BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN025K16

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    255   3e-83   Petunia x hybrida [garden petunia]
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    254   6e-83   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    253   3e-82   Solanum tuberosum [potatoes]
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    252   6e-82   Solanum tuberosum [potatoes]
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    252   7e-82   Solanum lycopersicum
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    251   1e-81   Solanum tuberosum [potatoes]
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    251   1e-81   Nicotiana sylvestris
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    251   1e-81   
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    251   2e-81   Nicotiana tomentosiformis
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    251   2e-81   Petunia x hybrida [garden petunia]
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    250   2e-81   Solanum lycopersicum
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    250   3e-81   Nicotiana attenuata
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    250   3e-81   
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    250   3e-81   Solanum tuberosum [potatoes]
gb|AHI85721.1|  stress-induced protein 16                               249   4e-81   Capsicum annuum
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    248   2e-80   Solanum tuberosum [potatoes]
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    247   4e-80   Solanum tuberosum [potatoes]
gb|AFK36660.1|  unknown                                                 247   4e-80   Lotus japonicus
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    246   7e-80   Stellaria longipes
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    246   7e-80   Solanum tuberosum [potatoes]
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    246   9e-80   Nicotiana sylvestris
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    246   1e-79   Solanum tuberosum [potatoes]
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    246   1e-79   Solanum tuberosum [potatoes]
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    244   3e-79   Nicotiana sylvestris
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    245   4e-79   Solanum tuberosum [potatoes]
gb|AAR83879.1|  Cristal-Glass1 protein                                  244   4e-79   Capsicum annuum
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    244   4e-79   Capsicum annuum
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   5e-79   Nicotiana sylvestris
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   6e-79   Nicotiana tomentosiformis
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    244   7e-79   Eucalyptus globulus [blue gum]
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   7e-79   Eucalyptus grandis [rose gum]
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   7e-79   Nicotiana tomentosiformis
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   8e-79   Nicotiana sylvestris
gb|AFK48034.1|  unknown                                                 244   9e-79   Lotus japonicus
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   9e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   9e-79   Nicotiana tomentosiformis
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   1e-78   Eucalyptus grandis [rose gum]
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    244   1e-78   Capsicum annuum
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   1e-78   Nicotiana sylvestris
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    242   1e-78   Nicotiana sylvestris
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    243   2e-78   Solanum tuberosum [potatoes]
gb|AFK33868.1|  unknown                                                 243   2e-78   Lotus japonicus
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    243   2e-78   Betula pendula [white birch]
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   2e-78   Malus domestica [apple tree]
gb|AFK42721.1|  unknown                                                 243   3e-78   Lotus japonicus
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   3e-78   Nicotiana tomentosiformis
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   4e-78   Nicotiana sylvestris
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   5e-78   Nicotiana sylvestris
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   5e-78   
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   5e-78   Nicotiana tomentosiformis
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                     242   5e-78   Eucalyptus grandis [rose gum]
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   6e-78   
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    240   1e-77   Nicotiana tomentosiformis
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    240   1e-77   Nicotiana tabacum [American tobacco]
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     240   2e-77   Malus domestica x Pyrus communis
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    240   2e-77   Ricinus communis
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   3e-77   Pyrus x bretschneideri [bai li]
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    240   3e-77   Solanum lycopersicum
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   4e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   4e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    239   5e-77   Blitum nuttallianum
gb|ABK96567.1|  unknown                                                 239   6e-77   Populus trichocarpa x Populus deltoides
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    238   7e-77   Nicotiana tabacum [American tobacco]
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   7e-77   Nelumbo nucifera [Indian lotus]
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   7e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   8e-77   Pyrus x bretschneideri [bai li]
gb|AFK40375.1|  unknown                                                 239   1e-76   Medicago truncatula
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    238   1e-76   Populus trichocarpa [western balsam poplar]
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    238   1e-76   Ammopiptanthus mongolicus
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    238   2e-76   Fragaria vesca subsp. vesca
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     238   2e-76   Eucalyptus grandis [rose gum]
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      238   2e-76   Medicago truncatula
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    238   3e-76   Pyrus pyrifolia [sha li]
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    237   3e-76   Malus sp.
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    237   4e-76   Nelumbo nucifera [Indian lotus]
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   4e-76   Populus euphratica
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    237   6e-76   Corchorus olitorius [Nalta jute]
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    236   7e-76   Panax ginseng [Asiatic ginseng]
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   8e-76   Populus euphratica
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   9e-76   Nicotiana sylvestris
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    235   1e-75   Blitum nuttallianum
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   1e-75   Citrus sinensis [apfelsine]
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    236   1e-75   Wolffia australiana
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    235   2e-75   Chenopodium album [lamb's-quarters]
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    235   2e-75   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    234   2e-75   Arachis duranensis
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      235   2e-75   Medicago truncatula
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    235   2e-75   Fagus crenata
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    234   2e-75   Arachis hypogaea [goober]
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    235   3e-75   Coffea arabica [arabica coffee]
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    234   4e-75   Nicotiana tomentosiformis
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    234   4e-75   Eucalyptus globulus [blue gum]
