BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN028B17

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB15837.1|  hypothetical protein B456_002G198900                    197   7e-60   Gossypium raimondii
gb|KDO68093.1|  hypothetical protein CISIN_1g023370mg                   197   9e-60   Citrus sinensis [apfelsine]
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                  198   2e-59   Gossypium hirsutum [American cotton]
gb|ACB42440.1|  aquaporin PIP2;3                                        198   2e-59   Gossypium hirsutum [American cotton]
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   198   3e-59   Nicotiana tomentosiformis
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   197   6e-59   Nicotiana tomentosiformis
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   197   6e-59   Nicotiana sylvestris
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   197   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   197   7e-59   Nicotiana sylvestris
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    197   8e-59   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 197   8e-59   Nicotiana tabacum [American tobacco]
gb|ACB42441.1|  aquaporin PIP2;4                                        197   9e-59   Gossypium hirsutum [American cotton]
emb|CBI16313.3|  unnamed protein product                                193   2e-58   Vitis vinifera
gb|ACB71281.1|  plasma membrane intrinsic protein                       196   2e-58   Tamarix hispida
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             195   3e-58   Citrus clementina [clementine]
ref|XP_002306187.1|  membrane intrinsic family protein                  195   4e-58   
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               195   4e-58   Nicotiana tomentosiformis
gb|ABB13430.2|  plasma membrane intrinsic protein                       195   4e-58   Olea europaea
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               195   5e-58   Populus euphratica
emb|CAH60721.1|  putative plasma membrane intrinsic protein             195   5e-58   Populus tremula x Populus tremuloides
dbj|BAA22098.1|  unnamed protein product                                192   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               195   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               194   6e-58   
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      195   6e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               194   6e-58   Beta vulgaris [beet]
ref|NP_001105639.1|  aquaporin PIP2-7                                   195   7e-58   
gb|AFH36336.1|  aquaporin PIP2;1                                        194   7e-58   Quercus petraea [durmast oak]
gb|EAY92738.1|  hypothetical protein OsI_14490                          190   7e-58   Oryza sativa Indica Group [Indian rice]
gb|ACU21481.1|  unknown                                                 194   7e-58   Glycine max [soybeans]
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 194   1e-57   Gossypium arboreum [tree cotton]
gb|KJB32662.1|  hypothetical protein B456_005G254400                    194   1e-57   Gossypium raimondii
gb|ACU87556.1|  PIP protein                                             194   1e-57   Gossypium hirsutum [American cotton]
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        194   1e-57   Petunia x hybrida [garden petunia]
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg             194   1e-57   Capsella rubella
ref|NP_001275065.1|  major intrinsic protein 2                          194   1e-57   Solanum tuberosum [potatoes]
emb|CBI37861.3|  unnamed protein product                                191   1e-57   Vitis vinifera
emb|CAB46351.1|  major intrinsic protein 2                              194   1e-57   Solanum tuberosum [potatoes]
emb|CAA04654.1|  major intrinsic protein PIPC                           191   2e-57   Craterostigma plantagineum
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   194   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               194   2e-57   Tarenaya hassleriana [spider flower]
emb|CDX72515.1|  BnaC07g45370D                                          192   2e-57   
gb|ACB87734.1|  aquaporin                                               193   2e-57   Manihot esculenta [manioc]
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               193   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        193   2e-57   Sesamum indicum [beniseed]
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             193   2e-57   Eutrema salsugineum [saltwater cress]
emb|CDQ12456.1|  plasma membrane intrinsic protein 2;1                  190   3e-57   Vicia faba var. minor [tick bean]
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               193   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               193   3e-57   Pyrus x bretschneideri [bai li]
gb|AAB65787.1|  plasma membrane intrinsic protein                       193   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   193   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ABM54183.1|  aquaporin                                               193   3e-57   Jatropha curcas
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  192   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237286.1|  PIP2,2                                             193   3e-57   
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             192   4e-57   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    192   4e-57   Theobroma cacao [chocolate]
gb|AHG32323.1|  PIP2-2                                                  192   4e-57   Pisum sativum [garden pea]
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   192   4e-57   Brassica rapa
ref|NP_001268056.1|  aquaporin PIP2                                     192   4e-57   Vitis vinifera
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             192   4e-57   Capsella rubella
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          192   5e-57   Solanum tuberosum [potatoes]
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         192   5e-57   Helianthemum almeriense
emb|CDX69112.1|  BnaC01g03410D                                          192   5e-57   
gb|AAG30607.1|AF314656_1  aquaporin                                     192   5e-57   Brassica oleracea
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               192   6e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                        192   6e-57   Nicotiana sylvestris
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         192   6e-57   
ref|XP_007137341.1|  hypothetical protein PHAVU_009G118900g             192   6e-57   Phaseolus vulgaris [French bean]
gb|KJB12139.1|  hypothetical protein B456_002G002500                    192   7e-57   Gossypium raimondii
gb|ACU87555.1|  PIP protein                                             192   7e-57   Gossypium hirsutum [American cotton]
ref|XP_003606383.1|  Aquaporin PIP2-7                                   192   7e-57   Medicago truncatula
gb|ACR56614.1|  plasma intrinsic protein 2;4                            192   7e-57   Juglans regia
ref|NP_179277.1|  putative aquaporin PIP2-8                             192   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             192   9e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                        191   9e-57   Camelina sativa [gold-of-pleasure]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                192   1e-56   Populus trichocarpa x Populus deltoides
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               191   1e-56   Elaeis guineensis
gb|ACM50914.1|  aquaporin                                               192   1e-56   Medicago falcata [sickle alfalfa]
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        191   1e-56   Fragaria vesca subsp. vesca
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                        191   1e-56   Nicotiana tomentosiformis
emb|CAH60724.1|  putative plasma membrane intrinsic protein             191   1e-56   Populus tremula x Populus tremuloides
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               191   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               191   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACR56615.1|  plasma intrinsic protein 2;5                            191   1e-56   Juglans regia
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    191   1e-56   Nicotiana sylvestris
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               191   1e-56   Phoenix dactylifera
ref|XP_003597235.1|  Aquaporin PIP2-7                                   191   2e-56   Medicago truncatula
gb|AAL32127.1|  aquaporin                                               191   2e-56   Medicago truncatula
gb|ACV66986.1|  plasma membrane aquaporin 2                             191   2e-56   Hevea brasiliensis [jebe]
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    191   2e-56   Arabis alpina [alpine rockcress]
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        191   2e-56   Cucumis melo [Oriental melon]
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    191   2e-56   Arabis alpina [alpine rockcress]
ref|NP_001274381.1|  aquaporin PIP2-7-like                              191   2e-56   Cucumis sativus [cucumbers]
ref|NP_001267957.1|  aquaporin PIP2;2                                   191   2e-56   Vitis vinifera
gb|AFO63679.1|  plasma intrinsic protein 2                              191   2e-56   Eriobotrya japonica [loquat]
gb|ABH09327.1|  putative aquaporin                                      191   2e-56   Vitis vinifera
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     191   2e-56   Vitis cinerea var. helleri x Vitis rupestris
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         191   2e-56   Jatropha curcas
gb|AFH36337.1|  aquaporin PIP2;2                                        191   2e-56   Quercus petraea [durmast oak]
emb|CAB61749.1|  putative water channel protein                         189   2e-56   Cicer arietinum [garbanzo]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             191   2e-56   Populus trichocarpa [western balsam poplar]
gb|AAL33586.1|AF440272_1  aquaporin                                     191   2e-56   Nicotiana tabacum [American tobacco]
ref|XP_003604054.1|  Aquaporin PIP22                                    191   2e-56   
ref|XP_006664813.1|  PREDICTED: probable aquaporin PIP2-6-like          190   3e-56   Oryza brachyantha
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  191   3e-56   Mimosa pudica [sensitive-plant]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   191   3e-56   Populus euphratica
ref|NP_001052292.1|  Os04g0233400                                       191   3e-56   
ref|XP_002884019.1|  PIP2_8/PIP3B                                       190   3e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        190   3e-56   Brassica rapa
emb|CDY17511.1|  BnaC03g65520D                                          190   3e-56   Brassica napus [oilseed rape]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                190   3e-56   Erythranthe guttata [common monkey flower]
gb|AEY75254.1|  aquaporin                                               190   3e-56   Atriplex canescens [shadscale]
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               190   3e-56   Populus euphratica
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  190   3e-56   Mimosa pudica [sensitive-plant]
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   190   3e-56   Populus euphratica
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like          190   3e-56   Oryza brachyantha
dbj|BAF63508.1|  plasma membrane intrinsic protein                      190   3e-56   Potamogeton distinctus
ref|NP_001234625.1|  aquaporin                                          190   3e-56   Solanum lycopersicum
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g             190   4e-56   Populus trichocarpa [western balsam poplar]
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               190   4e-56   Malus domestica [apple tree]
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        191   5e-56   
gb|AAA68701.1|  similar to mipB gene product in Mesembryanthemum ...    189   5e-56   Mesembryanthemum crystallinum
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                190   5e-56   Morus alba var. multicaulis
gb|ACU87558.1|  PIP protein                                             190   5e-56   Gossypium hirsutum [American cotton]
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        189   6e-56   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             189   6e-56   Prunus persica
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             189   6e-56   Phaseolus vulgaris [French bean]
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8               189   7e-56   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                189   7e-56   Populus trichocarpa x Populus deltoides
gb|AAB18228.1|  MipE                                                    189   7e-56   Mesembryanthemum crystallinum
gb|AFB82643.1|  aquaporin                                               189   7e-56   Camellia sinensis [black tea]
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                189   7e-56   Erythranthe guttata [common monkey flower]
ref|XP_010107654.1|  Aquaporin PIP2-7                                   189   7e-56   Morus notabilis
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             189   7e-56   Populus trichocarpa [western balsam poplar]
gb|KHG00060.1|  putative aquaporin PIP2-2                               189   8e-56   Gossypium arboreum [tree cotton]
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               189   8e-56   Camelina sativa [gold-of-pleasure]
emb|CDX76314.1|  BnaA08g10860D                                          189   8e-56   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   189   8e-56   Nelumbo nucifera [Indian lotus]
emb|CAH60720.1|  putative plasma membrane intrinsic protein             189   9e-56   Populus tremula x Populus tremuloides
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               189   9e-56   Camelina sativa [gold-of-pleasure]
gb|KJB56128.1|  hypothetical protein B456_009G107200                    189   9e-56   Gossypium raimondii
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               189   9e-56   Populus euphratica
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   189   1e-55   Fragaria vesca subsp. vesca
gb|KJB11823.1|  hypothetical protein B456_002G2484001                   184   1e-55   Gossypium raimondii
gb|KHG29841.1|  putative aquaporin PIP2-2                               189   1e-55   Gossypium arboreum [tree cotton]
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     189   1e-55   Eucalyptus grandis [rose gum]
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               189   1e-55   Eucalyptus grandis [rose gum]
gb|KHN05685.1|  Aquaporin PIP2-7                                        189   1e-55   Glycine soja [wild soybean]
gb|ABL76066.1|  aquaporin 2                                             188   2e-55   Bruguiera gymnorhiza [Burma mangrove]
sp|P42767.1|PIP1_ATRCA  RecName: Full=Aquaporin PIP-type                188   2e-55   Atriplex canescens [shadscale]
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        188   2e-55   Fragaria vesca subsp. vesca
