago truncatula]
 gb|KEH18114.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=215

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 177/197 (90%), Gaps = 3/197 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR           EE    A EE KKS HVQRKLE+RQKER+LD+H+EEQFG GRL+A
Sbjct  121  DIGR---KKKNVSKKEEEAEAATEEVKKSAHVQRKLEQRQKERQLDAHIEEQFGGGRLLA  177

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  178  CISSRPGQCGRADGYIL  194



>ref|XP_009406344.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   267 bits (683),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD GNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGRKKKA + K+ A E    A EE KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A
Sbjct  121  EIGRKKKAPSAKKEATEEGEAATEEEKKSNHVTRKLEKRQQGRKLDPHIEEQFGSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  181  SISSRPGQCGRADGYIL  197



>ref|XP_010907235.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=223

 Score =   267 bits (683),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGR KK  AA K+ A E    A EE KKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAASKKEATEEGEGATEEAKKSNHVLRKLEKRQQCRTLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_006352667.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=221

 Score =   267 bits (683),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR--kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGR  K  AA K+   E     AAEETKKSNHV RK+EKR  +RKLDSHLEEQF SGRL
Sbjct  121  DIGRKKKGAAAKKETAEEGESAAAAEETKKSNHVLRKIEKRLADRKLDSHLEEQFSSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
             ACISSRPGQCGRADGYIL
Sbjct  181  YACISSRPGQCGRADGYIL  199



>ref|XP_010675861.1| PREDICTED: 40S ribosomal protein S8 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   267 bits (683),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK AA     E  EG   EE KKSNHV RKLEKRQ+ R LD+H+EEQFG GRL+A
Sbjct  121  EIGR-KKKAAASAKKEAEEGETTEEAKKSNHVARKLEKRQQTRTLDAHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_010646836.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=220

 Score =   267 bits (683),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATG KKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGSKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK AA K+   E      EETKKS+HV RKLEKRQ +RKLD H+EEQF SGRL+A
Sbjct  121  DIGR-KKKAAAKKETTEEGEAPVEETKKSSHVLRKLEKRQADRKLDPHIEEQFSSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_009783183.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   267 bits (683),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISTNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK  A  +     E    AAEETKKSNHV RK+E RQK+RKLD H+EEQFG GRL
Sbjct  121  DIGRKKKGPAKKETTEEGEGAAAAAEETKKSNHVLRKIETRQKDRKLDPHIEEQFGGGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_003520991.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
 gb|KHN05782.1| 40S ribosomal protein S8 [Glycine soja]
Length=220

 Score =   267 bits (682),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR--kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            +IGR  K  A  +          AAEE KKSNHVQRKLEKRQK+RKLD+H+EEQFG GRL
Sbjct  121  EIGRKKKTAAKKETAEEGGDAAAAAEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFGGGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_010913109.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Elaeis guineensis]
Length=222

 Score =   267 bits (682),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGRKKKA A  +     EG  A E  KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAATKKEATEEGEGATEEPKKSNHVLRKLEKRQQGRKLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_009610547.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=224

 Score =   267 bits (683),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISANKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK  A  +     E    AAEETKKSNHV RK+E RQK+RKLD H+EEQFG GRL
Sbjct  121  DIGRKKKGPAKKETTEEGEGAAAAAEETKKSNHVLRKIETRQKDRKLDPHIEEQFGGGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_008451649.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis melo]
Length=219

 Score =   267 bits (682),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  +     EE      EE KKSNHVQRK+EKRQ++RKLD H+EEQF SGRLMA
Sbjct  121  DIGR-KKKTSASAKKEEEGDAGTEEVKKSNHVQRKIEKRQQDRKLDPHIEEQFSSGRLMA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|NP_001236970.1| uncharacterized protein LOC100500112 [Glycine max]
 gb|ACU14990.1| unknown [Glycine max]
Length=217

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 184/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR LDVVYNASNNELV+TQTLVK+AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRTLDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK  A K+ + E    AAEETKKSNHVQRKLEKRQK+RKLDSH+EEQFG GRL+A
Sbjct  121  EIGR-KKKVASKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRKLDSHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_010278451.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=219

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSE VTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKKAAAKK+TAE +      EETKKS+HV RKLEKR +  KLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKAAAKKDTAEGQEGDGTTEETKKSSHVLRKLEKRLQGHKLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_009413565.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWY QHYG+
Sbjct  61   LDSGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYFQHYGI  120

Query  370  DIGRkkka-aakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGRKKKA  A K+ A E    A EE KKSNHV RKLEKRQ+  KLD H+EEQFG+GRL+
Sbjct  121  EIGRKKKAPTASKKEAAEEGEAAVEEGKKSNHVTRKLEKRQQGCKLDPHIEEQFGAGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_003547779.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
Length=219

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGR KK AA K+   E    VA EE KKSNH+QRKLEKRQK+RKLD+H+EEQFG GRL+
Sbjct  121  EIGRKKKTAAKKETAEEGAAAVAVEEAKKSNHLQRKLEKRQKDRKLDAHIEEQFGGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_002529032.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF33343.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=219

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 179/197 (91%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A  +   E    A EE KKSNHV RKLEKRQ+ RKLD H+EEQFG GRL+A
Sbjct  121  DIGR-KKKTAAAKKEGEEGEAATEEVKKSNHVLRKLEKRQQIRKLDPHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>gb|ACU19111.1| unknown [Glycine max]
Length=220

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 189/199 (95%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaee--tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            +IGRKKK AAKKETAEE      A EE KKSNHVQRKLEKRQK+RKLD+H+EEQFG GRL
Sbjct  121  EIGRKKKTAAKKETAEEGGDAVAATEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFGGGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_006833291.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
 gb|ERM98569.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
Length=218

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 175/197 (89%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPF+QWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGI  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK     +   E    A EE  KS HV RKLEKRQ+  KLD H+EEQFG GRL+A
Sbjct  121  DIGR-KKKTGAAKKEGEEGEAAIEEVNKSKHVLRKLEKRQEGHKLDPHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_011069406.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 183/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A K+  EE E  A EE KKSNHVQRK+EKRQ++RK+D H+EEQF SGRL+A
Sbjct  121  DIGR-KKKTAAKKEGEEAEAAATEEVKKSNHVQRKIEKRQQDRKIDPHIEEQFSSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  180  AISSRPGQCGRADGYIL  196



>ref|XP_002534344.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF28038.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=221

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkka-aakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK  A K+    E EG AAEE+KKSNHV RKLEKRQK+RKLD+H+EEQF  GRL+
Sbjct  121  DIGRKKKTVAKKETEEGEGEGAAAEESKKSNHVIRKLEKRQKDRKLDAHIEEQFWGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_003551567.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
 gb|KHN28407.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASAKKEGEDGEAATEEVKKSNHVLRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_008679876.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Zea mays]
Length=258

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 2/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketaee--tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK  A K+   E      AAEETKKSNHV RKLEKR++ R LD H+EEQFGSGRL
Sbjct  121  DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL  180

Query  544  MACISSRPGQCGRADGY  594
            +ACISSRPGQCGRADGY
Sbjct  181  LACISSRPGQCGRADGY  197



>ref|XP_009371092.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=220

 Score =   266 bits (679),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK+A  K+   E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+A
Sbjct  121  EIGR-KKSAVAKKDTPEEGEGTTEEAKKSNHVARKLEKRQQGRTLDPHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  180  CISSRPGQCGRCDGYIL  196



>ref|XP_006286561.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
 gb|EOA19459.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
Length=221

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 182/200 (91%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae---etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            ++GRKKK AA     E   + E  A EETKKSNHVQRK+E RQ+ R LDSH+E+QF SGR
Sbjct  121  EVGRKKKNAATSTKKEGEDKEEVAAPEETKKSNHVQRKIEGRQETRTLDSHIEDQFASGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGRADGYIL
Sbjct  181  LLACISSRPGQCGRADGYIL  200



>ref|XP_011095494.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 182/197 (92%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELV+TQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK  A K+  EETE    EE KKSNHVQRKLEKRQ++RK+D H+EEQFG GRL+A
Sbjct  121  DIGR-KKKTAAKKEGEETEAAGTEEVKKSNHVQRKLEKRQQDRKIDQHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  180  AISSRPGQCGRADGYIL  196



>ref|XP_002313320.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92635.1| unknown [Populus trichocarpa]
 gb|EEE87275.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=219

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK  A  +   E    AA E  K+SNHVQRKLEKRQ+ RKLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKTTAAAKKEGEEGEAAATEEVKQSNHVQRKLEKRQQIRKLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  181  ASISSRPGQCGRADGYIL  198



>ref|XP_010069614.1| PREDICTED: 40S ribosomal protein S8-like [Eucalyptus grandis]
 gb|KCW58022.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=222

 Score =   265 bits (678),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGR KK AAAKKE  EE E   AEE KKS HV RKLEKRQK+R+LD+H+EEQFGSGRL+
Sbjct  121  DIGRKKKAAAAKKEATEEGEAAPAEEAKKSAHVLRKLEKRQKDRQLDAHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGR+DGYIL
Sbjct  181  ACISSRPGQCGRSDGYIL  198



>ref|NP_001274851.1| uncharacterized protein LOC102577693 [Solanum tuberosum]
 gb|ABA46755.1| unknown [Solanum tuberosum]
Length=224

 Score =   265 bits (677),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG 
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  370  DIGRkkk--aaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK  A  +     E    AAEETKKSNHVQRK+E RQK+R LD HLEEQFG GRL
Sbjct  121  DIGRKKKGPAKKETTEEGEGAAAAAEETKKSNHVQRKIENRQKDRTLDPHLEEQFGGGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGR DGYIL
Sbjct  181  LACISSRPGQCGRCDGYIL  199



>ref|NP_200732.2| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
 sp|Q9FIF3.1|RS82_ARATH RecName: Full=40S ribosomal protein S8-2 [Arabidopsis thaliana]
 dbj|BAB09769.1| 40S ribosomal protein S8 [Arabidopsis thaliana]
 gb|AAO42849.1| At5g59240 [Arabidopsis thaliana]
 dbj|BAE99897.1| 40S ribosomal protein S8 - like [Arabidopsis thaliana]
 gb|AED97161.1| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
Length=210

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 174/197 (88%), Gaps = 10/197 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDV YNASNNELV+TQTLVKSAIVQVDAAPFKQ YLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR           ++ E V  EE KKSNHVQRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGR----------KKKGEAVTTEEVKKSNHVQRKLEMRQEGRALDSHLEEQFSSGRLLA  170

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGRADGYIL
Sbjct  171  CIASRPGQCGRADGYIL  187



>ref|XP_007223947.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
 gb|EMJ25146.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
Length=222

 Score =   265 bits (676),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakket-aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGRKKK AA  +    E      EE KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+
Sbjct  121  EIGRKKKTAAAAKKDTPEEGEATTEEAKKSNHVARKLEKRQQGRTLDGHIEEQFGGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|KJB81683.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=245

 Score =   265 bits (678),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR KK +A  +   E    A EE KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+A
Sbjct  121  DIGR-KKKSAAAKKEGEEGETATEEVKKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYI  597
            CISSRPGQCGRADGY+
Sbjct  180  CISSRPGQCGRADGYL  195



>ref|XP_009403610.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   265 bits (676),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPF+QWYLQHYGV
Sbjct  61   LDSGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  370  DIGRkkkaaakket-aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGRKKKA    +  A E    AAEE KKSNHV RKLEKRQ+ R LD H+E+QFG+GRL+
Sbjct  121  EIGRKKKAPTASKKDAMEEGEAAAEEEKKSNHVTRKLEKRQQGRILDPHIEDQFGAGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGR+DGYIL
Sbjct  181  ACISSRPGQCGRSDGYIL  198



>gb|ACU16800.1| unknown [Glycine max]
Length=243

 Score =   265 bits (678),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAW KKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWGKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGR KK AA K+   E    VA EE KKSNH+QRKLEKRQK+RKLD+H+EEQFG GRL+
Sbjct  121  EIGRKKKTAAKKETAEEGAAAVAVEEAKKSNHLQRKLEKRQKDRKLDAHIEEQFGGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_010905161.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=224

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeeteg--vaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            +IGRKKKAA  K+   E +    AAEE KKSNHV RKLEKRQ+ RKLD H+EEQFG GRL
Sbjct  121  EIGRKKKAAVAKKETAEGQEGDGAAEEAKKSNHVLRKLEKRQQGRKLDPHIEEQFGGGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +A ISSRPGQCGRADGYIL
Sbjct  181  LASISSRPGQCGRADGYIL  199



>gb|EYU33688.1| hypothetical protein MIMGU_mgv1a013525mg [Erythranthe guttata]
Length=218