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    234   5e-75   Medicago sativa [alfalfa]
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    234   5e-75   Fagus sylvatica
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             234   6e-75   Citrus clementina [clementine]
gb|ABK96590.1|  unknown                                                 234   8e-75   Populus trichocarpa x Populus deltoides
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    234   9e-75   Fragaria vesca subsp. vesca
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    233   1e-74   Ricinus communis
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    234   1e-74   Mesembryanthemum crystallinum
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    233   1e-74   Mesembryanthemum crystallinum
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    233   2e-74   Mesembryanthemum crystallinum
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    233   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    233   3e-74   Ricinus communis
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    232   3e-74   Aralia elata
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    232   4e-74   Mesembryanthemum crystallinum
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    232   4e-74   Amaranthus hypochondriacus [prince's feather]
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    232   4e-74   Trifolium repens [creeping white clover]
gb|ABK95229.1|  unknown                                                 231   6e-74   Populus trichocarpa [western balsam poplar]
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    231   6e-74   
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    231   7e-74   Lactuca sativa [cultivated lettuce]
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    231   8e-74   Cucumis melo [Oriental melon]
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   231   1e-73   Mesembryanthemum crystallinum
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    231   1e-73   Mesembryanthemum crystallinum
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    230   1e-73   Camellia sinensis [black tea]
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    230   2e-73   Lemna gibba
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    230   2e-73   Beta vulgaris subsp. vulgaris [field beet]
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    230   2e-73   Amaranthus hypochondriacus [prince's feather]
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    230   2e-73   Lemna gibba
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    230   2e-73   Camellia oleifera [abura-tsubaki]
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    230   3e-73   Amaranthus hypochondriacus [prince's feather]
gb|ABK96431.1|  unknown                                                 229   3e-73   Populus trichocarpa x Populus deltoides
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    229   4e-73   Populus euphratica
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    229   4e-73   Lactuca sativa [cultivated lettuce]
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    229   5e-73   
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    229   7e-73   Helianthus annuus
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    229   8e-73   Arachis hypogaea [goober]
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    229   8e-73   Prunus mume [ume]
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    228   9e-73   Cicer arietinum [garbanzo]
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    228   1e-72   Mesembryanthemum crystallinum
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    228   1e-72   Mesembryanthemum crystallinum
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    228   1e-72   Cucumis sativus [cucumbers]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    228   1e-72   Cucumis sativus [cucumbers]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     228   2e-72   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             228   2e-72   Prunus persica
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           228   2e-72   Medicago truncatula
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    228   2e-72   Coffea canephora [robusta coffee]
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           228   2e-72   Medicago truncatula
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    228   2e-72   
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           227   3e-72   Medicago truncatula
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    227   3e-72   Lemna gibba
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    227   3e-72   
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    227   3e-72   Spinacia oleracea
gb|ACJ85905.1|  unknown                                                 227   3e-72   Medicago truncatula
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           227   3e-72   Medicago truncatula
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    227   3e-72   
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     227   4e-72   Spinacia oleracea
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         226   6e-72   Jatropha curcas
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      226   6e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    226   7e-72   Spinacia turkestanica
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      226   8e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    226   1e-71   
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    225   1e-71   Spinacia oleracea
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    225   1e-71   Spinacia oleracea
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    226   1e-71   Glycine max [soybeans]
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    226   1e-71   Tarenaya hassleriana [spider flower]
ref|NP_001235314.1|  uncharacterized protein LOC100500504               226   1e-71   Glycine max [soybeans]
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    225   1e-71   Gossypium gossypioides
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    226   1e-71   
emb|CDP20139.1|  unnamed protein product                                225   1e-71   Coffea canephora [robusta coffee]
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    226   1e-71   Pisum sativum [garden pea]
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    225   1e-71   Arabidopsis thaliana [mouse-ear cress]
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    225   1e-71   Pisum sativum [garden pea]
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      225   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    225   1e-71   Glycine max [soybeans]
gb|AIR75143.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    224   2e-71   Blitum virgatum
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      225   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      225   2e-71   Arabidopsis thaliana [mouse-ear cress]
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    225   2e-71   Cucumis sativus [cucumbers]
gb|AEX60840.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   2e-71   Gossypium herbaceum [Arabian cotton]
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    225   3e-71   Pyrus x bretschneideri [bai li]
gb|KEH21537.1|  ribulose bisphosphate carboxylase small chain           225   3e-71   Medicago truncatula
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             224   3e-71   Eutrema salsugineum [saltwater cress]
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    224   3e-71   Glycine tabacina
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    224   4e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75302.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    224   4e-71   Arachis duranensis
gb|AIF75300.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    224   4e-71   Arachis duranensis
gb|AIF75301.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   4e-71   
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    224   4e-71   Arabidopsis suecica
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    224   4e-71   Mesembryanthemum crystallinum
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           224   5e-71   Medicago truncatula
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   5e-71   Gossypium herbaceum [Arabian cotton]