gb|AGD98708.1|  aquaporin protein 5                                     189   2e-55   Camellia sinensis [black tea]
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   189   2e-55   Cicer arietinum [garbanzo]
gb|KJB11822.1|  hypothetical protein B456_002G2484001                   185   2e-55   Gossypium raimondii
ref|XP_010098191.1|  Aquaporin PIP2-7                                   188   2e-55   Morus notabilis
ref|XP_008447947.1|  PREDICTED: aquaporin PIP2-7                        188   2e-55   Cucumis melo [Oriental melon]
gb|AGD98705.1|  aquaporin                                               188   2e-55   Camellia sinensis [black tea]
gb|EMT32724.1|  Aquaporin PIP2-1                                        184   2e-55   
ref|NP_001274376.1|  aquaporin PIP2-7-like                              188   2e-55   Cucumis sativus [cucumbers]
gb|AAB18227.1|  MipC                                                    188   2e-55   Mesembryanthemum crystallinum
dbj|BAG68661.1|  plasma membrane intrinsic protein                      189   2e-55   Tulipa gesneriana
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          189   2e-55   Sorghum bicolor [broomcorn]
gb|ABO69705.2|  aquaporin PIP2                                          188   2e-55   Prunus humilis
gb|EMT02787.1|  Putative aquaporin PIP2-6                               185   2e-55   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               188   2e-55   Pyrus x bretschneideri [bai li]
gb|AAL49751.1|AF452013_1  aquaporin-like protein                        187   2e-55   Petunia x hybrida [garden petunia]
ref|NP_001280185.1|  aquaporin PIP2-2                                   188   2e-55   Prunus mume [ume]
ref|NP_001240223.1|  prolactin-inducible protein                        188   2e-55   Glycine max [soybeans]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                188   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg             188   2e-55   
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             188   2e-55   Citrus clementina [clementine]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         188   2e-55   Jatropha curcas
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          188   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|ABU94630.1|  putative aquaporin PIP2;2                               188   2e-55   Phaseolus vulgaris [French bean]
gb|EPS67791.1|  hypothetical protein M569_06982                         185   2e-55   Genlisea aurea
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        188   3e-55   Malus domestica [apple tree]
gb|AEQ29857.1|  aquaporin PIP2                                          188   3e-55   Malus prunifolia
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                188   3e-55   Fragaria chiloensis
ref|NP_001059545.1|  Os07g0448800                                       188   3e-55   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        188   3e-55   Pyrus x bretschneideri [bai li]
gb|AGD98714.1|  aquaporin protein 11                                    188   3e-55   Camellia sinensis [black tea]
gb|ADL16407.1|  aquaporin                                               188   3e-55   Dianthus caryophyllus [carnation]
gb|AEY75244.1|  plasma membrane intrinsic protein                       187   3e-55   Malus hupehensis
gb|AAC16545.1|  aquaporin                                               188   4e-55   Oryza sativa [red rice]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   187   4e-55   Nicotiana sylvestris
ref|NP_001289999.1|  aquaporin PIP2-1                                   187   4e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN38765.1|  Aquaporin PIP2-7                                        187   4e-55   Glycine soja [wild soybean]
gb|KJB20285.1|  hypothetical protein B456_003G141600                    189   4e-55   Gossypium raimondii
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        187   4e-55   Glycine max [soybeans]
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               187   4e-55   Camelina sativa [gold-of-pleasure]
gb|AAW80918.1|  putative plasma membrane intrinsic protein              187   5e-55   Astragalus membranaceus
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               187   5e-55   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   187   5e-55   Nelumbo nucifera [Indian lotus]
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               187   5e-55   Beta vulgaris [beet]
gb|ADK25057.1|  plasma membrane intrinsic protein                       187   5e-55   Glycine max [soybeans]
gb|KJB26182.1|  hypothetical protein B456_004G229000                    187   5e-55   Gossypium raimondii
gb|ABK60195.2|  PIP2 protein                                            187   5e-55   Gossypium hirsutum [American cotton]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         187   5e-55   Ricinus communis
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              187   5e-55   
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               187   6e-55   Camelina sativa [gold-of-pleasure]
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          187   6e-55   Gossypium arboreum [tree cotton]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   187   6e-55   Fragaria vesca subsp. vesca
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   187   6e-55   Nicotiana tomentosiformis
gb|AAO86707.1|  aquaporin                                               187   7e-55   Zea mays [maize]
ref|XP_002322877.1|  major intrinsic protein 1                          187   7e-55   Populus trichocarpa [western balsam poplar]
emb|CAB45651.1|  putative plasma membrane intrinsic protein             187   7e-55   Pisum sativum [garden pea]
gb|ACX37450.1|  plasma membrane intrinsic protein                       187   7e-55   Hevea brasiliensis [jebe]
gb|AAC32107.1|  probable aquaporin                                      186   9e-55   Picea mariana [black spruce]
gb|AFQ23186.1|  aquaporin PIP2;1                                        186   1e-54   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AIA83106.1|  putative aquaporin PIP2                                 187   1e-54   Citrus trifoliata [hardy orange]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   187   1e-54   Setaria italica
gb|ABK24156.1|  unknown                                                 186   1e-54   Picea sitchensis
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               186   1e-54   Brachypodium distachyon [annual false brome]
dbj|BAG06230.1|  plasma membrane intrinsic protein                      186   1e-54   Hordeum vulgare [barley]
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               186   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010107541.1|  Aquaporin PIP2-2                                   186   1e-54   Morus notabilis
ref|NP_001105024.1|  aquaporin PIP2-1                                   186   1e-54   Zea mays [maize]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  186   1e-54   Pyrus communis
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        186   1e-54   
gb|ACG32567.1|  aquaporin PIP2.1                                        186   1e-54   Zea mays [maize]
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     186   1e-54   Lilium hybrid cultivar
gb|ABK22173.1|  unknown                                                 186   1e-54   Picea sitchensis
gb|AIA83104.1|  putative aquaporin PIP2                                 186   1e-54   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   186   2e-54   Populus euphratica
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               186   2e-54   Pyrus x bretschneideri [bai li]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          186   2e-54   Gossypium arboreum [tree cotton]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  186   2e-54   Mimosa pudica [sensitive-plant]
gb|KHN32779.1|  Aquaporin PIP2-2                                        184   2e-54   Glycine soja [wild soybean]
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1           186   2e-54   Triticum aestivum [Canadian hard winter wheat]
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  186   2e-54   Mimosa pudica [sensitive-plant]
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    186   2e-54   Spinacia oleracea
gb|ACG39551.1|  aquaporin PIP2.1                                        186   2e-54   Zea mays [maize]
ref|XP_009803290.1|  PREDICTED: probable aquaporin PIP2-4               181   2e-54   Nicotiana sylvestris
gb|ABI96815.1|  plasma membrane intrinsic protein                       186   2e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               186   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009108681.1|  PREDICTED: aquaporin PIP2-7-like                   186   2e-54   Brassica rapa
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             186   2e-54   Elaeis guineensis
ref|XP_010553324.1|  PREDICTED: aquaporin PIP2-2                        183   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          186   2e-54   Amborella trichopoda
gb|AAU43629.1|  putative aquaporin PIP-type                             182   2e-54   Solanum lycopersicum
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        185   3e-54   Cucumis melo [Oriental melon]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             185   3e-54   Phaseolus vulgaris [French bean]
gb|ABB88840.1|  aquaporin                                               185   3e-54   Stevia rebaudiana
ref|NP_001289846.1|  probable aquaporin PIP2-1                          185   3e-54   
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   185   3e-54   Gossypium raimondii
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   185   4e-54   Sesamum indicum [beniseed]
dbj|BAG06231.1|  plasma membrane intrinsic protein                      185   4e-54   Hordeum vulgare [barley]
gb|ACE60220.1|  plasma membrane aquaporin                               185   4e-54   Rosa hybrid cultivar
gb|AFN53630.1|  putative aquaporin PIP2-8                               193   4e-54   Linum usitatissimum
gb|AEF32110.1|  aquaporin PIP2                                          185   4e-54   Hedychium coronarium
ref|XP_004500724.1|  PREDICTED: uncharacterized protein LOC101494283    193   4e-54   Cicer arietinum [garbanzo]
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                185   5e-54   Erythranthe guttata [common monkey flower]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                185   5e-54   Hevea brasiliensis [jebe]
gb|EYU37965.1|  hypothetical protein MIMGU_mgv1a011471mg                184   5e-54   Erythranthe guttata [common monkey flower]
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    184   5e-54   Spinacia oleracea
ref|XP_010933360.1|  PREDICTED: probable aquaporin PIP2-6               184   5e-54   
emb|CDY70391.1|  BnaC03g72010D                                          181   5e-54   Brassica napus [oilseed rape]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    184   6e-54   Gossypium raimondii
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             184   6e-54   Eutrema salsugineum [saltwater cress]
ref|NP_001105638.1|  aquaporin PIP2-2                                   185   6e-54   Zea mays [maize]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                184   6e-54   Theobroma cacao [chocolate]
gb|ACU19125.1|  unknown                                                 184   6e-54   Glycine max [soybeans]
gb|ACF79873.1|  unknown                                                 185   6e-54   Zea mays [maize]
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     184   6e-54   Eucalyptus grandis [rose gum]
dbj|BAF32141.1|  putative aquaporin                                     184   6e-54   Taxodium distichum [bald cypress]
dbj|BAF32042.1|  putative aquaporin                                     184   7e-54   Cryptomeria japonica
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   184   7e-54   Nicotiana tomentosiformis
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          184   7e-54   Gossypium arboreum [tree cotton]
gb|AAY22203.1|  putative aquaporin                                      184   7e-54   Phaseolus vulgaris [French bean]
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   184   7e-54   Nicotiana sylvestris
gb|AEQ20672.1|  PIP2;1                                                  184   8e-54   Karelinia caspia
ref|XP_011088776.1|  PREDICTED: uncharacterized protein LOC105169921    193   8e-54   
gb|AHA84284.1|  prolactin-inducible protein                             184   8e-54   Phaseolus vulgaris [French bean]
gb|AFN53685.1|  putative aquaporin PIP2-8                               192   8e-54   Linum usitatissimum
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         184   8e-54   Ricinus communis
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        184   9e-54   Phoenix dactylifera
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          184   9e-54   Amborella trichopoda
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                184   9e-54   Populus trichocarpa x Populus deltoides
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    184   1e-53   Spinacia oleracea
gb|AHB33479.1|  plasma intrinsic protein 2-3                            184   1e-53   Cucumis sativus [cucumbers]
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   184   1e-53   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   184   1e-53   
gb|ACR56613.1|  plasma intrinsic protein 2;3                            184   1e-53   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             184   1e-53   
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   184   1e-53   
emb|CDP04351.1|  unnamed protein product                                181   1e-53   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    183   1e-53   
gb|AAO39008.1|  plasma intrinsic protein 2,2                            184   1e-53   
emb|CAC82712.1|  major intrinsic protein 1                              184   1e-53   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             184   1e-53   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   184   2e-53   
gb|ABC69040.1|  aquaporin PIP2-1                                        183   2e-53   
gb|ABC70536.1|  aquaporin protein                                       179   2e-53   
ref|XP_003625627.1|  Aquaporin PIP2-1                                   183   2e-53   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             183   2e-53   
gb|ABU94631.1|  putative aquaporin PIP2;3                               183   2e-53   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    183   2e-53   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    183   2e-53   
gb|KHN33668.1|  Aquaporin PIP2-7                                        182   2e-53   
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               183   2e-53   
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               183   2e-53   
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               183   2e-53   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               183   2e-53   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             183   3e-53   
gb|AFQ23181.1|  aquaporin PIP2;2                                        183   3e-53   
emb|CBI31462.3|  unnamed protein product                                180   3e-53   