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 184/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELV+T+TLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DI R KK AA K+  EE E  A EE KKSNHVQRK+EKRQ+ERK+D+H+EEQFGSGRL+A
Sbjct  121  DISR-KKKAAVKKEGEEAEAAATEEAKKSNHVQRKIEKRQEERKIDTHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  180  AISSRPGQCGRADGYIL  196



>sp|O81361.1|RS8_PRUAR RecName: Full=40S ribosomal protein S8 [Prunus armeniaca]
 gb|AAC24583.1| 40S ribosomal protein S8 [Prunus armeniaca]
Length=221

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGRKKK AA K+   E      EE KKSNHV  KLEKRQ+ R LD+H+EEQFG G+L+A
Sbjct  121  EIGRKKKTAAAKKDTPEEGEATTEEAKKSNHVAIKLEKRQQGRTLDAHIEEQFGGGKLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCG+ADG IL
Sbjct  181  CISSRPGQCGKADGDIL  197



>ref|XP_008809644.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=223

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+Q+DAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQIDAAPFKQWYLQHYGV  120

Query  370  DIGR-kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            +IGR KK  AA K+ A E    A EE KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+
Sbjct  121  EIGRKKKAPAATKKEATEEGEGATEEAKKSSHVLRKLEKRQQGRTLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGR+DGYIL
Sbjct  181  ACISSRPGQCGRSDGYIL  198



>ref|XP_004247043.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=222

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG 
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK AAKK+T EE E  A EETKKSNHVQRK+E RQK+R LD HLEEQFG GRL+A
Sbjct  121  DIGRKKKGAAKKDTTEEGEAAAPEETKKSNHVQRKIENRQKDRTLDPHLEEQFGGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  181  CISSRPGQCGRCDGYIL  197



>ref|XP_008366424.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_009364625.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009364657.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009335423.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 178/200 (89%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR---kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            +IGR      AA K+    E    AAEE KKSNHV RKLEKRQ+ R LD H+EEQFG GR
Sbjct  121  EIGRKKKTAAAAKKEAEDGEAPAAAAEEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGR DGYIL
Sbjct  181  LLACISSRPGQCGRCDGYIL  200



>ref|XP_007149668.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
 gb|ESW21662.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
Length=217

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQSANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK AA K+ + E    AAEETKKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+A
Sbjct  121  EIGR-KKKAASKKDSTEEADAAAEETKKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_009596732.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=223

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaee-tegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK AAKKET EE      AEE KKSNHV RKLEKRQK+RKLD HLEEQFG+GRL 
Sbjct  121  DIGRKKKGAAKKETTEEGEAATPAEEAKKSNHVARKLEKRQKDRKLDPHLEEQFGAGRLY  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_010243157.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Nelumbo 
nucifera]
Length=217

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSE VTRKTRILDVVYNASNNELV+TQTLV+SAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DI  +KK  A K+   E      EETKKSNHV RKLEKR +  KLD H+EEQFGSGRL+A
Sbjct  121  DI-GRKKKGAAKKDTAEEGDGTTEETKKSNHVLRKLEKRLQSHKLDPHIEEQFGSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  180  CISSRPGQCGRADGYIL  196



>ref|XP_004160707.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
Length=221

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELV+TQTLVKSA+VQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeet-kkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK AA  +  EE +  AA E  KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRLM
Sbjct  121  DIGRKKKTAASAKKDEEGDAAAAAEEVKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRLM  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>gb|ACU16398.1| unknown [Glycine max]
Length=256

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            ++GRKKK+AA     E E    A EE KKSNHV RKLEKR++ R LD H+EEQFG GRL+
Sbjct  121  EVGRKKKSAAASAKKEGEDGEAATEEVKKSNHVLRKLEKRKQNRVLDPHIEEQFGGGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_010270147.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=221

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVK AIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK+++  +   E      EE KKSNHV RKLEKRQ+  KLD H+EEQF SGRL+A
Sbjct  121  DIGRKKKSSSAAKKEGEEGEATTEEAKKSNHVLRKLEKRQQGHKLDPHIEEQFSSGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
             I+SRPGQCGRADGYIL
Sbjct  181  AIASRPGQCGRADGYIL  197



>ref|XP_009361080.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009348460.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 179/200 (90%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae---etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            +IGRKKK AA  +      E    A EE KKSNHV RKLEKRQ+ R LD H+EEQFG GR
Sbjct  121  EIGRKKKTAAAAKKEAEDGEAPAAAPEEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGR DGYIL
Sbjct  181  LLACISSRPGQCGRCDGYIL  200



>ref|XP_004149800.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN47709.1| hypothetical protein Csa_6G382970 [Cucumis sativus]
Length=222

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELV+TQTLVKSA+VQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeet--kkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DIGRKKK AA  +  EE +  AA     KKSNHVQRKLEKRQ+ RKLD H+EEQF SGRL
Sbjct  121  DIGRKKKTAASAKKDEEGDAAAAAAEEVKKSNHVQRKLEKRQEGRKLDPHIEEQFSSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            MACISSRPGQCGRADGYIL
Sbjct  181  MACISSRPGQCGRADGYIL  199



>ref|XP_009405538.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=224

 Score =   263 bits (672),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 179/200 (90%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDA PFK WYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDATPFKHWYLQHYGV  120

Query  370  DIGRkkkaaakketaeet---egvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            +IGRKKKA A  +           AAEE KKSNHV RKLEKRQ+ R LD H+EEQFG+GR
Sbjct  121  EIGRKKKAPAAAKKEATEVPEGEAAAEEAKKSNHVTRKLEKRQQGRTLDPHIEEQFGAGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGRADGYIL
Sbjct  181  LLACISSRPGQCGRADGYIL  200



>ref|XP_009771719.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DI--GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DI   +K  A  +     E    AAEETKKSNHV RKLEKRQK+R+LD+HLEEQFG+GRL
Sbjct  121  DIGRKKKGAAKKETAEEGEGAAAAAEETKKSNHVARKLEKRQKDRQLDAHLEEQFGAGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>gb|AGV54796.1| 40S ribosomal protein S8 [Phaseolus vulgaris]
Length=218

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELG  PANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGPPPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQ YG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQPYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGRKKK AAKK++AEE +  AAEE KKSNHVQRKLEKRQK+RKLD+H+EEQF  GRL+A
Sbjct  121  DIGRKKKTAAKKDSAEEGDAAAAEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFAGGRLLA  180

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  181  CISSRPGQCGRCDGYIL  197



>ref|XP_010243156.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Nelumbo 
nucifera]
Length=219

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSE VTRKTRILDVVYNASNNELV+TQTLV+SAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKK AAKK+TAE +      EETKKSNHV RKLEKR +  KLD H+EEQFGSGRL+
Sbjct  121  DIGRKKKGAAKKDTAEGQEGDGTTEETKKSNHVLRKLEKRLQSHKLDPHIEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_006344091.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=223

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 176/199 (88%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQSANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DI--GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DI   +K  A  +  T E      AEE KKSNHV RK+EKRQK+R LDSHLEEQF SGRL
Sbjct  121  DIGRKKKGAAKKETTTEEGEAAAPAEEAKKSNHVVRKIEKRQKDRTLDSHLEEQFSSGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
             ACISSRPGQCGRADGYIL
Sbjct  181  YACISSRPGQCGRADGYIL  199



>emb|CDY60374.1| BnaCnng36150D, partial [Brassica napus]
Length=228

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 179/205 (87%), Gaps = 8/205 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  3    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  62

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  63   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  122

Query  370  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  525
            ++GRKKK A+     +             A EETKKSNHV RK+E RQ+ R LDSH+E+Q
Sbjct  123  EVGRKKKNASAAAVKKDGEEGGEAAPAAAAPEETKKSNHVLRKIESRQEGRSLDSHIEDQ  182

Query  526  FGSGRLMACISSRPGQCGRADGYIL  600
            F SGRL+ACISSRPGQCGRADGYIL
Sbjct  183  FASGRLLACISSRPGQCGRADGYIL  207



>ref|XP_006409551.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
 gb|ESQ51004.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
Length=225

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 180/204 (88%), Gaps = 7/204 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae-------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQF  528
            ++GRKKK A+     E            A EETKKSNHV RK+E+RQ+ R LDSH+E+QF
Sbjct  121  EVGRKKKNASSATKKEGEDGEDASAPAAAPEETKKSNHVLRKIEQRQEGRSLDSHIEDQF  180

Query  529  GSGRLMACISSRPGQCGRADGYIL  600
             SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  ASGRLLACISSRPGQCGRADGYIL  204



>ref|XP_008227073.1| PREDICTED: 40S ribosomal protein S8-like [Prunus mume]
Length=225

 Score =   262 bits (670),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 179/203 (88%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeet------egvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  531
            +IGRKKK AA  +   E           AEE KKSNHV RKLEKRQ+ R LD H+EEQFG
Sbjct  121  EIGRKKKTAAAAKKEGEEGDAAAAPAAVAEEVKKSNHVVRKLEKRQQSRTLDQHIEEQFG  180

Query  532  SGRLMACISSRPGQCGRADGYIL  600
             GRL+ACISSRPGQCGRADGYIL
Sbjct  181  GGRLLACISSRPGQCGRADGYIL  203



>ref|XP_009131790.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=226

 Score =   262 bits (670),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 179/205 (87%), Gaps = 8/205 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  525
            ++GRKKK A+     +             A EETKKSNHV RK+E RQ+ R LDSH+E+Q
Sbjct  121  EVGRKKKNASAVAAKKDGEEGEEVAPAAAAPEETKKSNHVLRKIESRQEGRSLDSHIEDQ  180

Query  526  FGSGRLMACISSRPGQCGRADGYIL  600
            F SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  FASGRLLACISSRPGQCGRADGYIL  205



>gb|KFK31870.1| hypothetical protein AALP_AA6G169300 [Arabis alpina]
Length=219

 Score =   262 bits (669),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  370  DIGRkkkaaakketae-etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            ++GRKKK A      E E    AAEETKKSNHV RK+++RQ++R LDSH+E+QF SGRL+
Sbjct  121  EVGRKKKPAPSATKKEGEDVEEAAEETKKSNHVLRKIKERQEDRNLDSHIEDQFSSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  181  ACISSRPGQCGRADGYIL  198



>ref|XP_009126438.1| PREDICTED: 40S ribosomal protein S8-1-like [Brassica rapa]
Length=226

 Score =   262 bits (669),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 177/205 (86%), Gaps = 8/205 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  525
            ++GRKKK        E             A EE KKSNHVQRK+E RQ+ R LDSH+E+Q
Sbjct  121  EVGRKKKTVPSAAKKEGEDGEEAAPAAAAAPEEVKKSNHVQRKIESRQEGRSLDSHIEDQ  180

Query  526  FGSGRLMACISSRPGQCGRADGYIL  600
            F SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  FASGRLLACISSRPGQCGRADGYIL  205



>gb|ACJ83894.1| unknown [Medicago truncatula]
Length=216

 Score =   261 bits (668),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 180/197 (91%), Gaps = 2/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKK   +K++ YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKSWRKKRK-YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L TGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  60   LGTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++GR KK  A K+ + E   V AEE KKS+HVQRKLE+RQK+R+LDSH+EEQFG GRL+A
Sbjct  120  EVGR-KKKTAAKKDSAEEAEVVAEEVKKSSHVQRKLEQRQKDRQLDSHIEEQFGGGRLLA  178

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  179  CISSRPGQCGRADGYIL  195



>ref|XP_002873989.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50248.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  370  DIGRkkkaaakket--aeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            ++GRKKK AA  +    E  E  A EETKKSNH+ RK+E RQ+ R LDSH+E+QF SGRL
Sbjct  121  EVGRKKKNAASTKKDAEEGEEVAAVEETKKSNHLSRKIESRQEGRSLDSHIEDQFASGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_010420870.1| PREDICTED: 40S ribosomal protein S8-1-like [Camelina sativa]
Length=223

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 182/202 (90%), Gaps = 5/202 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakk-----etaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  534
            ++GRKKK AA       E A+E      EETKKSNHV+RK+E RQ+ R LDSH+E+QF S
Sbjct  121  EVGRKKKTAATTTKKDGEDADEAAPAIPEETKKSNHVKRKIETRQESRTLDSHIEDQFAS  180

Query  535  GRLMACISSRPGQCGRADGYIL  600
            GRL+ACISSRPGQCGRADGYIL
Sbjct  181  GRLLACISSRPGQCGRADGYIL  202



>ref|XP_008364326.1| PREDICTED: 40S ribosomal protein S8-like [Malus domestica]
 ref|XP_008345024.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_008355313.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=222

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 178/200 (89%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae---etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            +IGRKKK AA  +      E    A EE KKSNHV RKLEKRQ+ R LD H+EEQFG GR
Sbjct  121  EIGRKKKTAAAAKKEAEDGEAPAAAPEEAKKSNHVARKLEKRQQTRTLDQHIEEQFGGGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGR DGYIL
Sbjct  181  LLACISSRPGQCGRCDGYIL  200