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   6e-71   Gossypium hirsutum [American cotton]
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   6e-71   Gossypium hirsutum [American cotton]
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    224   7e-71   Elaeis guineensis
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   7e-71   Gossypium mustelinum
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   7e-71   Gossypium hirsutum [American cotton]
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    223   1e-70   Raphanus sativus
gb|AEX60837.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   1e-70   Gossypium herbaceum [Arabian cotton]
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    223   1e-70   Arabidopsis lyrata subsp. lyrata
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         223   1e-70   Jatropha curcas
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             223   1e-70   Capsella rubella
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   1e-70   Gossypium hirsutum [American cotton]
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   1e-70   Gossypium tomentosum
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    223   1e-70   Flaveria pringlei
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    223   1e-70   Spinacia tetrandra
gb|AEX60836.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   1e-70   Gossypium raimondii
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    223   1e-70   Glycine max [soybeans]
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   1e-70   Gossypium armourianum
ref|XP_010103758.1|  hypothetical protein L484_014647                   223   2e-70   Morus notabilis
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    222   2e-70   Arabidopsis suecica
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    223   2e-70   
gb|ACU13285.1|  unknown                                                 223   2e-70   Glycine max [soybeans]
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    223   2e-70   
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    223   2e-70   Camelina sativa [gold-of-pleasure]
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    222   2e-70   Flaveria pringlei
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   2e-70   Gossypium raimondii
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      222   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AIR75144.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    221   3e-70   Blitum bonus-henricus [allgood]
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   3e-70   Gossypium armourianum
gb|AEX60838.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   3e-70   Gossypium raimondii
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   3e-70   Gossypium tomentosum
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             222   3e-70   Capsella rubella
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    222   3e-70   Camelina sativa [gold-of-pleasure]
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    222   3e-70   Flaveria pringlei
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    222   3e-70   Lemna gibba
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    222   4e-70   Camelina sativa [gold-of-pleasure]
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    222   4e-70   Glycine soja [wild soybean]
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   4e-70   Gossypium hirsutum [American cotton]
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    222   4e-70   Brassica rapa
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     222   4e-70   Jatropha curcas
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    222   4e-70   Tarenaya hassleriana [spider flower]
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             222   4e-70   Capsella rubella
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   5e-70   Gossypium gossypioides
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   5e-70   Gossypium herbaceum [Arabian cotton]
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   5e-70   Gossypium mustelinum
emb|CDY52468.1|  BnaA04g27920D                                          221   5e-70   Brassica napus [oilseed rape]
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   6e-70   Camelina sativa [gold-of-pleasure]
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   6e-70   Gossypium hirsutum [American cotton]
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   6e-70   Brassica napus [oilseed rape]
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   6e-70   Ageratina adenophora
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   6e-70   Brassica rapa
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   6e-70   Arabidopsis arenosa
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   7e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   7e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   7e-70   Phoenix dactylifera
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    221   8e-70   Flaveria pringlei
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   8e-70   Gossypium raimondii
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   8e-70   Brassica oleracea
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   8e-70   Brassica napus [oilseed rape]
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   8e-70   Gossypium herbaceum [Arabian cotton]
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   8e-70   Gossypium hirsutum [American cotton]
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   8e-70   Camelina sativa [gold-of-pleasure]
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    221   9e-70   Flaveria pringlei
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    220   9e-70   Arabidopsis arenosa
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    221   9e-70   Gossypium hirsutum [American cotton]
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    221   1e-69   Gossypium arboreum [tree cotton]
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   1e-69   Brassica oleracea
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    221   1e-69   Flaveria pringlei
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  221   1e-69   Arabidopsis lyrata subsp. lyrata
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    220   1e-69   Arabidopsis suecica
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    220   1e-69   Glycine tomentella [wooly glycine]
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             220   2e-69   Eutrema salsugineum [saltwater cress]
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    220   2e-69   Glycine max [soybeans]
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    220   2e-69   Manihot esculenta [manioc]
gb|ACQ90230.1|  virus-resistance protein                                223   2e-69   Brassica rapa subsp. chinensis [bok-choy]
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    220   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    220   2e-69   Gossypium hirsutum [American cotton]
emb|CDX99682.1|  BnaC04g34390D                                          220   2e-69   
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    220   2e-69   Theobroma cacao [chocolate]
emb|CDY67657.1|  BnaCnng55860D                                          220   2e-69   Brassica napus [oilseed rape]
emb|CDX67402.1|  BnaA07g14420D                                          220   2e-69   
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             220   2e-69   Eutrema salsugineum [saltwater cress]
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   2e-69   Elaeis guineensis
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    219   3e-69   Brassica oleracea
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    219   3e-69   Brassica rapa
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    219   3e-69   Flaveria pringlei
gb|ABA46878.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    219   3e-69   Musa balbisiana [starchy banana]
gb|AAG40356.1|AF325004_1  At1g67090                                     219   4e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    218   5e-69   Arabidopsis suecica
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    219   5e-69   Musa acuminata AAA Group [Cavendish banana]
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    219   5e-69   Lemna gibba
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   6e-69   Brassica rapa