gb|KHG08488.1|  putative aquaporin PIP2-2                               183   3e-53   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   183   3e-53   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         183   3e-53   
ref|XP_003591907.1|  Aquaporin PIP                                      181   3e-53   
gb|KJB70980.1|  hypothetical protein B456_011G098100                    182   3e-53   
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         182   3e-53   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               182   3e-53   
gb|KJB21561.1|  hypothetical protein B456_004G001400                    182   3e-53   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        182   3e-53   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   182   3e-53   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   182   3e-53   
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    183   3e-53   
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    183   3e-53   
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             183   4e-53   
emb|CDP07111.1|  unnamed protein product                                182   4e-53   
gb|ACU24483.1|  unknown                                                 182   4e-53   
gb|ACU20229.1|  unknown                                                 182   4e-53   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        182   4e-53   
ref|NP_001233846.1|  putative PIP-type aquaporin                        182   4e-53   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   182   4e-53   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        182   4e-53   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   182   4e-53   
gb|ACZ06859.1|  plasma membrane intrinsic protein                       182   4e-53   
gb|AFK33316.1|  unknown                                                 182   4e-53   
gb|ACN40330.1|  unknown                                                 182   4e-53   
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               182   4e-53   
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  182   4e-53   
gb|ACU87557.1|  PIP protein                                             182   5e-53   
emb|CDX88767.1|  BnaA03g08820D                                          181   5e-53   
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  182   5e-53   
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    182   5e-53   
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   182   5e-53   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             182   5e-53   
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   182   5e-53   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   182   5e-53   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   182   5e-53   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               182   5e-53   
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   182   6e-53   
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   182   6e-53   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   182   6e-53   
gb|AAX92685.1|  probable aquaporin                                      179   6e-53   
gb|AAC17529.1|  aquaporin 2                                             182   6e-53   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             182   6e-53   
gb|KHN00691.1|  Aquaporin PIP2-2                                        182   6e-53   
emb|CDY31523.1|  BnaA10g13480D                                          181   6e-53   
ref|NP_001266257.1|  aquaporin PIP2-7-like                              182   6e-53   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   182   6e-53   
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   182   6e-53   
ref|NP_001240039.1|  uncharacterized protein LOC100782155               182   6e-53   
ref|XP_007046620.1|  Plasma membrane intrinsic protein 3 isoform 1      182   7e-53   
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   182   7e-53   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               182   7e-53   
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        182   7e-53   
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             182   7e-53   
dbj|BAO18630.1|  plasmamembrane intrinsic protein 2;8                   182   7e-53   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               182   8e-53   
ref|XP_006359706.1|  PREDICTED: aquaporin PIP2-7-like                   181   8e-53   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         181   8e-53   
ref|XP_002879655.1|  aquaporin                                          181   8e-53   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             181   9e-53   
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   181   9e-53   
gb|AAO39007.1|  plasma intrinsic protein 2,1                            181   9e-53   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   181   9e-53   
gb|ABK23750.1|  unknown                                                 181   1e-52   
gb|AEY75242.1|  plasma membrane intrinsic protein                       181   1e-52   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              181   1e-52   
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   181   1e-52   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             181   1e-52   
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           181   1e-52   
emb|CDX91340.1|  BnaC04g08100D                                          181   1e-52   
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             181   1e-52   
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             181   1e-52   
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   181   1e-52   
gb|ABH09326.1|  putative aquaporin                                      181   1e-52   
emb|CDY46759.1|  BnaA03g17030D                                          181   1e-52   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        181   1e-52   
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  181   1e-52   
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           181   1e-52   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               181   1e-52   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   181   1e-52   
gb|AAD31846.1|AF133530_1  water channel protein MipH                    181   1e-52   
ref|XP_010028741.1|  PREDICTED: uncharacterized protein LOC104418957    189   1e-52   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        181   2e-52   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        181   2e-52   
ref|XP_004149911.1|  PREDICTED: probable aquaporin PIP2-5-like          179   2e-52   
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               181   2e-52   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             181   2e-52   
ref|XP_002971714.1|  hypothetical protein SELMODRAFT_441556             181   2e-52   
gb|ABK93567.1|  unknown                                                 181   2e-52   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               181   2e-52   
gb|AFK47442.1|  unknown                                                 181   2e-52   
ref|NP_200874.1|  putative aquaporin PIP2-4                             181   2e-52   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             181   2e-52   
emb|CDY56697.1|  BnaCnng31040D                                          181   2e-52   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  180   2e-52   
ref|NP_181255.1|  aquaporin PIP2-3                                      180   2e-52   
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        181   2e-52   
gb|ADJ67992.1|  aquaporin                                               180   3e-52   
ref|XP_002316367.1|  putative aquaporin family protein                  180   3e-52   
ref|XP_002991582.1|  hypothetical protein SELMODRAFT_448485             180   3e-52   
emb|CDX91341.1|  BnaC04g08090D                                          180   3e-52   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     182   3e-52   
emb|CDX10333.1|  aquaporin                                              180   3e-52   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              180   3e-52   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    180   3e-52   
emb|CBI32731.3|  unnamed protein product                                176   3e-52   
emb|CDX71032.1|  BnaC03g11160D                                          179   3e-52   
ref|NP_001267922.1|  aquaporin-like                                     180   3e-52   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   180   3e-52   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               180   3e-52   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   180   3e-52   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     180   4e-52   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       180   4e-52   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 180   4e-52   
ref|XP_003591905.1|  Aquaporin PIP                                      180   4e-52   
gb|AIK66515.1|  putative aquaporin                                      180   4e-52   
gb|AFK47400.1|  unknown                                                 180   4e-52   
gb|AAW55294.1|  aquaporin 2                                             177   4e-52   
ref|XP_006581099.1|  PREDICTED: uncharacterized protein LOC100808290    187   4e-52   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  181   4e-52   
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             180   4e-52   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     182   5e-52   
emb|CAN75442.1|  hypothetical protein VITISV_019657                     179   5e-52   
gb|AAV69744.1|  aquaporin                                               179   5e-52   
gb|ABK60196.1|  PIP2 protein                                            179   5e-52   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   179   5e-52   
ref|NP_181254.1|  aquaporin PIP2-2                                      179   6e-52   
ref|XP_006648854.1|  PREDICTED: probable aquaporin PIP2-2-like          179   6e-52   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        179   6e-52   
gb|KJB73803.1|  hypothetical protein B456_011G253400                    178   6e-52   
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         179   6e-52   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              179   6e-52   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        179   6e-52   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   179   6e-52   
ref|NP_191042.1|  putative aquaporin PIP2-5                             179   7e-52   
gb|AAG44947.1|AF290620_1  putative PIP2                                 179   7e-52   
gb|EAY86778.1|  hypothetical protein OsI_08158                          179   7e-52   
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   179   7e-52   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        179   7e-52   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     179   7e-52   
gb|AGG39693.1|  aquaporin protein AQU15                                 179   8e-52   
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   179   8e-52   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             179   8e-52   
ref|NP_001235204.1|  Pip1 protein                                       179   8e-52   
emb|CDY13298.1|  BnaC06g14590D                                          179   8e-52   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               179   9e-52   
gb|AGD98707.1|  aquaporin protein 4                                     179   9e-52   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   179   9e-52   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   179   9e-52   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               179   9e-52   
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        179   1e-51   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               179   1e-51   
ref|NP_001274397.1|  aquaporin PIP2-1-like                              179   1e-51   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    179   1e-51   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               179   1e-51   
gb|KGN47819.1|  hypothetical protein Csa_6G405320                       178   1e-51   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               179   1e-51   
gb|AIG92831.1|  aquaporin PIP2                                          179   1e-51   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   179   1e-51   
ref|XP_006657663.1|  PREDICTED: aquaporin PIP2-5-like                   176   1e-51   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        178   1e-51   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          179   1e-51   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        179   1e-51   
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   177   1e-51   
ref|XP_001753248.1|  predicted protein                                  178   1e-51   
gb|ABX83874.1|  plasma membrane intrinsic protein                       178   1e-51   
emb|CDY14415.1|  BnaC03g21800D                                          178   1e-51   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          178   1e-51   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               178   1e-51   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          178   1e-51   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             178   1e-51   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             178   2e-51   
emb|CDY07519.1|  BnaC06g15450D                                          178   2e-51   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 178   2e-51   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             178   2e-51   
ref|XP_001779900.1|  predicted protein                                  178   2e-51   
emb|CDX67611.1|  BnaA07g16510D                                          178   2e-51   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   178   2e-51   
gb|ACG33001.1|  aquaporin PIP2.2                                        178   2e-51   
gb|ABN11917.1|  aquaporin                                               178   2e-51   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               178   2e-51   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             178   2e-51   
ref|NP_001105026.1|  aquaporin PIP2-4                                   178   2e-51   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   178   2e-51   
gb|AAS65964.1|  aquaporin PIP 2                                         177   2e-51   
ref|NP_001047491.1|  Os02g0629200                                       178   2e-51   
ref|NP_001105025.1|  aquaporin PIP2-3                                   178   2e-51   
ref|XP_008340653.1|  PREDICTED: aquaporin PIP2-1-like                   175   2e-51   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                177   3e-51   
ref|NP_001274386.1|  aquaporin PIP2-1-like                              177   3e-51   
emb|CDY09192.1|  BnaA02g06180D                                          177   3e-51   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    177   3e-51   
gb|AEO13898.1|  aquaporin 7                                             177   3e-51   
gb|EMT33553.1|  hypothetical protein F775_44017                         175   3e-51   
dbj|BAA23744.1|  HvPIP2;1                                               177   3e-51   