>ref|XP_006400597.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
 gb|ESQ42050.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
Length=226

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 178/205 (87%), Gaps = 8/205 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  525
            ++GRKKK A      E               EETKKSNHV RK+E+RQ+ R LDSH+E+Q
Sbjct  121  EVGRKKKNAGASTKKEGEDTEDAPAAAAATPEETKKSNHVLRKIEQRQEGRSLDSHIEDQ  180

Query  526  FGSGRLMACISSRPGQCGRADGYIL  600
            F SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  FASGRLLACISSRPGQCGRADGYIL  205



>ref|XP_010493138.1| PREDICTED: 40S ribosomal protein S8-1 [Camelina sativa]
Length=223

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 180/202 (89%), Gaps = 5/202 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketa-----eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  534
            ++GRKKK A           +E     AEETKKSNHVQRK+E RQ+ R LDSH+E+QF S
Sbjct  121  EVGRKKKTAVTTTKKDGEDGDEAAPAVAEETKKSNHVQRKIESRQETRTLDSHIEDQFAS  180

Query  535  GRLMACISSRPGQCGRADGYIL  600
            GRL+ACISSRPGQCGRADGYIL
Sbjct  181  GRLLACISSRPGQCGRADGYIL  202



>emb|CDY45095.1| BnaA02g04810D [Brassica napus]
Length=244

 Score =   262 bits (669),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 178/205 (87%), Gaps = 8/205 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  19   MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  78

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  79   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  138

Query  370  DIGRkkkaaakketae--------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  525
            ++GRKKK A      E             A EE KKSNHVQRK+E RQ+ R LDSH+E+Q
Sbjct  139  EVGRKKKTAPSAAKKEGEDGEEAAPAAAAAPEEVKKSNHVQRKIESRQEGRSLDSHIEDQ  198

Query  526  FGSGRLMACISSRPGQCGRADGYIL  600
            F SGRL+ACISSRPGQCGRADGYIL
Sbjct  199  FASGRLLACISSRPGQCGRADGYIL  223



>ref|XP_009619873.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=220

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 175/198 (88%), Gaps = 3/198 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            VDIGR  K        E  E  A  E KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+
Sbjct  121  VDIGR--KKKTAASKKEGEEAEAVPEEKKSNHVQRKLQKRQQDRKIDPHIEEQFASGRLL  178

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  179  AAISSRPGQCGRADGYIL  196



>gb|ACN31997.1| unknown [Zea mays]
 gb|AFW66127.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66131.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66132.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
 gb|AFW66139.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66140.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
Length=214

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakke--taeetegvaae  441
            SNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK  A K+     +    AAE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAAKKDNAEGQEVEAAAE  139

Query  442  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            ETKKSNHV RKLEKR++ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYIL
Sbjct  140  ETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYIL  192



>gb|KJB62960.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=211

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAA  +   E    A EE 
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAAAGAKKEGEEGETATEEV  139

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKS+HV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYIL
Sbjct  140  KKSSHVLRKLEKRQQSRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYIL  190



>ref|XP_007211997.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 ref|XP_007211998.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13196.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13197.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
Length=225

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 179/203 (88%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeet------egvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  531
            +IGRKKK AA  +   E           AEE KKSNHV RKLEKRQ+ R LD H+EEQFG
Sbjct  121  EIGRKKKTAAAAKKEGEEGDAAAAPAAVAEEVKKSNHVVRKLEKRQQSRTLDQHIEEQFG  180

Query  532  SGRLMACISSRPGQCGRADGYIL  600
             GRL+ACISSRPGQCGR+DGYIL
Sbjct  181  GGRLLACISSRPGQCGRSDGYIL  203



>ref|XP_009602561.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=224

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DI--GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            DI   +K  A  +     E    AAEETKKSNHV RKLEKRQK+RKLD+HLEEQFG+GRL
Sbjct  121  DIGRKKKGAAKKETAEEGEGAAAAAEETKKSNHVARKLEKRQKDRKLDAHLEEQFGAGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>ref|XP_010541736.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=222

 Score =   260 bits (664),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 178/201 (89%), Gaps = 4/201 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeete----gvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  537
            +IGRKKK  A     E  E      A EETKKSNHV RKLEKRQK R LDSH+E+QF SG
Sbjct  121  EIGRKKKTPATSGKKEGEEGEDGAAAPEETKKSNHVLRKLEKRQKNRALDSHIEDQFASG  180

Query  538  RLMACISSRPGQCGRADGYIL  600
            RL+ACISSRPGQCGRADGYIL
Sbjct  181  RLLACISSRPGQCGRADGYIL  201



>gb|EYU27406.1| hypothetical protein MIMGU_mgv1a013520mg [Erythranthe guttata]
Length=218

 Score =   259 bits (662),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 181/197 (92%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKMKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELV+TQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR KK AA K+  EETE  AAEE KKS HV RKLEKRQ+ER +D H+EEQFG GRL+A
Sbjct  121  EIGR-KKKAAAKKEGEETEAAAAEEVKKSKHVLRKLEKRQEERTIDQHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  180  AISSRPGQCGRADGYIL  196



>ref|XP_006856815.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
 gb|ERN18282.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
Length=218

 Score =   259 bits (662),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN SWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNCSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            D+G KKK A+  +   E    A EE KKS+HV+RKLEKR +  KLD H+EEQFG GRL+A
Sbjct  121  DLG-KKKKASATKKEGEEAEGATEEVKKSDHVKRKLEKRLEGHKLDPHIEEQFGGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGY+L
Sbjct  180  CISSRPGQCGRADGYVL  196



>ref|XP_009770276.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=220

 Score =   259 bits (662),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 174/198 (88%), Gaps = 3/198 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            VDIGR  K        E  E  A  E KKSNHVQRKL+KRQ++RK+D H+EEQF  GRL+
Sbjct  121  VDIGR--KKKTAASKKEGEEAEAVPEEKKSNHVQRKLQKRQQDRKIDPHIEEQFAGGRLL  178

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  179  AAISSRPGQCGRADGYIL  196



>gb|KFK26269.1| hypothetical protein AALP_AA8G225000 [Arabis alpina]
Length=223

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 181/202 (90%), Gaps = 5/202 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  370  DIGRkkkaaakketae-----etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  534
            ++GRKKKAA      E     E    AAEETKKSNHV RK+++RQ++R LDSH+E+QF S
Sbjct  121  EVGRKKKAAVSATKKEGEDVEEAPPAAAEETKKSNHVLRKIKERQEDRNLDSHIEDQFSS  180

Query  535  GRLMACISSRPGQCGRADGYIL  600
            GRL+ACISSRPGQCGRADGYIL
Sbjct  181  GRLLACISSRPGQCGRADGYIL  202



>emb|CDP03936.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV+YNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVMYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR KK    K+ A E     AEET
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR-KKKGPAKKDATEDGEATAEET  138

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSNHV RKLEKRQ+ R LD H+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  139  KKSNHVVRKLEKRQQGRTLDPHIEEQFGGGRLLACISSRPGQCGRADGYIL  189



>ref|XP_009120819.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=227

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 180/206 (87%), Gaps = 9/206 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaee---------tegvaaeetkkSNHVqrklekrqkerklDSHLEE  522
            ++GRKKK AA     +E             A EE KKSNHVQRK+E RQ+ R LDSH+E+
Sbjct  121  EVGRKKKNAAASAAKKEGEDGEDAAPAAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIED  180

Query  523  QFGSGRLMACISSRPGQCGRADGYIL  600
            QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  QFASGRLLACISSRPGQCGRADGYIL  206



>emb|CDY35814.1| BnaC09g37460D [Brassica napus]
Length=258

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 180/205 (88%), Gaps = 8/205 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  33   MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  92

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  93   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  152

Query  370  DIGRkkkaaakketaee--------tegvaaeetkkSNHVqrklekrqkerklDSHLEEQ  525
            ++GRKKK AA     +E            A EE KKSNHVQRK+E RQ+ R LDSH+E+Q
Sbjct  153  EVGRKKKNAAASAAKKEGEDGEDAAPAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIEDQ  212

Query  526  FGSGRLMACISSRPGQCGRADGYIL  600
            F SGRL+ACISSRPGQCGRADGYIL
Sbjct  213  FASGRLLACISSRPGQCGRADGYIL  237



>gb|ABL85034.1| ribosomal subunit 8E protein [Brachypodium sylvaticum]
Length=223

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 176/201 (88%), Gaps = 4/201 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLAHYGV  120

Query  370  DIGR----kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  537
            DIGR                +    AAEETKKSN+VQRKLEKRQ+ R LD H+EEQF SG
Sbjct  121  DIGRKKKTPAATKKDATEDGDAAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIEEQFSSG  180

Query  538  RLMACISSRPGQCGRADGYIL  600
            RL+ACISSRPGQCGRADGYIL
Sbjct  181  RLLACISSRPGQCGRADGYIL  201



>ref|XP_009765854.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=221

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 182/198 (92%), Gaps = 2/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            VDIGR KK +A K+  EE E   A E KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+
Sbjct  121  VDIGR-KKKSAAKKEGEEAETAPAAEEKKSNHVQRKLQKRQQDRKIDPHVEEQFASGRLL  179

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  180  AAISSRPGQCGRADGYIL  197



>ref|XP_010235437.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Brachypodium 
distachyon]
Length=226

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 180/204 (88%), Gaps = 7/204 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketaeet-------egvaaeetkkSNHVqrklekrqkerklDSHLEEQF  528
            DIGRKKK  A  +               AAEETKKSN+VQRKLEKRQ+ R LD H+EEQF
Sbjct  121  DIGRKKKTPAATKKDATEDGDAAAPAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIEEQF  180

Query  529  GSGRLMACISSRPGQCGRADGYIL  600
             SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  SSGRLLACISSRPGQCGRADGYIL  204



>ref|XP_010535902.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=220

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+T+TLVKSAIVQVD APFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDVAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketa--eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            ++GRKKK AA       EE E  A EETKKSNHV RKLEKRQ+ R LDSH+E+QF SGRL
Sbjct  121  EVGRKKKTAATSGKKEGEEGEDAAPEETKKSNHVLRKLEKRQQNRSLDSHIEDQFASGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  181  LACISSRPGQCGRADGYIL  199



>gb|KJB13806.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=212

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketae-etegvaaee  444
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGVD+GRKKK  A     + E     AEE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLGRKKKTLAAATKKDGEEGETVAEE  139

Query  445  tkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
             KKSNHV RKLEKRQ+ RKLD H+E+QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  140  AKKSNHVLRKLEKRQQNRKLDPHIEDQFSSGRLLACISSRPGQCGRADGYIL  191



>gb|KJB81682.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=196

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  6    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  65

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR KK +A  +   E    A EE 
Sbjct  66   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEEV  124

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSNH+ RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYIL
Sbjct  125  KKSNHILRKLEKRQQNRALDPHIEEQFGSGRLLACISSRPGQCGRADGYIL  175



>ref|XP_004290159.1| PREDICTED: 40S ribosomal protein S8-like [Fragaria vesca subsp. 
vesca]
Length=224

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 181/200 (91%), Gaps = 3/200 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPF+QWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYNV  120

Query  370  DIGRkkkaaakketaeetegv---aaeetkkSNHVqrklekrqkerklDSHLEEQFGSGR  540
            DIGRKKK AAKK+  +          EETKKS ++ RKLEKRQK+R LDSH+EEQF  GR
Sbjct  121  DIGRKKKTAAKKDAKDVAAEEADGTTEETKKSGNLLRKLEKRQKDRTLDSHIEEQFSGGR  180

Query  541  LMACISSRPGQCGRADGYIL  600
            L+ACISSRPGQCGRADGYIL
Sbjct  181  LLACISSRPGQCGRADGYIL  200



>ref|XP_003557224.1| PREDICTED: 40S ribosomal protein S8 [Brachypodium distachyon]
Length=226

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 179/204 (88%), Gaps = 7/204 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketaeet-------egvaaeetkkSNHVqrklekrqkerklDSHLEEQF  528
            DIGRKKK  A  +               AAEE KKSN+VQRKLEKRQ+ R LD H+EEQF
Sbjct  121  DIGRKKKTPAATKKDATEDGDAAAPAAAAAEEAKKSNNVQRKLEKRQQGRTLDPHIEEQF  180

Query  529  GSGRLMACISSRPGQCGRADGYIL  600
             SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  SSGRLLACISSRPGQCGRADGYIL  204



>emb|CBI39377.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  AKKET EE EG A EET
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTTAKKETTEEGEGGATEET  139