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   6e-69   Phoenix dactylifera
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    218   6e-69   Gossypioides kirkii
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   6e-69   Brassica rapa
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             219   7e-69   Prunus persica
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    218   7e-69   Flaveria trinervia
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   7e-69   
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    218   8e-69   
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    218   8e-69   
gb|ABA46875.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    218   8e-69   
emb|CDY01665.1|  BnaC04g30870D                                          218   9e-69   
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    218   1e-68   
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    218   1e-68   
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   218   1e-68   
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   1e-68   
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    218   1e-68   
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    218   1e-68   
gb|ABA46877.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    217   2e-68   
emb|CAH59401.1|  Rubisco SSU                                            218   2e-68   
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    217   2e-68   
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    218   2e-68   
gb|ABA46882.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    217   2e-68   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    217   2e-68   
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    217   2e-68   
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    218   2e-68   
gb|KJB10450.1|  hypothetical protein B456_001G201800                    217   2e-68   
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      217   2e-68   
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    217   3e-68   
gb|ABA46879.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   3e-68   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    217   3e-68   
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    217   3e-68   
gb|ABA46889.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   3e-68   
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    217   3e-68   
gb|ABA46911.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   4e-68   
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    217   4e-68   
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    216   4e-68   
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    216   4e-68   
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        216   5e-68   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    216   5e-68   
gb|ABA46898.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   6e-68   
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    216   6e-68   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    216   6e-68   
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             216   7e-68   
gb|ABA46910.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    215   7e-68   
gb|ABA46883.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    215   7e-68   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   7e-68   
gb|KJB43046.1|  hypothetical protein B456_007G181300                    216   8e-68   
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    216   8e-68   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    215   1e-67   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                215   1e-67   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    215   1e-67   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       214   1e-67   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                215   2e-67   
ref|NP_001066606.1|  Os12g0291400                                       215   2e-67   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    215   2e-67   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    214   2e-67   
gb|ABA46888.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   2e-67   
emb|CAA30290.1|  rubisco ssu precursor                                  215   2e-67   
gb|EAY97115.1|  hypothetical protein OsI_19041                          214   2e-67   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    214   2e-67   
ref|NP_001066604.1|  Os12g0291100                                       214   2e-67   
gb|ABA46891.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   2e-67   
ref|NP_001066559.1|  Os12g0274700                                       214   2e-67   
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       214   3e-67   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    214   3e-67   
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             214   3e-67   
gb|ABA46909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   3e-67   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    214   3e-67   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    214   4e-67   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     214   4e-67   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    214   5e-67   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    213   6e-67   
gb|ABA46887.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    213   7e-67   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    213   8e-67   
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      213   8e-67   
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    213   9e-67   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    213   1e-66   
dbj|BAJ86022.1|  predicted protein                                      213   1e-66   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    213   1e-66   
gb|EMT06085.1|  hypothetical protein F775_43781                         213   1e-66   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    213   1e-66   
ref|NP_001066607.1|  Os12g0292400                                       212   2e-66   
gb|ABA46892.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    212   2e-66   
dbj|BAJ90202.1|  predicted protein                                      212   2e-66   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   2e-66   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    212   2e-66   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    213   3e-66   
emb|CDY12616.1|  BnaA02g12840D                                          212   3e-66   
dbj|BAJ89884.1|  predicted protein                                      212   3e-66   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     212   3e-66   
dbj|BAJ90404.1|  predicted protein                                      211   3e-66   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   4e-66   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                212   4e-66   
emb|CAA10497.1|  hypothetical protein                                   211   4e-66   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   4e-66   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    211   5e-66   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   5e-66   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    211   5e-66   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    211   7e-66   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    211   7e-66   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    210   8e-66   
emb|CAA10496.1|  hypothetical protein                                   211   8e-66   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    210   8e-66   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    211   8e-66   
emb|CDY42338.1|  BnaC02g17150D                                          211   9e-66   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   1e-65   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    210   1e-65   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    211   1e-65   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   1e-65   
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   1e-65   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    210   1e-65   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    210   1e-65   
dbj|BAJ90550.1|  predicted protein                                      210   1e-65   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    210   1e-65   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    210   1e-65   