>gb|KJB15837.1| hypothetical protein B456_002G198900 [Gossypium raimondii]
Length=211

 Score =   197 bits (502),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  103  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  162

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWDEHWIFWVGPFVGALAAA+YHQYILR +AIKALGSFRSN
Sbjct  163  YNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRAAAIKALGSFRSN  208



>gb|KDO68093.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=212

 Score =   197 bits (501),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  104  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  163

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  164  YNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  209



>tpg|DAA33864.1| TPA_inf: aquaporin PIP2;4 [Gossypium hirsutum]
Length=270

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  162  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  221

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWDEHWIFWVGPFVGALAAA+YHQYILR +AIKALGSFRSN
Sbjct  222  YNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRATAIKALGSFRSN  267



>gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum]
 gb|AIL95755.1| aquaporin [Gossypium hirsutum]
 gb|KJB15834.1| hypothetical protein B456_002G198900 [Gossypium raimondii]
Length=278

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWDEHWIFWVGPFVGALAAA+YHQYILR +AIKALGSFRSN
Sbjct  230  YNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRAAAIKALGSFRSN  275



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWDEHWIFWVGPF+GA AAAVYHQ+ILR  AIKALGSFRSNA
Sbjct  241  YNQDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFRSNA  287



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWDEHWIFWVGPFVGA AAAVYHQYILR  A+KALGSFRSNA
Sbjct  241  YNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKALGSFRSNA  287



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWDEHWIFWVGPFVGA AAAVYHQYILR  A+KALGSFRSNA
Sbjct  241  YNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKALGSFRSNA  287



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+HW+FWVGPF+GALAAAVYHQY+LR +AIKALGSFRSNA
Sbjct  240  YNQDKAWDDHWLFWVGPFIGALAAAVYHQYVLRAAAIKALGSFRSNA  286



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   197 bits (501),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWDEHWIFWVGPF+GA AAAVYHQ+ILR  AIKALGSFRSNA
Sbjct  241  YNHDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFRSNA  287



>ref|XP_011089904.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-7-like [Sesamum 
indicum]
Length=278

 Score =   197 bits (500),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +NDDKAWD+HWIFWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  232  YNDDKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  278



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   197 bits (501),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWDEHWIFWVGPFVGA AAAVYHQYILR  A+KALGSFRSNA
Sbjct  241  YNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKALGSFRSNA  287



>gb|ACB42441.1| aquaporin PIP2;4 [Gossypium hirsutum]
 gb|KHG19165.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=278

 Score =   197 bits (500),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+HWIFWVGPFVGALAAA+YHQYILR +AIKALGSFRSN
Sbjct  230  YNNDKAWDDHWIFWVGPFVGALAAAIYHQYILRAAAIKALGSFRSN  275



>emb|CBI16313.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  90   FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  149

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DKAWD+HW+FWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  150  YNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  196



>gb|ACB71281.1| plasma membrane intrinsic protein [Tamarix hispida]
Length=281

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WDEHWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNDKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_006422584.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 ref|XP_006486723.1| PREDICTED: aquaporin PIP2-7-like [Citrus sinensis]
 gb|ESR35824.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|KDO68090.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=283

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  235  YNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  280



>ref|XP_002306187.1| membrane intrinsic family protein [Populus trichocarpa]
 gb|ABK95359.1| unknown [Populus trichocarpa]
 gb|EEE86698.1| membrane intrinsic family protein [Populus trichocarpa]
Length=279

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  FNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWDEHWIFWVGPF+GA AAA YHQYILR  A+KALGSFRSNA
Sbjct  237  YNQDKAWDEHWIFWVGPFIGAFAAAAYHQYILRAGAVKALGSFRSNA  283



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DK WD+HWIFWVGPFVGAL AA+YHQYILR  AIKALGSFRSNA
Sbjct  241  YNEDKPWDDHWIFWVGPFVGALIAAIYHQYILRAGAIKALGSFRSNA  287



>ref|XP_011046666.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  FNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>emb|CAH60721.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  FNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>dbj|BAA22098.1| unnamed protein product [Arabidopsis thaliana]
Length=193

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PV+APLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  85   FVLVYTVFSATDPKRSARDSHIPVVAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  144

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+ WIFWVGPF+GALAAA YHQYILR SAIKALGSFRSNA
Sbjct  145  YNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNA  191



>ref|XP_010548112.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_010489282.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +NDDKAWD+HWIFWVGPFVGALAAA YHQYILR +AIKAL SFRSN
Sbjct  230  YNDDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFRSN  275



>ref|XP_010690355.1| PREDICTED: aquaporin PIP-type [Beta vulgaris subsp. vulgaris]
Length=281

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FND KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  FNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta vulgaris]
Length=281

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FND KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  FNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   195 bits (495),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WI+WVGPFVGA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea]
Length=278

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WDEHWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNEKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  275



>gb|EAY92738.1| hypothetical protein OsI_14490 [Oryza sativa Indica Group]
Length=141

 Score =   190 bits (482),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  33   FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  92

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N  KAWD+HWIFW GPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  93   YNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFRSN  138



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WI+WVGPFVGA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>gb|KHF98939.1| putative aquaporin PIP2-8 -like protein [Gossypium arboreum]
Length=278

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+HWIFWVGP VGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNDKAWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFRSN  275



>gb|KJB32662.1| hypothetical protein B456_005G254400 [Gossypium raimondii]
Length=278

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+ KAWD+HWIFWVGPFVGA+AAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNGKAWDDHWIFWVGPFVGAVAAAAYHQYILRAAAIKALGSFRSN  275



>gb|ACU87556.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+HWIFWVGP VGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNDKAWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFRSN  275



>gb|AAL49750.1|AF452012_1 aquaporin-like protein [Petunia x hybrida]
Length=283

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  235  YNNDKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  280



>ref|XP_006284279.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
 gb|EOA17177.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
Length=280

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPF+GALAAA+YHQ++LR SAIKALGSFRSNA
Sbjct  232  YNNEKAWDDHWIFWVGPFLGALAAAIYHQFVLRASAIKALGSFRSNA  278



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L   VFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYVVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DKAWDEHWIFWVGPF+GA  AAVYHQYILR  AIKALGSFRSNA
Sbjct  241  FNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILRAGAIKALGSFRSNA  287



>emb|CBI37861.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  90   FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  149

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  150  YNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  195



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L   VFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYVVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DKAWDEHWIFWVGPF+GA  AAVYHQYILR  AIKALGSFRSNA
Sbjct  240  FNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILRAGAIKALGSFRSNA  286



>emb|CAA04654.1| major intrinsic protein PIPC [Craterostigma plantagineum]
Length=198

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  90   FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  149

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN+ KAWD+HWIFWVGPF+GALAAA+YHQYILR  A KALGSFRSN
Sbjct  150  FNNGKAWDDHWIFWVGPFLGALAAAIYHQYILRAQAAKALGSFRSN  195



>ref|XP_010266027.1| PREDICTED: aquaporin PIP2-7-like [Nelumbo nucifera]
Length=280

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN +K WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  FNREKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  277



>ref|XP_010526891.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>emb|CDX72515.1| BnaC07g45370D [Brassica napus]
Length=254

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  146  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  205

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +A+KAL SFRSNA
Sbjct  206  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFRSNA  252



>gb|ACB87734.1| aquaporin [Manihot esculenta]
Length=280

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  YNNDKVWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFRSN  277



>ref|XP_010467415.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +NDDKAW++HWIFWVGPFVGALAAA YHQYILR +AIKAL SFRSN
Sbjct  230  YNDDKAWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFRSN  275



>ref|XP_011092966.1| PREDICTED: aquaporin PIP2-7 [Sesamum indicum]
Length=283

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  235  YNNDKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  280



>ref|XP_006412152.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
 gb|ESQ53605.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
Length=281

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+ KAWD+HWIFWVGPF+GALAAA YHQYILR +AIKALGSFRSNA
Sbjct  233  YNNKKAWDDHWIFWVGPFLGALAAAAYHQYILRAAAIKALGSFRSNA  279



>emb|CDQ12456.1| plasma membrane intrinsic protein 2;1, partial [Vicia faba var. 
minor]
Length=182

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLA IP+TGTGINPARSFG  +I
Sbjct  76   FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLAAIPVTGTGINPARSFGPAVI  135

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WI+WVGPF+GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  136  FNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  182



>ref|XP_009412922.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  174  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DKAWD+HWIFWVGPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNQDKAWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFRSN  279



>ref|XP_009355655.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WDEHWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNDKIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>gb|AAB65787.1| plasma membrane intrinsic protein [Arabidopsis thaliana]
Length=280

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+ WIFWVGPF+GALAAA YHQYILR SAIKALGSFRSNA
Sbjct  232  YNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNA  278



>ref|NP_195236.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 ref|NP_001190920.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 sp|P93004.2|PIP27_ARATH RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; Short=AtPIP2;7; AltName: Full=Plasma 
membrane intrinsic protein 3; AltName: Full=Salt stress-induced 
major intrinsic protein; Contains: RecName: Full=Aquaporin 
PIP2-7, N-terminally processed [Arabidopsis thaliana]
 gb|AAL06563.1|AF412110_1 AT4g35100/M4E13_150 [Arabidopsis thaliana]
 emb|CAA17774.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 emb|CAB80227.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAL32881.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM10142.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM66021.1| plasma membrane intrinsic protein SIMIP [Arabidopsis thaliana]
 dbj|BAH30556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86464.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 gb|AEE86465.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
Length=280

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+ WIFWVGPF+GALAAA YHQYILR SAIKALGSFRSNA
Sbjct  232  YNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNA  278



>gb|ABM54183.1| aquaporin [Jatropha curcas]
 gb|KDP29674.1| hypothetical protein JCGZ_18836 [Jatropha curcas]
Length=280