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSNHV RKLEKRQ++ +LD H+EEQFGSGRL+A ISSRPGQCGRADGYIL
Sbjct  140  KKSNHVLRKLEKRQQDHRLDPHIEEQFGSGRLLASISSRPGQCGRADGYIL  190



>ref|XP_003574981.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 180/207 (87%), Gaps = 10/207 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGRkkkaaakketaeetegv----------aaeetkkSNHVqrklekrqkerklDSHLE  519
            DIGRKKK  A  +                  AAEETKKSN+VQRKLEKRQ+ R LD H+E
Sbjct  121  DIGRKKKTPAATKKDATETLQDGDAAAPAAAAAEETKKSNNVQRKLEKRQQGRTLDPHIE  180

Query  520  EQFGSGRLMACISSRPGQCGRADGYIL  600
            EQF SGRL+ACISSRPGQCGRADGYIL
Sbjct  181  EQFSSGRLLACISSRPGQCGRADGYIL  207



>emb|CDX92472.1| BnaA10g15110D [Brassica napus]
Length=246

 Score =   258 bits (659),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 180/206 (87%), Gaps = 9/206 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  20   MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  79

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  80   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  139

Query  370  DIGRkkkaaakketaee---------tegvaaeetkkSNHVqrklekrqkerklDSHLEE  522
            ++GRKKK AA     +E             A EE KKSNHVQRK+E RQ+ R LDSH+E+
Sbjct  140  EVGRKKKNAAASAAKKEGEDGEDAAPAAAAAPEEVKKSNHVQRKIESRQEGRTLDSHIED  199

Query  523  QFGSGRLMACISSRPGQCGRADGYIL  600
            QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  200  QFASGRLLACISSRPGQCGRADGYIL  225



>ref|XP_006652189.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=214

 Score =   257 bits (656),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakket--aeetegvaae  441
            SNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKKA A K+     +    AAE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAVEGQEGEAAAE  139

Query  442  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            ETKKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYIL
Sbjct  140  ETKKSNHVVRKLEKRQQGRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYIL  192



>ref|XP_002864608.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40867.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   257 bits (656),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 172/197 (87%), Gaps = 10/197 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDV YNASNNELV+TQTLVKSAIV VDAAPFKQ YLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVLVDAAPFKQGYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIGR           ++ + V  EE KKSNH+QRKLE RQ+ R LDSHLEEQF SGRL+A
Sbjct  121  DIGR----------KKKGDAVTTEEVKKSNHIQRKLEMRQEGRALDSHLEEQFSSGRLLA  170

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQ GRADGYIL
Sbjct  171  CIASRPGQSGRADGYIL  187



>gb|KHG14255.1| 40S ribosomal S8 [Gossypium arboreum]
Length=210

 Score =   256 bits (655),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR KK +A  +   E    A EE 
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKSAAAKKEGEEGETATEEV  138

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSNHV RKLEKRQ+ R LD H+EEQFGSGRL+ACISSRPGQCGRADGYIL
Sbjct  139  KKSNHVLRKLEKRQQNRTLDPHIEEQFGSGRLLACISSRPGQCGRADGYIL  189



>ref|XP_009594581.1| PREDICTED: 40S ribosomal protein S8-2-like [Nicotiana tomentosiformis]
Length=221

 Score =   257 bits (656),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 182/198 (92%), Gaps = 2/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            VDIGR KK +A K+  EE E   A E KKSNHVQRKL+KRQ++RK+D H+EEQF SGRL+
Sbjct  121  VDIGR-KKKSATKKEGEEAEAAPAAEEKKSNHVQRKLQKRQQDRKIDPHVEEQFASGRLL  179

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  180  AAISSRPGQCGRADGYIL  197



>ref|XP_010097296.1| 40S ribosomal protein S8 [Morus notabilis]
 gb|EXB67448.1| 40S ribosomal protein S8 [Morus notabilis]
Length=215

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQ ANTKLSS+KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQSANTKLSSDKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaee----tegva  435
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK +A    A          A
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTSAAAAAAAAQEGDAAAAA  139

Query  436  aeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
             EE KKS+HV RKLEKRQ+ R LD+H+EEQF SGRL+ACISSRPGQCGRADGYIL
Sbjct  140  TEEAKKSSHVLRKLEKRQQNRVLDAHIEEQFSSGRLLACISSRPGQCGRADGYIL  194



>emb|CBI26725.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPASTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG+DIGRKKKA+A  +   E     AEET
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGLDIGRKKKASATAKKEGEEGDGPAEET  139

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSNHV RKLEKRQ+E KLD H+EEQFGSGRL+A ISSRPGQCGRADGYIL
Sbjct  140  KKSNHVVRKLEKRQQEHKLDPHIEEQFGSGRLLAAISSRPGQCGRADGYIL  190



>ref|XP_011461093.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
 ref|XP_011461096.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
Length=225

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 176/203 (87%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWY  HYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYSTHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeet------kkSNHVqrklekrqkerklDSHLEEQFG  531
            +IGRKKK AA  +   E    A          KKS HV+RKLEKRQ+ R LD H+EEQFG
Sbjct  121  EIGRKKKTAAAIKKEAEDGEAATAAAAAAEEVKKSKHVERKLEKRQQTRVLDHHIEEQFG  180

Query  532  SGRLMACISSRPGQCGRADGYIL  600
             GRL+ACISSRPGQCGRADGYIL
Sbjct  181  GGRLLACISSRPGQCGRADGYIL  203



>gb|EMT18438.1| 40S ribosomal protein S8 [Aegilops tauschii]
Length=225

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 177/203 (87%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGR------kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  531
            +IGR        K  A +    E    A EE KKSN+VQRKLEKRQ+ R LDSH+EEQF 
Sbjct  121  EIGRKKKAAAAAKKEAAEGQEAEVAAAATEEAKKSNNVQRKLEKRQQGRTLDSHIEEQFS  180

Query  532  SGRLMACISSRPGQCGRADGYIL  600
             GRL+ACISSRPGQCGRADGYIL
Sbjct  181  GGRLLACISSRPGQCGRADGYIL  203



>gb|EYU39184.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=218

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 178/198 (90%), Gaps = 2/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELV+T+TLVKSAI+QVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            VDIGR KK     +  E  EG AA+E KKS+HV RK+EKRQ ERKLD H+EEQF SGRL+
Sbjct  121  VDIGR-KKKGGADKKEETEEGEAAQEAKKSSHVLRKIEKRQAERKLDPHVEEQFSSGRLL  179

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  180  ACISSRPGQCGRADGYIL  197



>emb|CDX88842.1| BnaA03g08070D [Brassica napus]
Length=239

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 179/206 (87%), Gaps = 9/206 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            +GISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  13   LGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  72

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  73   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  132

Query  370  DIGRkkkaa---------akketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEE  522
            ++GRKKK A          ++         A EETKKSNHV RK+E RQ+ R LDSH+E+
Sbjct  133  EVGRKKKNASAAAAAKKDGEEGEEAAPAAAAPEETKKSNHVLRKIESRQEGRSLDSHIED  192

Query  523  QFGSGRLMACISSRPGQCGRADGYIL  600
            QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  193  QFASGRLLACISSRPGQCGRADGYIL  218



>gb|KJB22660.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=212

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKTRILDVVYNA
Sbjct  20   YELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG+DIGR KK  A K+ A E    AAEET
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGR-KKKMASKKEATEEPEGAAEET  138

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            K+S HV RKLEKRQK+RKLD H+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  139  KRSKHVARKLEKRQKDRKLDPHVEEQFGGGRLLACISSRPGQCGRADGYIL  189



>ref|XP_006648644.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=213

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketae-etegvaaee  444
            SNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKKA A K+ AE +      EE
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKKDAEGQDAEATTEE  139

Query  445  tkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
             KKSNHV RK+EKRQ+ R LD H+EEQF SGRL+ACISSRPGQCGRADGYIL
Sbjct  140  AKKSNHVIRKIEKRQEGRTLDPHIEEQFSSGRLLACISSRPGQCGRADGYIL  191



>ref|XP_003626942.1| Ribosomal protein S8 [Medicago truncatula]
Length=605

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 177/199 (89%), Gaps = 3/199 (2%)
 Frame = +1

Query  4    LAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRA  183
              MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRA
Sbjct  389  FKMGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRA  448

Query  184  LRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHY  363
            LRLDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHY
Sbjct  449  LRLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY  508

Query  364  GVDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRL  543
            GVDIGR           EE    A EE KKS HVQRKLE+RQKER+LD+H+EEQFG GRL
Sbjct  509  GVDIGR---KKKNVSKKEEEAEAATEEVKKSAHVQRKLEQRQKERQLDAHIEEQFGGGRL  565

Query  544  MACISSRPGQCGRADGYIL  600
            +ACISSRPGQCGRADGYIL
Sbjct  566  LACISSRPGQCGRADGYIL  584


 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVR IRVRGGN+K RALRLDTGN SWGSEAVTRK+R+L+VVYNA
Sbjct  128  YELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLDTGNISWGSEAVTRKSRLLNVVYNA  187

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV+IG  KK  A K+ + +    A EET
Sbjct  188  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-NKKKTAAKQDSAKEAEAATEET  246

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSNHV RKLE R+K+R+LD+H+EEQFG GRL+ACISSRPGQCGRADGYIL
Sbjct  247  KKSNHVLRKLENREKDRQLDAHIEEQFGGGRLLACISSRPGQCGRADGYIL  297



>ref|NP_197529.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
 sp|Q93VG5.1|RS81_ARATH RecName: Full=40S ribosomal protein S8-1 [Arabidopsis thaliana]
 gb|AAK93614.1| unknown protein [Arabidopsis thaliana]
 gb|AAK96530.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAL31236.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAM14111.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64526.1| 40S ribosomal protein S8-like [Arabidopsis thaliana]
 dbj|BAE98439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92825.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
Length=222

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 178/201 (89%), Gaps = 4/201 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEA TRKTR+LDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEATTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  370  DIGRkkkaaak----ketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  537
            ++GRKKK+A+      E  EE    A EE KKSNH+ RK+  RQ+ R LDSH+E+QF SG
Sbjct  121  ELGRKKKSASSTKKDGEEGEEAAVAAPEEVKKSNHLLRKIASRQEGRSLDSHIEDQFASG  180

Query  538  RLMACISSRPGQCGRADGYIL  600
            RL+ACISSRPGQCGRADGYIL
Sbjct  181  RLLACISSRPGQCGRADGYIL  201



>dbj|BAJ89904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 175/203 (86%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGR------kkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  531
            +IGR        K  A +    E    A EE KKSN VQRKLEKRQ+ R LDSH+EEQF 
Sbjct  121  EIGRKKKAAAAAKKDAAEGQEAEVAAAATEEAKKSNKVQRKLEKRQQGRTLDSHIEEQFS  180

Query  532  SGRLMACISSRPGQCGRADGYIL  600
             GRL+ACISSRPGQCGRADGYIL
Sbjct  181  GGRLLACISSRPGQCGRADGYIL  203



>ref|XP_010519957.1| PREDICTED: 40S ribosomal protein S8-1 [Tarenaya hassleriana]
Length=222

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 176/201 (88%), Gaps = 4/201 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYE+GR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+T+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  370  DIGRkkkaaakketae----etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSG  537
            ++GRKKK +A     E    E    A EETKKSNHV RKLEKRQ  R LD H+E+QF SG
Sbjct  121  EVGRKKKTSATSGKKEGDEGEDAAAAPEETKKSNHVLRKLEKRQSNRSLDPHIEDQFTSG  180

Query  538  RLMACISSRPGQCGRADGYIL  600
            RL+ACISSRPGQCGRADGYIL
Sbjct  181  RLLACISSRPGQCGRADGYIL  201



>ref|XP_006369983.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
 gb|ERP66552.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
Length=199

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  8    YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  67

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR KK     +   E      EE 
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR-KKKTTAAKKEGEEGEAVTEEV  126

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSNHV RKLEKRQ+ RKLD H+EEQFGSGRL+A ISSRPGQCGRADGYIL
Sbjct  127  KKSNHVLRKLEKRQQIRKLDPHIEEQFGSGRLLASISSRPGQCGRADGYIL  177



>ref|XP_006346168.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=220

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 175/198 (88%), Gaps = 3/198 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            V+IGR  K        E  E  A  E KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+
Sbjct  121  VEIGR--KKKTAASKKEGEEAEAVAEEKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLL  178

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  179  AAISSRPGQCGRADGYIL  196



>ref|XP_010926672.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Elaeis guineensis]
Length=207

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  10   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  69

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeeteg--vaae  441
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV+IGRKKK  A K+ A E +    AAE
Sbjct  70   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATEGQEGDGAAE  129

Query  442  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            E KKSNHV RKLEKRQ+ R+LD H+EEQFGSGRL+ACISSRPGQCGRADG IL
Sbjct  130  EVKKSNHVLRKLEKRQQGRQLDPHIEEQFGSGRLLACISSRPGQCGRADGCIL  182