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   2e-65   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    210   2e-65   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    210   2e-65   
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    209   2e-65   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    209   2e-65   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    210   2e-65   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           210   2e-65   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   2e-65   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    209   2e-65   
gb|EAY82834.1|  hypothetical protein OsI_38046                          209   2e-65   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    209   3e-65   
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...    209   3e-65   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    209   4e-65   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    209   4e-65   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          209   4e-65   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    209   4e-65   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    208   5e-65   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    208   5e-65   
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    208   6e-65   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    208   6e-65   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    208   6e-65   
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    207   7e-65   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    208   8e-65   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    208   8e-65   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    208   8e-65   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    207   9e-65   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     207   1e-64   
emb|CAH59404.1|  Rubisco SSU                                            207   1e-64   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    207   1e-64   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    207   1e-64   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    207   1e-64   
gb|AAF03096.1|AF162195_1  ribulose-1,5-bisphosphate carboxylase/o...    207   2e-64   
gb|EMS50269.1|  Ribulose bisphosphate carboxylase small chain PW9...    208   2e-64   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    207   2e-64   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         206   2e-64   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    206   3e-64   
emb|CDY42337.1|  BnaC02g17140D                                          207   3e-64   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     206   3e-64   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    206   3e-64   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    206   3e-64   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     206   4e-64   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    206   5e-64   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          206   5e-64   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    206   6e-64   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    205   7e-64   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    206   8e-64   
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    205   1e-63   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    205   1e-63   
emb|CAG25595.1|  putative rubisco small subunit                         205   1e-63   
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   203   2e-63   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    204   2e-63   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    204   2e-63   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...    204   2e-63   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    204   2e-63   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    204   4e-63   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...    204   4e-63   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    203   4e-63   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    203   5e-63   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    203   5e-63   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    203   6e-63   
gb|ABQ42090.1|  ribulose bisphosphate carboxylase small chain (Ru...    203   6e-63   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    203   6e-63   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    203   6e-63   
gb|EMS50268.1|  Ribulose bisphosphate carboxylase small chain PWS...    204   7e-63   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    202   7e-63   
emb|CBI15452.3|  unnamed protein product                                202   1e-62   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    202   1e-62   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    202   1e-62   
gb|ABQ42164.1|  ribulose bisphosphate carboxylase small chain (Ru...    202   1e-62   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     202   2e-62   
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    202   2e-62   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    201   3e-62   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    201   3e-62   
gb|ABQ42089.1|  ribulose bisphosphate carboxylase small chain (Ru...    201   5e-62   
gb|ACS68693.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   6e-62   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    201   6e-62   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...    199   2e-61   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    199   3e-61   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    198   4e-61   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        197   1e-60   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    197   1e-60   
sp|Q38793.1|RBS_AEGTA  RecName: Full=Ribulose bisphosphate carbox...    197   1e-60   
gb|EYU38175.1|  hypothetical protein MIMGU_mgv1a014707mg                197   1e-60   
gb|ABR45725.1|  RBCS1                                                   197   2e-60   
gb|ABR45726.1|  RBCS1                                                   197   2e-60   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     196   3e-60   
ref|WP_026003795.1|  hypothetical protein                               194   4e-60   
gb|AAB95215.1|  ribulose 1,5 bisphosphate carboxylase small subunit     195   4e-60   
gb|AAB95212.1|  ribulose 1,5 bisphosphate carboxylase small subunit     195   5e-60   
emb|CAA63441.1|  Rubisco                                                194   5e-60   
sp|Q41373.1|RBS_SACHY  RecName: Full=Ribulose bisphosphate carbox...    196   5e-60   
gb|AAB95210.1|  ribulose 1,5 bisphosphate carboxylase small subunit     194   7e-60   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...    195   1e-59   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    194   2e-59   
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...    192   2e-59   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    194   3e-59   
gb|AAP31674.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    192   3e-59   
sp|P16031.1|RBS_LARLA  RecName: Full=Ribulose bisphosphate carbox...    194   4e-59   
ref|XP_006485852.1|  PREDICTED: ribulose bisphosphate carboxylase...    196   4e-59   
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      192   5e-59   
gb|AAB95217.1|  ribulose 1,5 bisphosphate carboxylase small subunit     192   6e-59   
gb|AAB95211.1|  ribulose 1,5 bisphosphate carboxylase small subunit     192   6e-59   
gb|AAB95214.1|  ribulose 1,5 bisphosphate carboxylase small subunit     192   7e-59   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    192   1e-58   
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...    191   1e-58   
gb|ABK21690.1|  unknown                                                 192   1e-58   
gb|ACN40080.1|  unknown                                                 192   2e-58   
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...    190   2e-58   
gb|AAF06097.1|  ribulose 1,5-bisphosphate carboxylase small chain...    192   2e-58   
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...    190   2e-58   
gb|AAK16230.1|AF044398_1  ribulose-1,5-bisphosphate carboxylase s...    190   3e-58   
gb|ACN40169.1|  unknown                                                 192   3e-58   