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGA+AAA YHQYILR +AIKALGSFRSN
Sbjct  232  YNNDKVWDDHWIFWVGPFVGAIAAAAYHQYILRAAAIKALGSFRSN  277



>gb|AAB36949.1| plasma membrane intrinsic protein PIP3 [Arabidopsis thaliana]
Length=280

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+ WIFWVGPF+GALAAA YHQYILR SAIKALGSFRSNA
Sbjct  232  YNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNA  278



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFM HLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMAHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WI+WVGPFVGA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45367.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+ WIFWVGPF+GALAAA YHQYILR SAIKALGSFRSNA
Sbjct  232  YNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNA  278



>ref|XP_007041804.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
 gb|EOX97635.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
Length=278

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  275



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WI+WVGPF+GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>ref|XP_009138343.1| PREDICTED: aquaporin PIP2-7-like [Brassica rapa]
Length=281

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKAL SFRSNA
Sbjct  233  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFRSNA  279



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DKAWD+HW+FWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  234  YNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  280



>ref|XP_006298288.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
 gb|EOA31186.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
Length=278

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +ND KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKAL SFRSN
Sbjct  230  YNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFRSN  275



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWDEHWIFWVGPF+GA  AA YHQ++LR  AIKALGSFRSNA
Sbjct  240  YNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLRAGAIKALGSFRSNA  286



>gb|AFB83067.1| plasma intrinsic protein PIP2.1 [Helianthemum almeriense]
Length=279

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN+ K+WD+HWIFWVGPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  FNNQKSWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFRSN  276



>emb|CDX69112.1| BnaC01g03410D [Brassica napus]
Length=281

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +A+KAL SFRSNA
Sbjct  233  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFRSNA  279



>gb|AAG30607.1|AF314656_1 aquaporin [Brassica oleracea]
Length=281

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +A+KAL SFRSNA
Sbjct  233  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFRSNA  279



>ref|XP_010266854.1| PREDICTED: probable aquaporin PIP2-8 [Nelumbo nucifera]
Length=280

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR  RDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FLLVYTVFSATDPKRKTRDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DKAWD+HWIFWVGPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  YNGDKAWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFRSN  277



>ref|XP_009782764.1| PREDICTED: aquaporin PIP2-7 [Nicotiana sylvestris]
 tpg|DAA64682.1| TPA_exp: aquaporin PIP2 7a [Nicotiana tabacum]
Length=284

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N +K WD+ WIFWVGPFVGAL AAVYHQYILRGSAIKALGSFRSN
Sbjct  236  YNTEKVWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKALGSFRSN  281



>ref|XP_002521292.1| Aquaporin PIP2.7, putative [Ricinus communis]
 emb|CAE53883.1| aquaporin [Ricinus communis]
 gb|EEF41148.1| Aquaporin PIP2.7, putative [Ricinus communis]
Length=280

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGALAAA YHQY+LR + IKALGSFRSN
Sbjct  232  YNNDKVWDDHWIFWVGPFVGALAAAAYHQYVLRAAGIKALGSFRSN  277



>ref|XP_007137341.1| hypothetical protein PHAVU_009G118900g [Phaseolus vulgaris]
 gb|ESW09335.1| hypothetical protein PHAVU_009G118900g [Phaseolus vulgaris]
Length=278

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +ND K WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNDAKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  275



>gb|KJB12139.1| hypothetical protein B456_002G002500 [Gossypium raimondii]
Length=278

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+ WIFWVGP VGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNDKAWDDQWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFRSN  275



>gb|ACU87555.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+ WIFWVGP VGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNDKAWDDQWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFRSN  275



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG+ +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGSAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +ND K WD+ WIFWVGPF+GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  239  YNDGKIWDDQWIFWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  285



>gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia]
Length=280

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +++DK WDEHWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  YDNDKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  277



>ref|NP_179277.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
 sp|Q9ZVX8.1|PIP28_ARATH RecName: Full=Probable aquaporin PIP2-8; AltName: Full=Plasma 
membrane intrinsic protein 2-8; Short=AtPIP2;8; AltName: Full=Plasma 
membrane intrinsic protein 3b; Short=PIP3b [Arabidopsis 
thaliana]
 gb|AAC64216.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAM15086.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAO63278.1| At2g16850 [Arabidopsis thaliana]
 dbj|BAF00056.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC06543.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
Length=278

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKAL SFRSN
Sbjct  230  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFRSN  275



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DKAWD+HWIFWVGPF+GA  AA+YHQY+LR +A+KALGSFRS++
Sbjct  237  YNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_010432340.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
 ref|XP_010437523.1| PREDICTED: aquaporin PIP2-7 isoform X1 [Camelina sativa]
 ref|XP_010437524.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010437525.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010446981.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
Length=280

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+ WIFWVGPF+GALAAA+YHQ++LR SAIKALGSFRSNA
Sbjct  232  YNNEKAWDDQWIFWVGPFLGALAAAIYHQFVLRASAIKALGSFRSNA  278



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DKAWD+HWIFWVGPF+GA  AA+YHQY+LR +A+KALGSFRS++
Sbjct  237  YNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_010920097.1| PREDICTED: probable aquaporin PIP2-6 [Elaeis guineensis]
Length=282

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N  KAWD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNQGKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  279



>gb|ACM50914.1| aquaporin [Medicago falcata]
Length=287

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++KAWD+ WI+WVGPF+GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  241  FNNEKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>ref|XP_004290727.1| PREDICTED: aquaporin PIP2-7 [Fragaria vesca subsp. vesca]
Length=281

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WDEHWIFWVGPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNEKVWDEHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_009615212.1| PREDICTED: aquaporin PIP2-7 [Nicotiana tomentosiformis]
 tpg|DAA64683.1| TPA_exp: aquaporin PIP2 7b [Nicotiana tabacum]
Length=284

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N +K WD+ WIFWVGPFVGAL AAVYHQYILRGSAIKALGSFRSN
Sbjct  236  YNTEKIWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKALGSFRSN  281



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DKAWD+HWIFWVGPF+GA  AA+YHQY+LR +A+KALGSFRS++
Sbjct  237  YNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_009389186.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=281

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DK WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNQDKPWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_009400343.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  174  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DK WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNQDKPWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  279



>gb|ACR56615.1| plasma intrinsic protein 2;5 [Juglans regia]
Length=281

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +++DK WDEHWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YDNDKIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L   VFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYVVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAW+EHWIFWVGPF+GA AAA YHQYILR  A+KALGSFRSNA
Sbjct  236  YNQDKAWNEHWIFWVGPFIGAFAAAAYHQYILRAGAVKALGSFRSNA  282



>ref|XP_008809438.1| PREDICTED: probable aquaporin PIP2-6 [Phoenix dactylifera]
Length=282

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHL TIPITGTGINPARS G  +I
Sbjct  174  FLLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLGTIPITGTGINPARSLGPAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN DKAWD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  FNQDKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  279



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++KAWD+ WI+WVGPF+GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  241  FNNEKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>gb|AAL32127.1| aquaporin [Medicago truncatula]
Length=287

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++KAWD+ WI+WVGPF+GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  241  FNNEKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>gb|ACV66986.1| plasma membrane aquaporin 2 [Hevea brasiliensis]
Length=278

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DKAWD+H IFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  230  YNNDKAWDDHRIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  275



>gb|KFK36762.1| hypothetical protein AALP_AA4G166800 [Arabis alpina]
Length=278

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKA+ SFRSN
Sbjct  230  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAIASFRSN  275



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN +KAWD+ WIFWVGPF+GA  AA+YHQY+LR  AIKALGSFRSNA
Sbjct  237  FNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFRSNA  283



>gb|KFK30134.1| hypothetical protein AALP_AA7G221400 [Arabis alpina]
Length=282

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+ WIFWVGPF+GALAAA YHQYILR +A+KALGSFRSNA
Sbjct  234  YNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAAAVKALGSFRSNA  280



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN +KAWD+ WIFWVGPF+GA  AA+YHQY+LR  AIKALGSFRSNA
Sbjct  237  FNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFRSNA  283



>ref|NP_001267957.1| aquaporin PIP2;2 [Vitis vinifera]
 gb|AEZ35023.1| plasma membrane 2;2 aquaporin [Vitis vinifera]
Length=279

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  YNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>gb|AFO63679.1| plasma intrinsic protein 2 [Eriobotrya japonica]
Length=281

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>gb|ABH09327.1| putative aquaporin [Vitis vinifera]
 gb|ABN14351.1| aquaporin PIP2;2 [Vitis vinifera]
 emb|CAN77349.1| hypothetical protein VITISV_007541 [Vitis vinifera]
Length=279

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  YNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>gb|AAF71820.1|AF141900_1 putative aquaporin PIP2-2 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=279

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  YNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGPFVGA  AA YHQYILR +AIKALGSFRSNA
Sbjct  240  YNKDKAWDDQWIFWVGPFVGAAIAAFYHQYILRAAAIKALGSFRSNA  286



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN  KAWD+HWIFWVGPFVGA  AA YHQ+ILR +AIKALGSFRSNA
Sbjct  239  FNQSKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSNA  285



>emb|CAB61749.1| putative water channel protein [Cicer arietinum]
Length=237

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG+ +I
Sbjct  131  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGSAVI  190

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+ K WD+ WIFWVGP +GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  191  YNEGKIWDDQWIFWVGPIIGATVAAIYHQYILRGSAIKALGSFRSNA  237



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+HWIFWVGPF+GA  AA+YHQY+LR +A+KALGSFRS++
Sbjct  237  YNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|AAL33586.1|AF440272_1 aquaporin [Nicotiana tabacum]
Length=284

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR+FGA +I
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARTFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N +K WD+ WIFWVGPFVGAL AAVYHQYILRGSAIKALGSFRSN
Sbjct  236  YNTEKIWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKALGSFRSN  281



>ref|XP_003604054.1| Aquaporin PIP22 [Medicago truncatula]
 gb|AES74305.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=279

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN+ K WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  FNNAKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>ref|XP_006664813.1| PREDICTED: probable aquaporin PIP2-6-like [Oryza brachyantha]
Length=276

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  168  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  227

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N  KAWD+HWIFW GPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  228  YNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFRSN  273



>dbj|BAD90697.1| plasma membrane intrinsic protein 2;1 [Mimosa pudica]
Length=287

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N  KAWD+HWIFWVGP +GALAAA+YHQYILR +AIKALGSFRSN
Sbjct  241  YNGSKAWDDHWIFWVGPAIGALAAAIYHQYILRAAAIKALGSFRSN  286