>ref|XP_010926670.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
 ref|XP_010926671.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
Length=212

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  15   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  74

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeeteg--vaae  441
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV+IGRKKK  A K+ A E +    AAE
Sbjct  75   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATEGQEGDGAAE  134

Query  442  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            E KKSNHV RKLEKRQ+ R+LD H+EEQFGSGRL+ACISSRPGQCGRADG IL
Sbjct  135  EVKKSNHVLRKLEKRQQGRQLDPHIEEQFGSGRLLACISSRPGQCGRADGCIL  187



>ref|XP_010327196.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=221

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 177/198 (89%), Gaps = 3/198 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            V+IGR  K  +  +   E    AA E KKSNHVQRKLEKRQ++RK+D+H+EEQF SGRL+
Sbjct  121  VEIGR--KKKSAAKKEGEEVAEAAAEEKKSNHVQRKLEKRQQDRKIDAHIEEQFASGRLL  178

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  179  AAISSRPGQCGRADGYIL  196



>ref|XP_004244061.1| PREDICTED: 40S ribosomal protein S8-like [Solanum lycopersicum]
Length=221

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 176/198 (89%), Gaps = 2/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            V+IGR KK  A     E  E  A  E KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+
Sbjct  121  VEIGR-KKKTAASSKKEGEEAEAVAEEKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLL  179

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  180  AAISSRPGQCGRADGYIL  197



>gb|ACI15738.1| putative 40S ribosomal protein S8-like protein [Picrorhiza kurrooa]
Length=216

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 174/197 (88%), Gaps = 2/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            M  S  SMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MSTSLLSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELV+TQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IGR  K     +   E   V AEE KKSNHVQRKLEKRQ+ERK+DSH+EEQF  GRL+A
Sbjct  121  EIGR--KKKTAAKKEGEEAEVVAEEVKKSNHVQRKLEKRQEERKIDSHIEEQFSGGRLLA  178

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  179  AISSRPGQCGRADGYIL  195



>ref|XP_007049645.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
 gb|EOX93802.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
Length=195

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 145/171 (85%), Gaps = 7/171 (4%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  9    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  68

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK AAKKE  E          
Sbjct  69   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTAAKKEATEVESFFIW---  125

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
                     + +  K+ KLD+H+EEQFG+GRL+ACISSRPGQCGRADGYIL
Sbjct  126  ----QEGEGVAEETKKSKLDAHIEEQFGAGRLLACISSRPGQCGRADGYIL  172



>ref|NP_001275100.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
 gb|ABB72814.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
Length=221

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 175/198 (88%), Gaps = 3/198 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKK+WRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            V+IGR  K  +  +   E     A E KKSNHVQRKLEKRQ++RK+D H+EEQF SGRL+
Sbjct  121  VEIGR--KKKSAAKKEGEEAAEGAAEEKKSNHVQRKLEKRQQDRKIDPHVEEQFASGRLL  178

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  179  AAISSRPGQCGRADGYIL  196



>gb|EYU39185.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=194

 Score =   249 bits (636),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELV+T+TLVKSAI+QVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            VDIGR KK     +  E  EG AA+E KKS+HV RK+EKRQ ERKLD H+EEQF SGRL+
Sbjct  121  VDIGR-KKKGGADKKEETEEGEAAQEAKKSSHVLRKIEKRQAERKLDPHVEEQFSSGRLL  179

Query  547  ACISSRPGQCGRADG  591
            ACISSRPGQCGRADG
Sbjct  180  ACISSRPGQCGRADG  194



>ref|XP_011089042.1| PREDICTED: 40S ribosomal protein S8-like [Sesamum indicum]
Length=220

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 176/198 (89%), Gaps = 2/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKL +  KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLDTLQKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RL+TGNYSWGSEA+TRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            VDI  +KK  A K+   E     A+ETKKSNHV RKLEKRQ  RKLD H+EEQF SGRL+
Sbjct  121  VDI-GRKKKGAAKKDEAEEGEGIAQETKKSNHVLRKLEKRQAARKLDPHVEEQFSSGRLL  179

Query  547  ACISSRPGQCGRADGYIL  600
            ACISSRPGQCGRADGYIL
Sbjct  180  ACISSRPGQCGRADGYIL  197



>gb|EMS65111.1| 40S ribosomal protein S8 [Triticum urartu]
Length=274

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 180/202 (89%), Gaps = 6/202 (3%)
 Frame = +1

Query  13   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  192
            GISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRL
Sbjct  51   GISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRL  110

Query  193  DTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVD  372
            DTGN+SWGSEAVTRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV+
Sbjct  111  DTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGVE  170

Query  373  IGRkkkaaakketa------eetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGS  534
            IGRKKKAAA  +         E    A EE KKSN+VQRKLEKRQ+ R LDSH+EEQF  
Sbjct  171  IGRKKKAAAAAKKEPAEGQEAEVAAAATEEAKKSNNVQRKLEKRQQGRTLDSHIEEQFSG  230

Query  535  GRLMACISSRPGQCGRADGYIL  600
            GRL+ACISSRPGQCGRADGYIL
Sbjct  231  GRLLACISSRPGQCGRADGYIL  252



>ref|XP_010520566.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=224

 Score =   249 bits (637),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 178/203 (88%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRLRVRGGNIKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEA TRK+RILDVVYNASNNELV+T+TLVKSAIVQ+DAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEAATRKSRILDVVYNASNNELVRTKTLVKSAIVQIDAAPFKQWYLSHYGV  120

Query  370  DIGRkkkaaakketae------etegvaaeetkkSNHVqrklekrqkerklDSHLEEQFG  531
            ++GRKKKA+A     E        +  A EETKKSNHV RKLEKRQ+ R LDSH+++QF 
Sbjct  121  EVGRKKKASASSGKKEEEGEDGAEKAAAPEETKKSNHVLRKLEKRQQNRALDSHIDDQFS  180

Query  532  SGRLMACISSRPGQCGRADGYIL  600
            +GRL+ACISSRPGQCGRADGYIL
Sbjct  181  TGRLLACISSRPGQCGRADGYIL  203



>ref|XP_006352532.1| PREDICTED: 40S ribosomal protein S8 [Solanum tuberosum]
Length=221

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 176/198 (89%), Gaps = 3/198 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  186
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  187  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYG  366
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  367  VDIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLM  546
            V+IGR  K  +  +   E    AA E KKSNHVQRKLEKRQ++RK++ H+EEQF SGRL+
Sbjct  121  VEIGR--KKKSAAKKEGEEAAEAAAEEKKSNHVQRKLEKRQQDRKINPHVEEQFASGRLL  178

Query  547  ACISSRPGQCGRADGYIL  600
            A ISSRPGQCGRADGYIL
Sbjct  179  AAISSRPGQCGRADGYIL  196



>gb|EPS68663.1| hypothetical protein M569_06106, partial [Genlisea aurea]
Length=217

 Score =   247 bits (631),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 173/197 (88%), Gaps = 2/197 (1%)
 Frame = +1

Query  13   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTVRRIRVRGGNVKWRALR  189
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRR+RVRGGNVKWRALR
Sbjct  1    GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTQKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIV VDAAPFKQWY  HYGV
Sbjct  61   LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDAAPFKQWYSTHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IG+ KK +  K      EG AA   K SNHV+RK +KRQ +RK+DSHLEEQF SGRL+A
Sbjct  121  EIGK-KKKSNAKRDEPTEEGDAATVGKASNHVERKRKKRQVDRKVDSHLEEQFSSGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  180  SISSRPGQCGRADGYIL  196



>gb|ABK21921.1| unknown [Picea sitchensis]
Length=221

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 175/198 (88%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrkl-ekrqkerklDSHLEEQFGSGRLM  546
            DIGRKKKAAA K+   E     AEE KK +    K  EKRQ+  KLDSHLEEQFGSGRL+
Sbjct  121  DIGRKKKAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFGSGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            A I+SRPGQCGRADGYIL
Sbjct  181  AAIASRPGQCGRADGYIL  198



>ref|XP_001761026.1| predicted protein [Physcomitrella patens]
 gb|EDQ74093.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 169/197 (86%), Gaps = 3/197 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK+AIVQVDAAPF+ WY QHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIVQVDAAPFRTWYSQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IG   K        +  +  A EE KKSNHVQ+KL KR +  KLDSHLE+QF SGRL+A
Sbjct  121  EIG---KKKKSAAKKDSEDAEATEEEKKSNHVQKKLAKRVEGHKLDSHLEDQFASGRLLA  177

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGRADGYIL
Sbjct  178  CIASRPGQCGRADGYIL  194



>gb|ABK21933.1| unknown [Picea sitchensis]
Length=221

 Score =   244 bits (623),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 174/198 (88%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqke-rklDSHLEEQFGSGRLM  546
            DIGRKKKAAA K+   E     AEE KK +    K  ++++E  KLDSHLEEQF SGRL+
Sbjct  121  DIGRKKKAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            A I+SRPGQCGRADGYIL
Sbjct  181  AAIASRPGQCGRADGYIL  198



>gb|ABK22298.1| unknown [Picea sitchensis]
Length=222

 Score =   244 bits (623),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 170/199 (85%), Gaps = 2/199 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqker--klDSHLEEQFGSGRL  543
            DIGRKKKAAA  +     EG A  E +K        +  +++   KLDSHLEEQF SGRL
Sbjct  121  DIGRKKKAAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRL  180

Query  544  MACISSRPGQCGRADGYIL  600
            +A I+SRPGQCGRADGYIL
Sbjct  181  LAAIASRPGQCGRADGYIL  199



>gb|AET01418.2| 40S ribosomal protein S8 [Medicago truncatula]
Length=288

 Score =   244 bits (624),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = +1

Query  16   ISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLD  195
            ISRDS  KR ATGGK+K   KKRKYELGRQPANTKLSSNKTVR IRVRGGN+K RALRLD
Sbjct  74   ISRDSRDKRLATGGKRKTCIKKRKYELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLD  133

Query  196  TGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDI  375
            TGN SWGSEAVTRK+R+L+VVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV+I
Sbjct  134  TGNISWGSEAVTRKSRLLNVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEI  193

Query  376  GRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACI  555
            G  KK  A K+ + +    A EETKKSNHV RKLE R+K+R+LD+H+EEQFG GRL+ACI
Sbjct  194  G-NKKKTAAKQDSAKEAEAATEETKKSNHVLRKLENREKDRQLDAHIEEQFGGGRLLACI  252

Query  556  SSRPGQCGRADGYIL  600
            SSRPGQCGRADGYIL
Sbjct  253  SSRPGQCGRADGYIL  267



>gb|ABR16896.1| unknown [Picea sitchensis]
Length=221

 Score =   242 bits (617),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 173/198 (87%), Gaps = 1/198 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSE VTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEPVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqke-rklDSHLEEQFGSGRLM  546
            DIGRKKKAAA K+   E     AEE KK +    K  ++++E  KLDSHLEEQF SGRL+
Sbjct  121  DIGRKKKAAAAKKETTEEGEATAEEEKKKSKHLLKKIEKRQEGHKLDSHLEEQFASGRLL  180

Query  547  ACISSRPGQCGRADGYIL  600
            A I+SRPGQCGRADGYIL
Sbjct  181  AAIASRPGQCGRADGYIL  198



>gb|EPS68749.1| hypothetical protein M569_06019 [Genlisea aurea]
Length=411

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 167/197 (85%), Gaps = 4/197 (2%)
 Frame = +1

Query  13   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTVRRIRVRGGNVKWRALR  189
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRRIRVRGGNVKWRALR
Sbjct  194  GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTTKTVRRIRVRGGNVKWRALR  253

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIV VDA PFKQWYL HYGV
Sbjct  254  LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDATPFKQWYLTHYGV  313

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DIG+           ++        TK S+HV++K +KRQ +RK++ H+EEQF  GRL+A
Sbjct  314  DIGK---KRKLPAAKKDEAEEPDANTKVSHHVEKKRKKRQVDRKIEPHVEEQFAGGRLLA  370

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  371  CISSRPGQCGRADGYIL  387



>ref|XP_001773385.1| predicted protein [Physcomitrella patens]
 gb|EDQ61758.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELV+TQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IG   K        EE      EE K+S+HV RK+ KR + +KLD+HLE+QF SGRL+A
Sbjct  121  EIG---KKKKAAVKKEEVAETTEEEKKQSSHVLRKIAKRAEGQKLDAHLEDQFASGRLLA  177

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR+DGYIL
Sbjct  178  CISSRPGQCGRSDGYIL  194