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   255 bits (651),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+   AAQASMVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVMSSAAVATSTNAAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP+G KK+ETLSYLP L+ EQLLK++EYLL KGWVPCLEFETE GFVYRE+HASP YYD
Sbjct  61   WPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVR  165



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   254 bits (650),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSVLSS A+A+R+  AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP   KK+ETLSYLP LS EQLL ++EYLLK GWVPCLEFETE+GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSQEQLLSEIEYLLKSGWVPCLEFETERGFVYREHHHSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AWVRI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRIIGFDNVR  165



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   253 bits (645),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+R   AQASMVAPFTGLKSTASFPV++K   D TSI++NG RV+CMQV
Sbjct  1    MASSVMSSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS EQLLK+VEYLLK GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVR  165



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   252 bits (643),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++SS A+A+RA  AQASMV PFTGLKSTASFPV++K   D TSI++NG RV+CMQV
Sbjct  1    MASSIVSSAAVATRANGAQASMVGPFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS EQLLK+VEYLLK GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVR  165



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   252 bits (643),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+R   AQASMVAPFTGLKSTASFPV++K   D TSI++NG RV CMQV
Sbjct  1    MASSVMSSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS EQLL ++EYLLK GWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVR  165



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+R   AQASMVAPFTGLKS ASFPV++K   D TSI++NG RV+CMQV
Sbjct  1    MASSVMSSAAVATRGNGAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVRCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS EQLLK+VEYLLK GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVR  165



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSVLSS A+A+R+  AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP   KK+ETLSYLP LS EQLL +VEYLLK GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVR  165



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++SS A+A+R   AQASMVAPFTGLKSTASFPV++K   D TSI++NG RV CMQV
Sbjct  1    MASSIVSSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS EQLL ++EYLLK GWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVR  165



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSVLSS A+A+R   AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRTNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP+G KK+ETLSYLP LS EQLL ++EYLLK GWVPCLEFETE+GFVYRE + SPGYYD
Sbjct  61   WPPYGKKKYETLSYLPDLSEEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAWIRIIGFDNVR  165



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+R   AQASMVAPF GLKS  SFPV+ K   D TSI++NG RVQCMQV
Sbjct  1    MASSVISSAAVATRTNVAQASMVAPFNGLKSAVSFPVSSKQNLDITSIASNGGRVQCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP+G KK+ETLSYLP L+ EQLLK++EYLL KGWVPCLEFETE GFVYRE+HASP YYD
Sbjct  61   WPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVR  165



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+R+   QASMVAPFTGLKS+A+FPVTKK   D TSI++NG RV CMQV
Sbjct  1    MASSVISSAAVATRSNVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS EQLL +VEYLLK GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVR  165