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+HWIFWVGPF+GA  AA+YHQY+LR +A+KALGSFRS++
Sbjct  237  YNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|NP_001052292.1| Os04g0233400 [Oryza sativa Japonica Group]
 sp|Q7XLR1.2|PIP26_ORYSJ RecName: Full=Probable aquaporin PIP2-6; AltName: Full=OsPIP2;6; 
AltName: Full=Plasma membrane intrinsic protein 2-6 [Oryza 
sativa Japonica Group]
 emb|CAE05002.2| OSJNBb0093G06.10 [Oryza sativa Japonica Group]
 dbj|BAF14206.1| Os04g0233400 [Oryza sativa Japonica Group]
 gb|EAY92739.1| hypothetical protein OsI_14491 [Oryza sativa Indica Group]
 dbj|BAG87850.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87963.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95414.1| unnamed protein product [Oryza sativa Japonica Group]
Length=282

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N  KAWD+HWIFW GPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFRSN  279



>ref|XP_002884019.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60278.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
Length=278

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++KAWD+HWIFWVGPF+GALAAA YHQYILR +AIKAL SFRSN
Sbjct  230  YNNEKAWDDHWIFWVGPFLGALAAAAYHQYILRAAAIKALASFRSN  275



>ref|XP_009105909.1| PREDICTED: aquaporin PIP2-7 [Brassica rapa]
 emb|CDY52648.1| BnaAnng11630D [Brassica napus]
Length=281

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +A+KAL SFRS+A
Sbjct  233  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFRSSA  279



>emb|CDY17511.1| BnaC03g65520D [Brassica napus]
Length=281

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPFVGALAAA YHQYILR +A+KAL SFRS+A
Sbjct  233  YNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFRSSA  279



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++KAWD+HWIFWVGPF+GA  AA+YHQ++LR  AIKALGSFRSNA
Sbjct  236  FNNEKAWDDHWIFWVGPFIGAAIAAIYHQFVLRAGAIKALGSFRSNA  282



>gb|AEY75254.1| aquaporin [Atriplex canescens]
Length=282

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  24   GYWFGCRDNRYFRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  203
            G  FG      F L  TVFSATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIPITGTGI
Sbjct  163  GTAFGAELLGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGI  222

Query  204  NPARSFGAVLIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            NPARSFGA +I+N+ K WD+HWIFWVGPFVGALAAA YHQY+LR +AIKALGSFRSN
Sbjct  223  NPARSFGAAVIYNNKKVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKALGSFRSN  279



>ref|XP_011045923.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
             ND KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRS+
Sbjct  231  INDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSH  276



>dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pudica]
Length=281

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSA DPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSAIDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+ KAWD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNGKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+HWIFWVGPF+GA  AA+YHQY+LR +A+KALGSFRS++
Sbjct  237  YNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_006664814.1| PREDICTED: probable aquaporin PIP2-6-like [Oryza brachyantha]
Length=282

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N  KAWD+HWIFW GPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFRSN  279



>dbj|BAF63508.1| plasma membrane intrinsic protein [Potamogeton distinctus]
Length=280

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDP+R+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPERSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DK WD+HWIFWVGPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  YNKDKPWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFRSN  277



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DKAWDEHWIFWVGPF+GA  AA YHQ++LR  AIKALGSFRS A
Sbjct  234  FNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLRAGAIKALGSFRSTA  280



>ref|XP_002312952.1| hypothetical protein POPTR_0009s13890g [Populus trichocarpa]
 gb|ABK94564.1| unknown [Populus trichocarpa]
 gb|EEE86907.1| hypothetical protein POPTR_0009s13890g [Populus trichocarpa]
Length=279

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
             ND KAWD+HWIFWVGPFVGALAAA YHQYILR  AIKALGSFRS+
Sbjct  231  INDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAGAIKALGSFRSH  276



>ref|XP_008377729.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGALAAA YHQYILR +A+KALGSFRSN
Sbjct  233  YNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAALKALGSFRSN  278



>ref|XP_003522619.2| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=322

 Score =   191 bits (485),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  214  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  273

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+ K WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  274  YNNGKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  319



>gb|AAA68701.1| similar to mipB gene product in Mesembryanthemum crystallinum, 
encoded by Genbank Accession Number L36097; MIP homolog; Method: 
conceptual translation supplied by author, partial [Mesembryanthemum 
crystallinum]
Length=252

 Score =   189 bits (479),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  72   TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLIFNDDK  251
            TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +IFN  K
Sbjct  149  TVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNSKK  208

Query  252  AWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
             WD+HWIFWVGP VGALAAA YHQYILR +AIKALGSFRSN
Sbjct  209  NWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFRSN  249



>gb|AHZ08398.1| phosphatidylinosital biphosphate protein [Morus alba var. multicaulis]
Length=282

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKR+ARDSH+PVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFAATDPKRSARDSHIPVLAPLPIGFAVFVVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  279



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ W+FWVGPF+GA  AA+YHQYILR  A+KALGSFRSNA
Sbjct  236  YNKDKAWDDQWMFWVGPFIGAAIAAIYHQYILRAGAMKALGSFRSNA  282



>ref|XP_008236033.1| PREDICTED: aquaporin PIP2-7 [Prunus mume]
Length=281

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN+ KAWD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  FNNKKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_007205689.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
 gb|EMJ06888.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
Length=281

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA+YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFRSNA  281



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WI+WVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFIGAAVAAFYHQYILRAAAIKALGSFRSNA  287



>ref|XP_008382110.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNEKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>gb|ACU00102.1| plasma membrane intrinsic protein PIP2.6 [Populus trichocarpa 
x Populus deltoides]
Length=279

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLAT+PITGTGINPARSF A +I
Sbjct  171  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATVPITGTGINPARSFXAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN++KAWD+HWIFWVGPFVGALAAA YHQYILR +AI ALGSFRSN
Sbjct  231  FNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIXALGSFRSN  276



>gb|AAB18228.1| MipE [Mesembryanthemum crystallinum]
Length=284

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN  K WD+HWIFWVGP VGALAAA YHQYILR +AIKALGSFRSN
Sbjct  236  FNSKKNWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFRSN  281



>gb|AFB82643.1| aquaporin [Camellia sinensis]
Length=279

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+   WDEHWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  231  YNNKHIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  276



>gb|EYU40445.1| hypothetical protein MIMGU_mgv1a011413mg [Erythranthe guttata]
Length=282

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN+ K WD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  FNNGKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  279



>ref|XP_010107654.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXC16565.1| Aquaporin PIP2-7 [Morus notabilis]
Length=282

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKR+ARDSH+PVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFAATDPKRSARDSHIPVLAPLPIGFAVFVVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  279



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  178  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  237

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN  KAWD+HW+FWVGPF+GA  AA YHQ+ILR +AIKALGSFRSNA
Sbjct  238  FNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKALGSFRSNA  284



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  183  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  242

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA AAA YHQYILR +AIKALGSFRSNA
Sbjct  243  YNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_010516059.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  170  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  229

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +ND K+WD+HWIFWVGPFVGALAA  YHQYILR +AIKAL SFRSN
Sbjct  230  YNDKKSWDDHWIFWVGPFVGALAARAYHQYILRAAAIKALASFRSN  275



>emb|CDX76314.1| BnaA08g10860D [Brassica napus]
Length=281

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+HWIFWVGPFVGALAAA YHQYILR +A+KAL SFRS+A
Sbjct  233  YNHEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFRSSA  279



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DKAWD+HWIFWVGPF GA  AA+YHQYILR +AIKALGSFRSN
Sbjct  239  YNKDKAWDDHWIFWVGPFTGAALAALYHQYILRAAAIKALGSFRSN  284



>emb|CAH60720.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  171  FVLVNTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  230

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
             ND KAWD+HWIFWVGPFVGALAAA YHQYILR  AIKALGSFRS+
Sbjct  231  INDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAGAIKALGSFRSH  276



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGP +GA AAA+YHQ+ILR +AIKALGSFRSNA
Sbjct  239  YNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSNA  285



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  183  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  242

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA AAA YHQYILR +AIKALGSFRSNA
Sbjct  243  YNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  178  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  237

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN  KAWD+HW+FWVGPF+GA  AA YHQ+ILR +AIKALGSFRSNA
Sbjct  238  FNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKALGSFRSNA  284



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPF+GA  AA+YHQYILR  A+KALGSFRS++
Sbjct  239  YNNEKAWDDHWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSSS  285



>gb|KJB11823.1| hypothetical protein B456_002G2484001, partial [Gossypium raimondii]
Length=143

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA ++
Sbjct  35   FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  94

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DK WD+HWIFWVGP +GA  AA+YHQYILR  A KALGSFRS++
Sbjct  95   FNQDKPWDDHWIFWVGPLIGAAIAAIYHQYILRAGAAKALGSFRSSS  141



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  185  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  244

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  245  YNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  291



>gb|KCW55551.1| hypothetical protein EUGRSUZ_I01429 [Eucalyptus grandis]
Length=281

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+ K WD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNGKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  178  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  237

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ W+FWVGPF+GA  AA YHQYILR  A+KALGSFRSNA
Sbjct  238  YNKDKAWDDQWMFWVGPFIGAAIAAFYHQYILRAGAVKALGSFRSNA  284



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DK WD+ WIFWVGP VGA  AA YHQYILR +AIKALGSFRSNA
Sbjct  240  YNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>gb|ABL76066.1| aquaporin 2 [Bruguiera gymnorhiza]
Length=280

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
             N+DK WD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  HNNDKIWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  277



>sp|P42767.1|PIP1_ATRCA RecName: Full=Aquaporin PIP-type [Atriplex canescens]
 gb|AAA86991.1| aquaporin [Atriplex canescens]
Length=282

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  24   GYWFGCRDNRYFRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  203
            G  FG      F L  TVFSATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIPITGTGI
Sbjct  163  GTAFGAELIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGI  222

Query  204  NPARSFGAVLIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            NPARSFGA +I+N  + WD+HWIFWVGPFVGALAAA YHQY+LR +AIKALGSFRSN
Sbjct  223  NPARSFGAAVIYNKKRVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKALGSFRSN  279



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+HW+FW+GPF+GA  AA YHQ++LR  AIKALGSFRSNA
Sbjct  235  YNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRAGAIKALGSFRSNA  281



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N  KAWD+HWIFWVGPFVGA+ AA YHQ+ILR +AIKALGSFRSNA
Sbjct  239  YNQKKAWDDHWIFWVGPFVGAVIAAFYHQFILRAAAIKALGSFRSNA  285