>ref|XP_001777587.1| predicted protein [Physcomitrella patens]
 gb|EDQ57630.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IG   K        +  +    EE KKS HVQRKL KR + +KLDSHLE+QF SGRL+A
Sbjct  121  EIG---KKKKAAAKKDTEDAETTEEEKKSAHVQRKLAKRLEGQKLDSHLEDQFASGRLLA  177

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGRADGYIL
Sbjct  178  CIASRPGQCGRADGYIL  194



>ref|XP_001780988.1| predicted protein [Physcomitrella patens]
 gb|EDQ54172.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IG   K        +E      E+TK+S HV RK+ KR + +KLDSHLE+QF SGRL+A
Sbjct  121  EIG---KKKKAAAKKDEEAEATEEQTKQSGHVLRKIAKRVEGQKLDSHLEDQFASGRLLA  177

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGRADGYIL
Sbjct  178  CIASRPGQCGRADGYIL  194



>ref|XP_001777813.1| predicted protein [Physcomitrella patens]
 gb|EDQ57351.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 167/197 (85%), Gaps = 3/197 (2%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNFKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +IG   K        +  E  A EE KKS HV RK+ KR + +KLD+HLE+QF SGRL+A
Sbjct  121  EIG---KKKKTAAKKDAEEAEATEEEKKSKHVLRKIAKRVESQKLDAHLEDQFASGRLLA  177

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGR DGYIL
Sbjct  178  CIASRPGQCGRVDGYIL  194



>gb|AES86897.2| 40S ribosomal S8-like protein [Medicago truncatula]
Length=218

 Score =   234 bits (596),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYNA
Sbjct  27   YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYNA  86

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV+IG   K  + K+ + E      EE 
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-SAKKTSGKKDSAEESEAVTEEV  145

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSN+VQRKLE+RQK+R+LD  +E QFG GRL+ACISSRPGQCGRADGYIL
Sbjct  146  KKSNNVQRKLEQRQKDRRLDPLIEVQFGGGRLLACISSRPGQCGRADGYIL  196



>ref|XP_003604700.1| Ribosomal protein S8 [Medicago truncatula]
Length=280

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYNA
Sbjct  8    YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYNA  67

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV+IG   K  + K+ + E      EE 
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIG-SAKKTSGKKDSAEESEAVTEEV  126

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KKSN+VQRKLE+RQK+R+LD  +E QFG GRL+ACISSRPGQCGRADGYIL
Sbjct  127  KKSNNVQRKLEQRQKDRRLDPLIEVQFGGGRLLACISSRPGQCGRADGYIL  177


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  514  LEEQFGSGRLMACISSRPGQCGRADGYIL  600
            +EEQ G GRL+ACISSRPGQCG ADGYIL
Sbjct  231  IEEQLGGGRLLACISSRPGQCGTADGYIL  259



>ref|XP_004516802.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=312

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 146/171 (85%), Gaps = 5/171 (3%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQ A+TKLSSNKT+RRIRVRGGNVKWR LR DTGN+SWGSEAVTRKTR+LD+VYNA
Sbjct  21   YELGRQLASTKLSSNKTIRRIRVRGGNVKWRDLRWDTGNFSWGSEAVTRKTRLLDMVYNA  80

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+TQTLVK+AIVQVD APFKQWYLQHYGV+IGR           +    VAAEE 
Sbjct  81   SNNELVRTQTLVKNAIVQVDVAPFKQWYLQHYGVEIGR-----NITMVLKLEVEVAAEEA  135

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KK+NHVQRKLE RQK+R+LDSH+EEQFG GRL+ACI S PGQCGR DGYIL
Sbjct  136  KKNNHVQRKLENRQKDRQLDSHIEEQFGGGRLLACILSHPGQCGRLDGYIL  186



>ref|XP_008676011.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=335

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSN+TVRR+ VRGGN KWRALRLDTGN SWGSEA+ RKT ILDVVYNA
Sbjct  149  YELGRQPANTKLSSNETVRRVHVRGGNAKWRALRLDTGNCSWGSEALIRKTHILDVVYNA  208

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakke--taeetegvaae  441
            SNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK    K+  T  +      E
Sbjct  209  SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVHVAKKDDTEGQEGEAIVE  268

Query  442  etkkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            ETKKSNHVQRK++KR + R LD+H+EE+FGSGRL+ACIS+ P QCGRADGYIL
Sbjct  269  ETKKSNHVQRKIDKRHQYRALDTHIEEKFGSGRLLACISAHPRQCGRADGYIL  321



>ref|XP_001696201.1| ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP08178.1| ribosomal protein S8 [Chlamydomonas reinhardtii]
Length=208

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 9/197 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRK RILDVVYNASNNELV+TQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++G            +       EE K SNHV+RK+++R ++RKLDSHL EQF +GRL A
Sbjct  121  ELG---------AKNQAEIVPKPEEIKGSNHVKRKIKERLQKRKLDSHLAEQFSTGRLFA  171

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  172  CISSRPGQCGRCDGYIL  188



>gb|ABA01100.1| 40S ribosomal protein S8 [Chlamydomonas incerta]
Length=208

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 161/197 (82%), Gaps = 9/197 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRR TGG+KK WRKK+KYE+GR PANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRDTGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRK RILDVVYNASNNELV+TQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++G           ++       EE K SNHV+RK+++R ++RKLD+H+ EQF +GRL A
Sbjct  121  ELG---------AKSQLEVVPKPEEVKGSNHVKRKIKERLQKRKLDAHMAEQFSTGRLFA  171

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGR DGYIL
Sbjct  172  CIASRPGQCGRCDGYIL  188



>ref|XP_002963298.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
 ref|XP_002974597.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ24117.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ35169.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
Length=214

 Score =   226 bits (576),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = +1

Query  13   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  192
            GISRDS+HKRRATGGKKKAWRKKRKYELGRQPA TKL++ KTVRRIRVRGGN K RALRL
Sbjct  1    GISRDSLHKRRATGGKKKAWRKKRKYELGRQPAMTKLAA-KTVRRIRVRGGNFKLRALRL  59

Query  193  DTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVD  372
            D GNYSWG+EAV RKTRIL+VVYNASNNELV+TQTLVKSAIVQVDA PF+ WY QHYGVD
Sbjct  60   DAGNYSWGTEAVARKTRILEVVYNASNNELVRTQTLVKSAIVQVDATPFRAWYNQHYGVD  119

Query  373  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  552
            + R  K     E   E    A EE  KS H  RKL  R +  KLD H+EEQ  SGRL+AC
Sbjct  120  LSR--KKKPSAEATTEAGPAAEEEKPKSKHTLRKLANRAEGHKLDPHIEEQMASGRLLAC  177

Query  553  ISSRPGQCGRADGYIL  600
            I+SRPGQCGRADGYIL
Sbjct  178  IASRPGQCGRADGYIL  193



>ref|XP_002945874.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52869.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=209

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 8/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLSSN  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSSNVAVRTVRVRGGHTKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRK RILDVVYNASNNELV+TQTLVK+AIVQVDA  FKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATQFKQWYQKHYNV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++G         +  +       EE + SNHV+RK+++R ++RKLD HL EQF +GRL A
Sbjct  121  ELG--------AKKDQPDVAPKPEEIQGSNHVKRKIKERLQKRKLDPHLAEQFTTGRLFA  172

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGRADGYIL
Sbjct  173  CIASRPGQCGRADGYIL  189



>gb|EYU33690.1| hypothetical protein MIMGU_mgv1a013952mg [Erythranthe guttata]
Length=205

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELV+T+TLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            DI R KK AA K+  EE E  A EE KKSNHV RK+EKRQ+ERK+++H+EEQF SGRL+A
Sbjct  121  DISR-KKKAAVKKEGEEAEAAATEEAKKSNHVHRKIEKRQEERKINTHIEEQFCSGRLLA  179

Query  550  C  552
             
Sbjct  180  L  180



>ref|XP_010539242.1| PREDICTED: 40S ribosomal protein S8-1-like, partial [Tarenaya 
hassleriana]
Length=180

 Score =   219 bits (559),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 139/158 (88%), Gaps = 3/158 (2%)
 Frame = +1

Query  136  TVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAI  315
            TVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN+SNNELV+T+TLVKSAI
Sbjct  2    TVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTKTLVKSAI  61

Query  316  VQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeete---gvaaeetkkSNHVqrklekr  486
            VQVDAAPFKQWYLQHYGV++GRKKK AA     E  E     A EETKKSNHV RKLEKR
Sbjct  62   VQVDAAPFKQWYLQHYGVEVGRKKKTAATAGKKEGEEGEDTAALEETKKSNHVLRKLEKR  121

Query  487  qkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            Q+ R LD H+E+QF SGRL+ACISSRPGQCGRADGYIL
Sbjct  122  QQNRNLDPHIEDQFASGRLLACISSRPGQCGRADGYIL  159



>gb|AFW66128.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66141.1| putative ribosomal protein S8e family protein [Zea mays]
Length=153

 Score =   214 bits (544),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGR  381
            DIGR
Sbjct  121  DIGR  124



>gb|KJB81680.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=155

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  370  DIGR  381
            DIGR
Sbjct  121  DIGR  124



>gb|KHG09566.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=163

 Score =   213 bits (541),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRR+TGGK+KAWRKKRK+ELGRQP NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKHELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  370  DIGR  381
            DIGR
Sbjct  121  DIGR  124



>ref|XP_008799563.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=146

 Score =   211 bits (538),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  370  DIGR  381
            +IGR
Sbjct  121  EIGR  124



>emb|CCA22399.1| 40S ribosomal protein S82 putative [Albugo laibachii Nc14]
Length=206

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 154/197 (78%), Gaps = 10/197 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL   K V R+RVRGG+ K+RALR
Sbjct  1    MGISRDSRHKRRDTGGKRKQYRKKRKFELGRQPANTKLG-GKRVHRVRVRGGHFKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+TGN+SWGSEAV+RKTRILDVVYNASNNELV+T+TLVKSAIV +DA PF+QWY  HYGV
Sbjct  60   LETGNFSWGSEAVSRKTRILDVVYNASNNELVRTKTLVKSAIVSIDATPFRQWYETHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             IG+                   E+ KKS+HV RKL +RQ+ R  D  L+EQF SGR++A
Sbjct  120  KIGQ---------KKNAETTEKVEQEKKSDHVMRKLAQRQRGRIFDPKLDEQFTSGRILA  170

Query  550  CISSRPGQCGRADGYIL  600
            C+SSRPGQ GRADGYIL
Sbjct  171  CVSSRPGQSGRADGYIL  187



>gb|KDD75705.1| ribosomal protein S8e [Helicosporidium sp. ATCC 50920]
Length=353

 Score =   218 bits (554),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 147/197 (75%), Gaps = 13/197 (7%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRA+G +   WRKKRK+ELGRQPANTKLSSN TVR +R RGGN+K+RALR
Sbjct  1    MGISRDSIHKRRASGARPNIWRKKRKFELGRQPANTKLSSNVTVRPVRCRGGNMKYRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GN+SWGSEA TR+TRIL V YNASNNELV+TQTLVKSAIVQVDAAPFK WY Q YG 
Sbjct  61   LDSGNFSWGSEATTRRTRILSVSYNASNNELVRTQTLVKSAIVQVDAAPFKAWYSQRYGT  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++GR              +    E+   S  V +K   R K   LDS LE+QF  GRL A
Sbjct  121  ELGR-------------KKAAEEEKEPVSERVAKKQAARAKNHSLDSLLEDQFSVGRLYA  167

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGRADGYIL
Sbjct  168  LISSRPGQCGRADGYIL  184



>emb|CEG02139.1| Ribosomal protein S8e/ribosomal biogenesis NSA2 [Ostreococcus 
tauri]
Length=217

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 152/197 (77%), Gaps = 7/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR++R RGGNVK RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNVKHRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSE  TRKTRILDVVYNASNNELV+T+TLVKSA+V VDAAPF+ WY QHYG 
Sbjct  61   LDTGNYSWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGK  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             IG        K            + K+S  V  KL +R ++  ++S ++ QF +GRL+A
Sbjct  121  KIG-------IKVKNGAKVEEEDIDEKRSKSVTMKLRRRNRDHAVESAIDAQFSTGRLLA  173

Query  550  CISSRPGQCGRADGYIL  600
             ++SRPGQCGR DGYIL
Sbjct  174  IVTSRPGQCGRCDGYIL  190



>ref|XP_011397165.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
 gb|KFM24278.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
Length=191

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 157/197 (80%), Gaps = 27/197 (14%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+KAWRKKRKYELGRQPANTKLSSN TVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNVTVRRVRVRGGNSKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GN+SWGSEA TRKTRILDV YNASNNELV+TQTLVK+AI+Q+DAAPFKQWY QHYGV
Sbjct  61   LDSGNFSWGSEATTRKTRILDVSYNASNNELVRTQTLVKNAIIQIDAAPFKQWYQQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            +                           S+HVQRKL+ R K+R LD  L+EQF  GRL A
Sbjct  121  E---------------------------SDHVQRKLKLRNKDRTLDPLLDEQFSVGRLYA  153