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSVLSS A+A+R+  AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP   KK+ETLSYLP LS EQLL++VEYLLK GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSQEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDA QV+AE+EE KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDAAQVLAEVEEAKKAYPQAWIRIIGFDNVR  165



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   250 bits (638),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+R+   QASMVAPFTGLKS+A+FPVTKK   D TSI++NG RV CMQV
Sbjct  1    MASSVISSAAVATRSNVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS EQLL ++EYLLK GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVR  165



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   250 bits (638),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQ  195
            MASS++SS A+A+R+  AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQ
Sbjct  1    MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP  +KK+ETLSYLP LS EQLLK+VEYLLK GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVR  166



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS A+A+R    QASMVAPFTGLKS ASFPVT+K+  D TSI++NG RVQCM V
Sbjct  1    MASSVISSAAVATRTNVTQASMVAPFTGLKSAASFPVTRKNNLDITSIASNGGRVQCMLV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP   KK+ETLSYLP LS EQLLK++EYLL+KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVR  165



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLLK GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVR  166



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaias-rataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+       +SMVAPFTGLKSTA+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQASSMVAPFTGLKSTATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLLK GWVPCLEFETE GFVYRE + SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAWIRIIGFDNVR  166



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  22   PFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLA  81

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  82   KEVEYLIRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  141

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDNKR
Sbjct  142  EEAKKAYPNAFIRIIGFDNKR  162



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   246 bits (629),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++SS A+A+R+  AQASMVAPFTGLKS ASFPV++K+  D TSI++NG RV+CMQV
Sbjct  1    MASSIMSSAAVATRSNGAQASMVAPFTGLKSNASFPVSRKTNLDITSIASNGGRVRCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP  +KK+ETLSYLP LS+EQLL ++EYLLK GWVPCLEFETE GFVYRE  +SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSSEQLLSEIEYLLKNGWVPCLEFETEHGFVYREHTSSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV AE++E KKAYP A +RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVAAEVQEAKKAYPDAHIRIIGFDNVR  165



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   246 bits (629),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP   KK+ETLSYLP L+ EQLLK+VEYLLK GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVR  166



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   246 bits (629),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasr-ataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS    +  A AAQASMVAPFTGLKS +SFPVT+K   D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAVAVATGANAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP   KK+ETLSYLP LS EQLL++VEYLLK GWVPCLEFETE GFVYRE + SPGYY
Sbjct  61   VWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVR  166



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLLK GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTD TQV+AE++ECKK+YP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDTTQVLAEVQECKKSYPQAWIRIIGFDNVR  166



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQ  195
            MASS++SS A+A+R+  AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQ
Sbjct  1    MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP  +KK+ETLSYLP LS EQLLK+VEYLLK GWVPCLEFETE GFVYRE ++SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYREHNSSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTD TQV+AE++E K AYP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDGTQVLAEVQEAKNAYPQAWIRIIGFDNVR  166



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   244 bits (623),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaias-rataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+       +SMVAPFTGLKST +FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQASSMVAPFTGLKSTPTFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLLK GWVPCLEFETE GFVYRE + SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW+RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAWIRIIGFDNVR  166



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   244 bits (624),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+S+  +A+ A AAQASM+A F GLKS ASFPVT+K   D TSI++NG RVQCM V
Sbjct  1    MASSVMSTATVATGANAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP   KK+ETLSYLP LS EQLLK++EYLL+KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVR  165



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   244 bits (624),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+S   +A+ A AAQASM+A F GLKS ASFPVT+K   D TSI++NG RVQCM V
Sbjct  1    MASSVMSIATVATGANAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP   KK+ETLSYLP LS EQLLK++EYLL+KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVR  165



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (621),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   SEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>gb|AIF75357.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75358.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (621),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             ++EYLLK GWVPCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   SEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E KKAYP AW+RI+GFDN R
Sbjct  130  GEAKKAYPEAWIRIIGFDNVR  150



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   244 bits (623),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+ GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A+VRI+GFDNKR
Sbjct  146  EECKKAYPTAFVRIIGFDNKR  166



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   244 bits (623),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+ GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A+VRI+GFDNKR
Sbjct  146  EECKKAYPTAFVRIIGFDNKR  166



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (620),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSVEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>gb|AIF75349.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75350.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (620),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++V+YLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   244 bits (622),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FPV +K   D TSI+ NG RVQCMQVWPP G KKFETLSYLPPL+TEQLL
Sbjct  27   PFTGLKSMAGFPV-RKVNNDITSIANNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ EL
Sbjct  86   KEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDATQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  KAYP A+VRI+GFDN R
Sbjct  146  DEAVKAYPNAFVRIIGFDNVR  166