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG+ +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGSAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+ K WD+ WIFWVGP +GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  239  YNEGKIWDDQWIFWVGPIIGATVAAIYHQYILRGSAIKALGSFRSNA  285



>gb|KJB11822.1| hypothetical protein B456_002G2484001, partial [Gossypium raimondii]
Length=184

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA ++
Sbjct  76   FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  135

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DK WD+HWIFWVGP +GA  AA+YHQYILR  A KALGSFRS++
Sbjct  136  FNQDKPWDDHWIFWVGPLIGAAIAAIYHQYILRAGAAKALGSFRSSS  182



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DKAWD+ WIFWVGPF+GA  AA YHQYILR  AIKALGSFRS A
Sbjct  235  YNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAIKALGSFRSTA  281



>ref|XP_008447947.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=280

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N +K W++HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  YNREKPWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  277



>gb|AGD98705.1| aquaporin [Camellia sinensis]
Length=283

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+ K W +HWIFWVGPFVGA+AAA YHQYILR +AIKALGSFRSN
Sbjct  235  YNNKKVWGQHWIFWVGPFVGAMAAAAYHQYILRAAAIKALGSFRSN  280



>gb|EMT32724.1| Aquaporin PIP2-1 [Aegilops tauschii]
Length=143

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  37   FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  96

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGP +GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  97   YNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFRSNA  143



>ref|NP_001274376.1| aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33481.1| plasma intrinsic protein 2-5 [Cucumis sativus]
 gb|KGN43259.1| hypothetical protein Csa_7G014450 [Cucumis sativus]
Length=280

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N +K W++HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  232  YNREKPWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  277



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N  KAWD+HWIFWVGPF+GA  AA YHQYILR +AIKALGSFRS+A
Sbjct  241  YNQQKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSSA  287



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  182  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  241

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGPF+GA  AA YHQY+LR  AIKALGSFRSNA
Sbjct  242  YNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAIKALGSFRSNA  288



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGPFVGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  YNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA+YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFRSNA  281



>gb|EMT02787.1| Putative aquaporin PIP2-6 [Aegilops tauschii]
Length=177

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  69   FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  128

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N   AWD HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRS+
Sbjct  129  YNKKAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSS  174



>ref|XP_009376943.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WD+HWIFWVGPFVGAL AA YHQYILR +AIKALGSFRSN
Sbjct  233  YNNEKVWDDHWIFWVGPFVGALGAAAYHQYILRAAAIKALGSFRSN  278



>gb|AAL49751.1|AF452013_1 aquaporin-like protein [Petunia x hybrida]
Length=256

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  148  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  207

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DKAWD+ WIFWVGPF+GAL AA+YHQ++LR  A+KALGSFRSN
Sbjct  208  YNQDKAWDDQWIFWVGPFIGALIAALYHQFVLRAGAVKALGSFRSN  253



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA+YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFRSNA  281



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DK WD+ WIFWVGP VGA  AA YHQYILR +AIKALGSFRSNA
Sbjct  240  YNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WIFWVGPFVGA  AA YHQ+ILR +AIKALGSFRS+A
Sbjct  240  FNNDKAWDDQWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSHA  286



>ref|XP_007200557.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
 gb|EMJ01756.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
Length=281

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFG  +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGPAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN++KAWD+ WIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  233  FNNEKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  278



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  183  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  242

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  243  YNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  289



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGPF+GA  AA+YHQYILR  A+KALGSFRS +
Sbjct  236  YNKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKALGSFRSTS  282



>gb|EAZ39662.1| hypothetical protein OsJ_24090 [Oryza sativa Japonica Group]
Length=290

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++KAW  HWIFWVGPFVGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  FNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>gb|ABU94630.1| putative aquaporin PIP2;2 [Phaseolus vulgaris]
Length=287

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN+DKAWD+ WI+WVGPF+GA  AA YHQYILR +AIK LGSFRSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFIGAAVAAFYHQYILRAAAIKVLGSFRSNA  287



>gb|EPS67791.1| hypothetical protein M569_06982, partial [Genlisea aurea]
Length=182

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +3

Query  18   T*GYWFGCRDNRYFRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGT  197
            T G   G      F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGT
Sbjct  65   TKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGT  124

Query  198  GINPARSFGAVLIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRS  371
            GINPARSFGA ++FN  K WDEHWIFWVGP +GALAAA+YHQ++LR  AIKALGSFRS
Sbjct  125  GINPARSFGAAVVFNSQKIWDEHWIFWVGPLIGALAAAIYHQFVLRAGAIKALGSFRS  182



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|ADJ57599.1| plasma membrane intrinsic protein PIP2;1 [Fragaria chiloensis]
Length=284

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  178  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  237

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+HW+FW+GPF+GA  AA YHQ++LR  AIKALGSFRSNA
Sbjct  238  YNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRAGAIKALGSFRSNA  284



>ref|NP_001059545.1| Os07g0448800 [Oryza sativa Japonica Group]
 sp|Q8H5N9.1|PIP21_ORYSJ RecName: Full=Probable aquaporin PIP2-1; AltName: Full=OsPIP2;1; 
AltName: Full=Plasma membrane intrinsic protein 2-1; AltName: 
Full=Plasma membrane intrinsic protein 2a; Short=PIP2a 
[Oryza sativa Japonica Group]
 dbj|BAC15868.1| plasma membrane intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAF21459.1| Os07g0448800 [Oryza sativa Japonica Group]
 gb|EAZ03715.1| hypothetical protein OsI_25848 [Oryza sativa Indica Group]
 dbj|BAG96349.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93010.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99732.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++KAW  HWIFWVGPFVGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  FNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  182  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  241

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  242  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  288



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N  KAWD+HWIFWVGPFVGA  AA YHQ+ILR +AIKALGSFRSNA
Sbjct  241  YNQKKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSNA  287



>gb|ADL16407.1| aquaporin [Dianthus caryophyllus]
 gb|AFC90119.1| pip2 [Dianthus caryophyllus]
Length=285

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+ K WD+ WIFWVGPF+GALAAA YHQYILR +AIKALGSFRSN
Sbjct  237  YNNKKIWDDQWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFRSN  282



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|AAC16545.1| aquaporin [Oryza sativa]
Length=290

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++KAW  HWIFWVGPFVGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  FNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +  +KAWD+ WIFWVGPF+GA  AA+YHQYILR  A+KALGSFRSNA
Sbjct  239  YGKEKAWDDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSNA  285



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  182  FVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  241

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++K+W+EHWIFWVGPFVGA  AA YHQYILR  AIKALGSFRS+A
Sbjct  242  FNEEKSWNEHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSSA  288



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+ WIFWVGP VGA  AA YHQYILR +AIKALGSFRSNA
Sbjct  240  YNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  214  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  273

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  274  YNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  320



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+ WIFWVGP VGA  AA YHQYILR +AIKALGSFRSNA
Sbjct  240  YNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGP +GA AAA+YHQ+ILR +AIKALGSFRS+A
Sbjct  240  YNQEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSSA  286



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGPFVGA  AA YHQ++LR +AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAAAIKALGSFRSNA  281



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  235  YNXDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN DKAW +HWIFWVGPF+GA  AA YHQYILR +AIKALGSFRSN
Sbjct  239  FNKDKAWHDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSN  284



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  182  FVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  241

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN++K+W+EHWIFWVGPFVGA  AA YHQYILR  AIKALGSFRS+A
Sbjct  242  FNEEKSWNEHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSSA  288



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DK WD+ WIFWVGP VGA  AA YHQYILR +AIKALGSF+SNA
Sbjct  240  YNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFKSNA  286



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ W+FWVGPF+GA  AA YHQYILR  A+KALGSFRSNA
Sbjct  236  YNKDKAWDDQWMFWVGPFIGAAIAANYHQYILRAGAMKALGSFRSNA  282



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA ++
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DK WD+HWIFWVGPF+GA  AA+YHQYILR  A KALGSFRS++
Sbjct  237  FNQDKPWDDHWIFWVGPFIGAAIAAIYHQYILRAGAAKALGSFRSSS  283



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  241  YNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  287



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  183  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  242

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  243  YNREKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGP +GA AAA+YHQ+ILR +AIKALGSFRS+A
Sbjct  240  YNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSSA  286



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGPF+GA  AA+YHQ+ILR +A+KALGSFRS++
Sbjct  237  YNQDKPWDDHWIFWVGPFIGAAIAAIYHQFILRAAAVKALGSFRSSS  283



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KAWD+HWIFWVGPF+GA  AA+YHQYILR  A+KALGSFRS++
Sbjct  236  YNNEKAWDDHWIFWVGPFIGAAIAAMYHQYILRAGAVKALGSFRSSS  282



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +  DKAWD+ WIFWVGP +GA  AA+YHQYILR  A+KALGSFRSNA
Sbjct  239  YGKDKAWDDQWIFWVGPLIGAAIAALYHQYILRAGAVKALGSFRSNA  285



>gb|AAO86707.1| aquaporin [Zea mays]
Length=290

 Score =   187 bits (475),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  24   GYWFGCRDNRYFRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  203
            G  FG      F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGI
Sbjct  173  GTGFGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGI  232

Query  204  NPARSFGAVLIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            NPARS GA +I+N DK WD+HWIFWVGP VGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  233  NPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN +KAWD+HWIFWVGPF+GA  AA+YHQ+ILR +A+K+LGSFRS+
Sbjct  237  FNKEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFRSS  282



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG+ +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGSAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
             N  K WD+ W+FWVGP +GA  AA+YHQYILRGSAIKALGSFRSNA
Sbjct  239  LNQGKIWDDQWVFWVGPIIGATVAAIYHQYILRGSAIKALGSFRSNA  285



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   187 bits (475),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGPF+GA  AA YHQYILR +A+KALGSFRS +
Sbjct  240  YNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAVKALGSFRSTS  286



>gb|AAC32107.1| probable aquaporin [Picea mariana]
Length=282

 Score =   186 bits (473),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +   K WDEHWIFWVGPF+GA  AA YHQYILR  AIKALGSFRSN
Sbjct  234  YGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILRAGAIKALGSFRSN  279



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +  DKAWD+ WIFWVGPFVGA  AA+YHQYILR  AIKALGSFRSN
Sbjct  240  YGADKAWDDQWIFWVGPFVGAAIAALYHQYILRAGAIKALGSFRSN  285



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  186  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  245

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WI WVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  246  YNKEKAWDDQWILWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  292



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA +I
Sbjct  183  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  242

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGPF GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  243  YNKDKPWDDHWIFWVGPFAGAAIAAFYHQYILRAGAIKALGSFRSNA  289