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGRADGYIL
Sbjct  154  CISSRPGQCGRADGYIL  170



>gb|EPZ31448.1| 40S ribosomal protein S8-B [Rozella allomycis CSF55]
Length=205

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 155/197 (79%), Gaps = 8/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKR  TG K+  +RKKRK+ELGRQPANTKL + K +  +RVRGGN K+RA+R
Sbjct  1    MGISRDSRHKRSHTGAKRAQYRKKRKFELGRQPANTKLGA-KRIHPVRVRGGNTKFRAMR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEA+TRKTRI+DVVYNASNNELV+T+TLVKSAIVQ+DA PF+QWY  HYG 
Sbjct  60   LDTGNFSWGSEAITRKTRIIDVVYNASNNELVRTKTLVKSAIVQIDATPFRQWYEAHYGS  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             +G+       K+ A+     A +  KKSNHVQRK+E R+K+  +D  L++QF +GRL A
Sbjct  120  LLGK-------KKLAKAASTEAGDAEKKSNHVQRKIESRKKDAHVDQALDDQFSTGRLYA  172

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQ GR DGYIL
Sbjct  173  CISSRPGQSGRCDGYIL  189



>ref|XP_001422585.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00902.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=220

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 152/197 (77%), Gaps = 7/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR++R RGGN+K RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNIKHRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN++WGSE  TRKTRILDVVYNASNNELV+T+TLVKSA++ VDAAPF+ WY QHYG 
Sbjct  61   LDTGNFAWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVIAVDAAPFRAWYAQHYGK  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             IG        K            E K+S  V  KL  R ++ ++   ++EQF +GRL+A
Sbjct  121  KIG-------IKVKNGAKVESEDIEEKRSKSVTMKLRSRNQKHEVAKAIDEQFATGRLLA  173

Query  550  CISSRPGQCGRADGYIL  600
             I+SRPGQCGRADGY+L
Sbjct  174  IITSRPGQCGRADGYVL  190



>ref|XP_005648786.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
 gb|EIE24242.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
Length=214

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRR TGGK+K WRKKRK+ELGRQPANTKLSSN TVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRLTGGKQKTWRKKRKFELGRQPANTKLSSNVTVRRVRVRGGNFKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GN+SWGSEAVTRKTR+LDVVYNASNNELV+TQTLVKSAIVQVDA PFKQ+Y QHYGV
Sbjct  61   LDSGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDATPFKQFYTQHYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            + G  KK +     AEE +    E  K SNHV RKL+ R +  KLD  L+ QF  GRL+A
Sbjct  121  EAG-LKKKSGAAAAAEEEKKAGEEAKKTSNHVDRKLKLRNQNHKLDEVLDAQFAGGRLLA  179

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQCGR DGYIL
Sbjct  180  AISSRPGQCGRVDGYIL  196



>gb|KJB81681.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=153

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  370  DI  375
            DI
Sbjct  121  DI  122



>ref|XP_005844426.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
 gb|EFN52324.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
Length=233

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = +1

Query  13   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  192
            GISRDS+HKRRATGGK+K WRKKRKYELGRQPA TKLSSN  VRR+RVRGGN K+RALRL
Sbjct  19   GISRDSLHKRRATGGKQKPWRKKRKYELGRQPAMTKLSSNVCVRRVRVRGGNSKFRALRL  78

Query  193  DTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVD  372
            D GN+SWGSEAVTRK RILDV YNASNNELV+TQTLVKSAI+Q+DAAPFKQWY QHYG++
Sbjct  79   DHGNFSWGSEAVTRKVRILDVSYNASNNELVRTQTLVKSAIIQIDAAPFKQWYQQHYGLE  138

Query  373  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  552
            +G+  K  +    A            +SNHV+RKL++R + RKLD HL++QF +GRL A 
Sbjct  139  VGQ--KKKSAAAAAAAAAEGEEAAAPQSNHVKRKLKQRNQGRKLDQHLDDQFATGRLYAA  196

Query  553  ISSRPGQCGRADGYIL  600
            ISSRPGQCGR DGYIL
Sbjct  197  ISSRPGQCGRCDGYIL  212



>gb|KDO22073.1| 40S ribosomal protein S8 [Saprolegnia parasitica CBS 223.65]
Length=202

 Score =   208 bits (529),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 151/197 (77%), Gaps = 14/197 (7%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTK+ + K V  +RVRGGN+K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKMGA-KRVSTVRVRGGNLKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+TGN+SWG+E   RKTR+LDV+YNASNNELV+T+TLVK+AI+QVDA PF+QWY  HYGV
Sbjct  60   LETGNFSWGTEVTARKTRVLDVLYNASNNELVRTKTLVKNAIIQVDATPFRQWYEAHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             +G+              +    E  KKSNHV+RK   R + + LD  +EEQF SGRL+A
Sbjct  120  KLGK-------------VKADDEEAAKKSNHVERKQAARARAQVLDPKIEEQFNSGRLLA  166

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQ GR DGYIL
Sbjct  167  CISSRPGQSGRCDGYIL  183



>gb|AGE46026.1| 40S ribosomal protein S8, partial [Elaeis guineensis]
Length=173

 Score =   206 bits (525),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 130/149 (87%), Gaps = 3/149 (2%)
 Frame = +1

Query  163  GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFK  342
            GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAI+QVDAAPFK
Sbjct  1    GNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFK  60

Query  343  QWYLQHYGVDIGRkkkaaakketaeetegv---aaeetkkSNHVqrklekrqkerklDSH  513
            QWYLQHYGV+IGRKKKA A  +           A EE KKSNHV RKLEKRQ+ RKLD H
Sbjct  61   QWYLQHYGVEIGRKKKAPAATKKEATEGQEGEGATEEPKKSNHVLRKLEKRQQGRKLDPH  120

Query  514  LEEQFGSGRLMACISSRPGQCGRADGYIL  600
            +EEQFGSGRL+ACISSRPGQCGRADGYIL
Sbjct  121  IEEQFGSGRLLACISSRPGQCGRADGYIL  149



>emb|CAA03954.1| ribosomal protein S8 [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   204 bits (520),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELV+TQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGR  381
            +IGR
Sbjct  121  EIGR  124



>ref|XP_008608971.1| 40S ribosomal protein S8 [Saprolegnia diclina VS20]
 gb|EQC37451.1| 40S ribosomal protein S8 [Saprolegnia diclina VS20]
Length=202

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 151/197 (77%), Gaps = 14/197 (7%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTK+ + K V  +RVRGGN+K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKMGA-KRVSTVRVRGGNLKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+TGN+SWG+E   RKTR+LDV+YNASNNELV+T+TLVK+AI+Q+DA PF+QWY  HYGV
Sbjct  60   LETGNFSWGTEVTARKTRVLDVLYNASNNELVRTKTLVKNAIIQIDATPFRQWYEAHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             +G+              +    E  KKSNHV+RK   R + + LD  +EEQF SGRL+A
Sbjct  120  KLGK-------------VKADDEEAAKKSNHVERKQAARARVQVLDPKIEEQFNSGRLLA  166

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQ GR DGYIL
Sbjct  167  CISSRPGQSGRCDGYIL  183



>emb|CCI48864.1| unnamed protein product [Albugo candida]
Length=206

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 152/197 (77%), Gaps = 10/197 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL   K V R+RVRGG+ K+RALR
Sbjct  1    MGISRDSRHKRRETGGKRKQFRKKRKFELGRQPANTKLG-GKRVHRVRVRGGHFKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+TGN+SWGSEAV+RKTRILDVVYNASNNELV+T+TLVKSA+V +DA PF+ WY  HYGV
Sbjct  60   LETGNFSWGSEAVSRKTRILDVVYNASNNELVRTKTLVKSAVVSIDATPFRHWYETHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             IG                    E+ KKS+HV RKL +RQ+ R  D  L++QF SGR++A
Sbjct  120  KIG---------VKKNTESTEKVEQEKKSDHVMRKLAQRQRGRIFDPKLDDQFMSGRILA  170

Query  550  CISSRPGQCGRADGYIL  600
            C+SSRPGQ GRADGYIL
Sbjct  171  CVSSRPGQSGRADGYIL  187



>tpg|DAA53686.1| TPA: putative ribosomal protein S8e family protein, partial [Zea 
mays]
Length=296

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVK  306
            SNKTVRR+ VRGGNVKW ALRLDTGNYSWGSEA+T KT ILDVVYNASNNELV+TQTLVK
Sbjct  131  SNKTVRRVCVRGGNVKWSALRLDTGNYSWGSEALTHKTHILDVVYNASNNELVRTQTLVK  190

Query  307  SAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaee--tegvaaeetkkSNHVqrkle  480
            SAIVQVDAAPFKQWYL  YG+DIGRKKK    K+ A E        EETKKSNHVQRK+E
Sbjct  191  SAIVQVDAAPFKQWYLTRYGMDIGRKKKVHVAKKDATEGQAGEAIVEETKKSNHVQRKIE  250

Query  481  krqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            KRQ++  LD+H+EEQFGSGRL+ACIS+ PGQCG+ADGYIL
Sbjct  251  KRQQDCALDTHIEEQFGSGRLLACISACPGQCGQADGYIL  290



>gb|ABR25841.1| 40S ribosomal protein S8 [Oryza sativa Indica Group]
Length=168

 Score =   204 bits (518),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +1

Query  169  VKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQW  348
            +KWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQW
Sbjct  1    LKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  60

Query  349  YLQHYGVDIGRkkkaaakketaee--tegvaaeetkkSNHVqrklekrqkerklDSHLEE  522
            YL HYGVDIGRKKKA A K+ A E      A EE KKSNHV RKLEKRQ+ R LD+H+EE
Sbjct  61   YLTHYGVDIGRKKKAPAAKKDAAEGQEGEAATEEEKKSNHVVRKLEKRQQTRTLDAHIEE  120

Query  523  QFGSGRLMACISSRPGQCGRADGYIL  600
            QFGSGRL+ACISSRPGQCGRADGYIL
Sbjct  121  QFGSGRLLACISSRPGQCGRADGYIL  146



>ref|XP_005539190.1| 40S ribosomal protein S8 [Cyanidioschyzon merolae strain 10D]
 dbj|BAC67673.1| ribosomal protein S8 [Cyanidioschyzon merolae]
 dbj|BAM83154.1| 40S ribosomal protein S8 [Cyanidioschyzon merolae strain 10D]
Length=209

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 149/197 (76%), Gaps = 7/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS+HKRR TGGK+K  RKKRKYELGR PANT+L   K VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSIHKRRLTGGKRKIHRKKRKYELGRPPANTRLGP-KLVRPLRVRGGHFKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+ GNYSW SE VTRKTRIL VVYNASNNELV+T TLVK +IV +DA PF+ WY QHYG+
Sbjct  60   LEMGNYSWASECVTRKTRILGVVYNASNNELVRTNTLVKGSIVHIDATPFRTWYFQHYGI  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            D+G+      K  ++ +       E K+S  V  KL  RQ +R L+  LE+QF SGRL+A
Sbjct  120  DLGK------KAVSSADATDGTTTEAKRSASVLAKLAARQAKRSLEKALEDQFNSGRLLA  173

Query  550  CISSRPGQCGRADGYIL  600
            CI+SRPGQCGRADGYIL
Sbjct  174  CIASRPGQCGRADGYIL  190



>ref|XP_668115.1| ribosomal protein S8 [Cryptosporidium hominis TU502]
Length=208

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 142/197 (72%), Gaps = 8/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HK RATGG+     KKRKYE+GR  +NTKL ++  VR +R RGGN K+RALR
Sbjct  1    MGISRDSRHKHRATGGRMPIVVKKRKYEMGRPASNTKLGASPRVRVVRCRGGNKKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GNYSWGS+ VTRK RI++VVYNASNNELV+T+TLVK+AIV +DA PF+Q+YLQ YGV
Sbjct  61   LDSGNYSWGSQGVTRKARIMEVVYNASNNELVRTKTLVKNAIVVIDATPFRQFYLQRYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++GR            + +    +  K S H+    + R     +D  +EEQFG GRL+A
Sbjct  121  ELGR--------RKNADEKSDEKDAQKASGHLLATRKARLMNNVIDPLVEEQFGIGRLLA  172

Query  550  CISSRPGQCGRADGYIL  600
            C+SSRPGQCGR DGYIL
Sbjct  173  CVSSRPGQCGRCDGYIL  189



>ref|XP_002142692.1| 40S ribosomal protein S8 [Cryptosporidium muris RN66]
 gb|EEA08343.1| 40S ribosomal protein S8, putative [Cryptosporidium muris RN66]
Length=209