>gb|ABK24156.1| unknown [Picea sitchensis]
Length=282

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +   K WDEHWIFWVGPF+GA  AA YHQYILR  AIKALGSFRSN
Sbjct  234  YGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILRAGAIKALGSFRSN  279



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DKAWD+ WIFWVGP VGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  FNKDKAWDDQWIFWVGPMVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>dbj|BAG06230.1| plasma membrane intrinsic protein [Hordeum vulgare]
Length=284

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N   AWD HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRS+
Sbjct  236  YNKKAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSS  281



>ref|XP_009414435.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  24   GYWFGCRDNRYFRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  203
            G  FG      F L  TV SATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI
Sbjct  163  GTAFGAESIGTFVLVYTVLSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGI  222

Query  204  NPARSFGAVLIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            NPARSFGA +I+N  K W +HWIFWVGPFVGALAAAVYHQY+LR +A+KALGSFRS+
Sbjct  223  NPARSFGAAVIYNQHKPWHDHWIFWVGPFVGALAAAVYHQYVLRAAALKALGSFRSS  279



>ref|XP_010107541.1| Aquaporin PIP2-2 [Morus notabilis]
 gb|EXC16223.1| Aquaporin PIP2-2 [Morus notabilis]
Length=286

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  178  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  237

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGPF+GA  AA+YHQYILR +A+KALGSFRS++
Sbjct  238  YNKDKPWDDHWIFWVGPFIGAAIAALYHQYILRAAAVKALGSFRSSS  284



>ref|NP_001105024.1| aquaporin PIP2-1 [Zea mays]
 sp|Q84RL7.2|PIP21_MAIZE RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; AltName: Full=ZmPIP2-1; AltName: Full=ZmPIP2;1 
[Zea mays]
 gb|AAK26758.1| plasma membrane integral protein ZmPIP2-1 [Zea mays]
 gb|ACF78965.1| unknown [Zea mays]
 gb|ACF84592.1| unknown [Zea mays]
 gb|ACF86144.1| unknown [Zea mays]
 gb|ACG31774.1| aquaporin PIP2.1 [Zea mays]
 tpg|DAA60473.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=290

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGP VGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  YNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG  +I
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN+DKAWD+ WI+WVGPFVGA  AA YHQYILR +AIKALGSFRSN
Sbjct  241  FNNDKAWDDQWIYWVGPFVGAAVAAFYHQYILRAAAIKALGSFRSN  286



>gb|ACG32567.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGP VGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  YNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  182  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  241

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N  KAWD+ WIFWVGPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  242  YNKSKAWDDQWIFWVGPFIGAAIAAGYHQYILRAGAIKALGSFRSNA  288



>gb|ABK22173.1| unknown [Picea sitchensis]
Length=282

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +   K WDEHWIFWVGPF+GA  AA YHQYILR  AIKALGSFRSN
Sbjct  234  YGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILRAGAIKALGSFRSN  279



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPI GTGINPARSFGA +I
Sbjct  184  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPIIGTGINPARSFGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +KAWD+ WIFWVGPF+GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  244  YNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  290



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N +KAWD+HWIFWVGPF+GA  AA+YHQ+ILR +A+K+LGSFRS+
Sbjct  237  YNKEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFRSS  282



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GA +I
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFW+GPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA ++
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DK WD+HWIFWVGPF+GA  AA+YH+YILR  A KALGSFRS++
Sbjct  237  FNQDKPWDDHWIFWVGPFIGAAIAAIYHEYILRAGAAKALGSFRSSS  283



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN  KAWD+HWIFWVGPF+GA  AA YHQ+ILR  A KALGSFRSN
Sbjct  240  FNQQKAWDKHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  285



>gb|KHN32779.1| Aquaporin PIP2-2 [Glycine soja]
Length=239

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA ++
Sbjct  131  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVM  190

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N  KAWD+HWIFWVGPF+GA  AA YHQ+ILR SA KALGSFRSN
Sbjct  191  YNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRASAAKALGSFRSN  236



>gb|AAF61463.1|AF139814_1 plasma membrane intrinsic protein 1 [Triticum aestivum]
Length=290

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  42   RDNRYFRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSF  221
            R +  F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 
Sbjct  179  RSSGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSL  238

Query  222  GAVLIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            GA +I+N DKAWD+ WIFWVGP +GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  239  GAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>dbj|BAD90698.1| plasma membrane intrinsic protein 2;2 [Mimosa pudica]
Length=286

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  180  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  239

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGP +GA  AA+YHQ+ILR +AIKALGSFRSNA
Sbjct  240  YNKDKIWDDHWIFWVGPAIGAAVAAIYHQHILRATAIKALGSFRSNA  286



>pdb|2B5F|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
 pdb|2B5F|B Chain B, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
 pdb|2B5F|C Chain C, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
 pdb|2B5F|D Chain D, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
Length=303

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN +K WD+ WIFWVGPF+GA  AA YHQY+LR +AIKALGSFRSN
Sbjct  233  FNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLRAAAIKALGSFRSN  278



>gb|ACG39551.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DK WD+HWIFWVGP VGA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  YNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>ref|XP_009803290.1| PREDICTED: probable aquaporin PIP2-4, partial [Nicotiana sylvestris]
Length=139

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  33   FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  92

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +  +KAWD+ WIFWVGPF+GA  AA YHQ+ILR  A+KALGSFRSNA
Sbjct  93   YGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  139



>gb|ABI96815.1| plasma membrane intrinsic protein [Triticum aestivum]
 gb|ABW34454.1| aquaporin 2.1 [Triticum turgidum]
 gb|EMS62706.1| putative aquaporin PIP2-6 [Triticum urartu]
Length=284

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N   AWD HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRS+
Sbjct  236  YNKKAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSS  281



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  182  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  241

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGP +GA  AA YHQYILR  A+KALGSFRSNA
Sbjct  242  YNKDKAWDDQWIFWVGPLIGAAIAAAYHQYILRAGAVKALGSFRSNA  288



>ref|XP_009108681.1| PREDICTED: aquaporin PIP2-7-like [Brassica rapa]
Length=281

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N++KA D+HWIFWVGPFVGALAAA YHQYILR +A+KAL SFRS+A
Sbjct  233  YNNEKARDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFRSSA  279



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS G  +I
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGPAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N+DKAWD+ WIFWVGPF+GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  239  YNNDKAWDDQWIFWVGPFIGAAIAAAYHQYILRAGAIKALGSFRSNA  285



>ref|XP_010553324.1| PREDICTED: aquaporin PIP2-2 [Tarenaya hassleriana]
Length=198

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  90   FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  149

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DK WD+HWIFWVGPF+GA  AA YHQY+LR S  K+LGSFRS++
Sbjct  150  FNKDKPWDDHWIFWVGPFIGAAIAAFYHQYVLRASGSKSLGSFRSSS  196



>ref|XP_006846905.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
 gb|ERN08486.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
Length=280

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  172  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  231

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DKAWD+HW+FWVGPFVGA AAA YHQYILR +AIKALGSFRSN
Sbjct  232  YNSDKAWDDHWVFWVGPFVGAAAAAAYHQYILRAAAIKALGSFRSN  277



>gb|AAU43629.1| putative aquaporin PIP-type [Solanum lycopersicum]
Length=171

 Score =   182 bits (461),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  63   FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  122

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
             ++   WD+ WIFWVGPFVGAL AA YHQYILR +AIKALGSFRSNA
Sbjct  123  ADNKNVWDDQWIFWVGPFVGALLAAAYHQYILRAAAIKALGSFRSNA  169



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DKAWD+ WIFWVGPF+GA  AA+YHQ +LR  A+KALGSFRS+
Sbjct  236  YNKDKAWDDQWIFWVGPFIGAAIAAIYHQIVLRAGAVKALGSFRSS  281



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA +I
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  238

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N +K WD+ WIFWVGP +GA  AA YHQYILR +AIKALGSFRSNA
Sbjct  239  YNKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFRSNA  285



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  175  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGPF+GA  AA YHQ++LR  AIKALGSFRSNA
Sbjct  235  YNKDKAWDDQWIFWVGPFIGAAIAAFYHQFVLRAGAIKALGSFRSNA  281



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L   VFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  181  FVLVYVVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DKAWD+HWIFWVGPF GA  AAVY QYI R  AIKALGSFRSNA
Sbjct  241  FNGDKAWDDHWIFWVGPFFGAFIAAVYPQYIFRAGAIKALGSFRSNA  287



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA ++
Sbjct  177  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  236

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            FN DK WD+HWIFWVGP +GA  AA+YHQYILR  A KALGSFRS++
Sbjct  237  FNQDKPWDDHWIFWVGPLIGAAIAAIYHQYILRAGAAKALGSFRSSS  283



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  174  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +  DKAWD+ WIFWVGPF+GA  AA+YHQYILR  A KALGSFRS++
Sbjct  234  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAAKALGSFRSSS  280



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA +I
Sbjct  184  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  243

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSNA  377
            +N DKAWD+ WIFWVGP +GA  AA YHQYILR  AIKALGSFRSNA
Sbjct  244  YNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>gb|ACE60220.1| plasma membrane aquaporin [Rosa hybrid cultivar]
Length=281

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ HLATIPITGTGINPARSFGA +I
Sbjct  173  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFVEHLATIPITGTGINPARSFGAAVI  232

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N++K WD+ WIFWVGPFVGAL AA YHQYILR +AIKALGSFRSN
Sbjct  233  YNEEKVWDDQWIFWVGPFVGALCAAAYHQYILRAAAIKALGSFRSN  278



>gb|AFN53630.1| putative aquaporin PIP2-8 [Linum usitatissimum]
Length=692

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  584  FVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  643

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N+DK WD+HW+FWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  644  YNNDKIWDDHWVFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  689



>gb|AEF32110.1| aquaporin PIP2 [Hedychium coronarium]
Length=282

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLAT PITGTGINPARS G  +I
Sbjct  174  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATTPITGTGINPARSLGPAVI  233

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            +N DKAWD+ WIFWVGP VGALAAA YHQYILR +AIKALGSFRSN
Sbjct  234  YNQDKAWDDQWIFWVGPLVGALAAAAYHQYILRAAAIKALGSFRSN  279



>ref|XP_004500724.1| PREDICTED: uncharacterized protein LOC101494283 [Cicer arietinum]
Length=690

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  57   FRLGLTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAVLI  236
            F L  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA +I
Sbjct  582  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  641

Query  237  FNDDKAWDEHWIFWVGPFVGALAAAVYHQYILRGSAIKALGSFRSN  374
            FN+ K WD+HWIFWVGPFVGALAAA YHQYILR +AIKALGSFRSN
Sbjct  642  FNNAKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN  687



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515