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 147/197 (75%), Gaps = 7/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HK RATGG++    KKRKYELGR  +NTKL S + +R +R RGGN K+RALR
Sbjct  1    MGISRDSRHKHRATGGRRPITVKKRKYELGRPASNTKLGSPR-IRVVRCRGGNKKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GNYSWGS+ ++RKTRIL+VVYNASNNELV+T+TLVK+AIV +DA PF+Q+YLQHYGV
Sbjct  60   LDSGNYSWGSQGISRKTRILEVVYNASNNELVRTKTLVKNAIVVIDATPFRQYYLQHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++GR      ++  +++     A+    S HV    + R     +D  +EEQF  GRL+A
Sbjct  120  ELGR------RRNKSDDITDSRADIQSGSRHVLATKKARLDNNVIDPLVEEQFTIGRLLA  173

Query  550  CISSRPGQCGRADGYIL  600
            CISSRPGQCGR DGYIL
Sbjct  174  CISSRPGQCGRCDGYIL  190



>gb|KHG07290.1| 40S ribosomal S8 [Gossypium arboreum]
 gb|KHG09567.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=156

 Score =   199 bits (505),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            +ELGRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKTRILDVVYNA
Sbjct  20   HELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRILDVVYNA  79

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  381
            SNNELV+TQTLVKSAI+QVDAAPFKQWYLQHYG+DIGR
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGR  117



>ref|XP_001745896.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89320.1| predicted protein [Monosiga brevicollis MX1]
Length=222

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 143/196 (73%), Gaps = 5/196 (3%)
 Frame = +1

Query  13   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  192
            GISRD  HKRR TG +    R KRKYELGR PA TKL+  K V  IR  GGN K+RALRL
Sbjct  16   GISRDKFHKRRRTGARVAPIRMKRKYELGRPPALTKLAGPKRVHEIRTMGGNRKFRALRL  75

Query  193  DTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVD  372
            +TGN+SWGSE V+RKTR++DVVYNASNNELV+T+TLVK+AI+ VDA PFKQWY  HYG+ 
Sbjct  76   ETGNFSWGSEGVSRKTRLIDVVYNASNNELVRTKTLVKNAIIVVDATPFKQWYETHYGLP  135

Query  373  IGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMAC  552
            IG+      K    +     A     +SNH++RKLE+R+   K+D HLEEQF +GRL AC
Sbjct  136  IGK-----KKGGRNQSEVDEAILNKPRSNHLKRKLEERKAGAKVDVHLEEQFAAGRLYAC  190

Query  553  ISSRPGQCGRADGYIL  600
            +SSRPGQ GR DGYIL
Sbjct  191  VSSRPGQSGRCDGYIL  206



>ref|XP_627792.1| 40S ribosomal protein S8 [Cryptosporidium parvum Iowa II]
 emb|CAD98279.1| ribosomal protein S8, probable [Cryptosporidium parvum]
 gb|EAK90051.1| 40S ribosomal protein S8 [Cryptosporidium parvum Iowa II]
Length=208

 Score =   200 bits (508),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 142/197 (72%), Gaps = 8/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HK RATGG+     KKRKYE+GR  +NTKL ++  VR +R RGGN K+RALR
Sbjct  1    MGISRDSRHKHRATGGRMPIVVKKRKYEMGRPASNTKLGASPRVRVVRCRGGNKKFRALR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD+GNYSWGS+ ++RK RI++VVYNASNNELV+T+TLVK+AIV +DA PF+Q+YLQ YGV
Sbjct  61   LDSGNYSWGSQGISRKARIMEVVYNASNNELVRTKTLVKNAIVVIDATPFRQFYLQRYGV  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
            ++GR            + +    +  K S H+    + R     +D  +EEQFG GRL+A
Sbjct  121  ELGR--------RKNADEKSDEKDAQKASGHLLATRKARLMNNVIDPLVEEQFGIGRLLA  172

Query  550  CISSRPGQCGRADGYIL  600
            C+SSRPGQCGR DGYIL
Sbjct  173  CVSSRPGQCGRCDGYIL  189



>gb|EKD00868.1| 40S ribosomal protein S8 [Trichosporon asahii var. asahii CBS 
8904]
Length=207

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 151/197 (77%), Gaps = 11/197 (6%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKR A+G ++  +RKKRK+ELGRQ A TKL + K +  +R RGGNVK+RA+R
Sbjct  1    MGISRDSRHKRSASGARRAHYRKKRKFELGRQAAMTKLDTTKRIHTVRTRGGNVKYRAIR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWGSEA TRKTR+L+V YN++NNEL++TQTLVKSA+V+VDA PF+QWY  HY  
Sbjct  61   LDTGNFSWGSEATTRKTRLLNVRYNSTNNELLRTQTLVKSAVVEVDATPFRQWYEAHYAQ  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             + +           +      A+E KKSNHVQR L +R+K+ K+D+HLE+QF +GRL+A
Sbjct  121  PVTK-----------KGQAEAPADEGKKSNHVQRILAERKKDAKIDNHLEQQFRTGRLLA  169

Query  550  CISSRPGQCGRADGYIL  600
             I+SRPGQ GRADGYIL
Sbjct  170  MITSRPGQSGRADGYIL  186



>gb|AFW61714.1| putative ribosomal protein S8e family protein [Zea mays]
Length=154

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDSMHKR+AT GK+KAWRKKRKYELGRQPANTKLSSNKTVRR+ VRGG VKWRAL+
Sbjct  1    MGISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWRALQ  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDT NYSWGSEA+TRKT ILDVVYNASNNELV+TQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTCNYSWGSEALTRKTGILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  370  DIGR  381
            DIGR
Sbjct  121  DIGR  124



>ref|XP_008871313.1| 40S ribosomal protein S8 [Aphanomyces invadans]
 gb|ETW00288.1| 40S ribosomal protein S8 [Aphanomyces invadans]
Length=205

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 153/197 (78%), Gaps = 11/197 (6%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL + K V  +RVRGGN K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKLGA-KRVNAVRVRGGNQKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWG+E ++ KTRIL V+YNASNNELV+T TLVK+AI+Q+DA PF+QWY  HYGV
Sbjct  60   LDTGNFSWGTEGISHKTRILIVLYNASNNELVRTNTLVKNAIIQIDAHPFRQWYEAHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             IG            +  EG A E  K+SNHVQRKL  RQ+ R+LD  L+EQF  GRL+A
Sbjct  120  KIG----------VKKSQEGEADEAAKQSNHVQRKLANRQRTRELDPRLDEQFVQGRLLA  169

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQ GRADGYIL
Sbjct  170  AISSRPGQSGRADGYIL  186



>ref|XP_009831251.1| 40S ribosomal protein S8 [Aphanomyces astaci]
 gb|ETV79410.1| 40S ribosomal protein S8 [Aphanomyces astaci]
Length=205

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 153/197 (78%), Gaps = 11/197 (6%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL + K V  +RVRGGN K+RALR
Sbjct  1    MGISRDSKHKRRETGGKRKFFRKKRKFELGRQPANTKLGA-KRVNPVRVRGGNQKFRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWG+EA++ KTRIL V+YNASNNELV+T TLVK+AI+Q+DA PF+QWY  HYGV
Sbjct  60   LDTGNFSWGTEAISHKTRILIVLYNASNNELVRTNTLVKNAIIQIDAHPFRQWYEAHYGV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             IG            +  EG   E  K+S+HVQRKL  RQ+ R+LD  L+EQF  GRL+A
Sbjct  120  KIG----------VKKSQEGETEEAVKQSSHVQRKLATRQRTRELDPRLDEQFVQGRLLA  169

Query  550  CISSRPGQCGRADGYIL  600
             ISSRPGQ GRADGYIL
Sbjct  170  AISSRPGQSGRADGYIL  186



>gb|KFH71035.1| 40S ribosomal protein S8 [Mortierella verticillata NRRL 6337]
Length=204

 Score =   197 bits (502),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 146/197 (74%), Gaps = 7/197 (4%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKR ATG K+  +RKKRK+ELGRQ ANTKL + K +  +R RGGN K+RA+R
Sbjct  1    MGISRDSRHKRNATGAKRAQYRKKRKFELGRQAANTKLGA-KRIHEVRTRGGNRKFRAMR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LD GN+SWGSEA++RKTRI+ VVYN+SNNELV+T TLVK+AIVQ+DA PF+QWY  HY  
Sbjct  60   LDAGNFSWGSEAISRKTRIVAVVYNSSNNELVRTSTLVKNAIVQIDATPFRQWYEAHYAT  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             IG      A+K               +SNHVQRK+E R+ E K+D+ L+ QF +GRL A
Sbjct  120  PIG------ARKGKGAVKTESEEVTKARSNHVQRKIEGRKAEAKVDAALDHQFAAGRLYA  173

Query  550  CISSRPGQCGRADGYIL  600
            C+SSRPGQ GRADGYIL
Sbjct  174  CLSSRPGQSGRADGYIL  190



>ref|XP_003083062.1| RS8_MAIZE 40S ribosomal protein S8 pir||T04088 ribosomal protein 
S8-maize (ISS) [Ostreococcus tauri]
Length=388

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 127/171 (74%), Gaps = 7/171 (4%)
 Frame = +1

Query  88   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  267
            YELGRQPANTKLSSN TVR++R RGGNVK RALRLDTGNYSWGSE  TRKTRILDVVYNA
Sbjct  33   YELGRQPANTKLSSNVTVRQVRCRGGNVKHRALRLDTGNYSWGSENCTRKTRILDVVYNA  92

Query  268  SNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRkkkaaakketaeetegvaaeet  447
            SNNELV+T+TLVKSA+V VDAAPF+ WY QHYG  IG        K            + 
Sbjct  93   SNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGKKIG-------IKVKNGAKVEEEDIDE  145

Query  448  kkSNHVqrklekrqkerklDSHLEEQFGSGRLMACISSRPGQCGRADGYIL  600
            K+S  V  KL +R ++  ++S ++ QF +GRL+A ++SRPGQCGR DGYIL
Sbjct  146  KRSKSVTMKLRRRNRDHAVESAIDAQFSTGRLLAIVTSRPGQCGRCDGYIL  196



>gb|AGH70192.1| 40S ribosomal protein S8 [Placozoa sp. H4]
Length=206

 Score =   197 bits (502),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 149/197 (76%), Gaps = 9/197 (5%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKRR+T G+K   RKKRK+ELGRQPA TK+ + K +  +R RGGN K+RALR
Sbjct  1    MGISRDSWHKRRSTSGRKAPLRKKRKFELGRQPAMTKMGA-KRIHTVRTRGGNYKYRALR  59

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            L+TGNYSW SE+VTRK+RILDVVYNASNNELV+T+TLVK+ IVQ+DA PFKQWY  HY V
Sbjct  60   LETGNYSWASESVTRKSRILDVVYNASNNELVRTKTLVKNCIVQIDATPFKQWYESHYNV  119

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             I R        +  ++      EE K+S  V++KLE R++  K+ S LEEQF +GR+ A
Sbjct  120  PIIR--------KKGKQQAAEETEEQKRSKRVEKKLEARKRFAKIASTLEEQFVTGRIYA  171

Query  550  CISSRPGQCGRADGYIL  600
            C++SRPGQCGR DGYIL
Sbjct  172  CVASRPGQCGRCDGYIL  188



>gb|EJT52835.1| 40S ribosomal protein S8 [Trichosporon asahii var. asahii CBS 
2479]
Length=207

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 150/197 (76%), Gaps = 11/197 (6%)
 Frame = +1

Query  10   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  189
            MGISRDS HKR A+G ++  +RKKRK+ELGRQ A TKL + K +  +R RGGNVK+RA+R
Sbjct  1    MGISRDSRHKRSASGARRAHYRKKRKFELGRQAAMTKLDTTKRIHTVRTRGGNVKYRAIR  60

Query  190  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVQTQTLVKSAIVQVDAAPFKQWYLQHYGV  369
            LDTGN+SWG EA TRKTR+L+V YN++NNEL++TQTLVKSA+V+VDA PF+QWY  HY  
Sbjct  61   LDTGNFSWGYEATTRKTRLLNVRYNSTNNELLRTQTLVKSAVVEVDATPFRQWYEAHYAQ  120

Query  370  DIGRkkkaaakketaeetegvaaeetkkSNHVqrklekrqkerklDSHLEEQFGSGRLMA  549
             + +           +      A+E KKSNHVQR L +R+K+ K+D+HLE+QF +GRL+A
Sbjct  121  PVTK-----------KGQAEAPADEGKKSNHVQRILAERKKDAKIDNHLEQQFRTGRLLA  169

Query  550  CISSRPGQCGRADGYIL  600
             I+SRPGQ GRADGYIL
Sbjct  170  MITSRPGQSGRADGYIL  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940