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   244 bits (622),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKST++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL
Sbjct  26   PFNGLKSTSAFPVTRKSNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+
Sbjct  86   AEVNYLLVKGWIPCLEFEIKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A+VRI+GFDNKR
Sbjct  146  EEVKKAYPDAFVRIIGFDNKR  166



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (619),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KS+ D TS+S+NG RVQCMQVWPP G KKFETLSYLPPLS E L 
Sbjct  24   PFTGLKSASAFPVTRKSSEDITSLSSNGGRVQCMQVWPPIGKKKFETLSYLPPLSPESLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+ GWVPCLEFE E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSGWVPCLEFELEHGFVYREHHSSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDNKR
Sbjct  144  EEAKKAYPTAFIRIIGFDNKR  164



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+S+  +A+ A AAQASM+A F GLKS ASFPVT+K   D TSI++NG RV+CM V
Sbjct  1    MASSVMSTATVATGANAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVECMLV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP   KK+ETLSYLP LS EQLLK++EYLL+KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVR  165



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  146  EEAKKAYPQAWIRIIGFDNVR  166



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   242 bits (618),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP   KK+ETLSYLP L+ EQLLK+VEYLLK GWVPCLEFETE G VYRE H SPGYY
Sbjct  61   VWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGIVYREKHKSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYW MWKLPMFGCTDATQV+AE++ECKK+YP AW+RI+GFDN R
Sbjct  121  DGRYWNMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVR  166



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  22   PFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLA  81

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWVPCLEFETEKGFVYRE   SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  82   KEVEYLIRKGWVPCLEFETEKGFVYRENLKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  141

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDNKR
Sbjct  142  EEAKKAYPNAFIRIIGFDNKR  162



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFT LKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+EQL 
Sbjct  27   PFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K  +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC D++QV+ EL
Sbjct  87   KEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDNKR
Sbjct  147  EECKKAYPSAFIRIIGFDNKR  167



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++SS  +A+ +  AQA MVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQV
Sbjct  1    MASSMISSGTVATVSAPAQARMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQV  59

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPLSTE L K+V+YLL+K WVPCLEFE E GFVYRE H SPGYYD
Sbjct  60   WPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDN R
Sbjct  120  GRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVR  164



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FPV +K+  D TSI++NG RVQCMQVWPP G KKFETLSYLPPL+TEQLL
Sbjct  28   PFTGLKSMAGFPV-RKANNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLL  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DA QV+ EL
Sbjct  87   KEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDAAQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  +AYP A+VRI+GFDN R
Sbjct  147  DEAVRAYPNAFVRIIGFDNVR  167



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   241 bits (616),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>gb|AIF75355.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75356.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   241 bits (615),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++V+YLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++V+YLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  146  EEAKKAYPQAWIRIIGFDNVR  166



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  267
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQL  84

Query  268  LKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAE  447
            L ++EYLLK GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDATQV+AE
Sbjct  85   LSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAE  144

Query  448  LEECKKAYPGAWVRILGFDNKR  513
            ++E KKAYP AWVRI+GFDN R
Sbjct  145  VQEAKKAYPQAWVRIIGFDNVR  166



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  146  EEAKKAYPQAWIRIIGFDNVR  166



>gb|KCW52064.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=192

 Score =   242 bits (618),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+ GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNK  510
            EECKKAYP A+VRI+GFDN 
Sbjct  146  EECKKAYPTAFVRIIGFDNN  165



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   242 bits (617),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  148  EEAKKAYPNAFIRIIGFDNVR  168



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPRAWIRIIGFDNVR  150



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   240 bits (613),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++SS  +A+ +  AQA MVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQV
Sbjct  1    MASSMISSGTVATVSAPAQARMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQV  59

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPLSTE L K+V+YLL+K WVPCLEFE E GFVYRE + SPGYYD
Sbjct  60   WPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENNRSPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDN R
Sbjct  120  GRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVR  164



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   240 bits (613),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ASFPVT+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  24   PFTGLKSAASFPVTRKANNDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPDLTDEQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGC+D+TQV+ EL
Sbjct  84   KEVDYLLRKGWIPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDSTQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E KKAYP +++RI+GFDN+R
Sbjct  144  DEAKKAYPNSFIRIIGFDNRR  164



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   240 bits (613),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSPESLA  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  148  EEAKKAYPNAFIRIIGFDNVR  168



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   240 bits (612),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  267
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP  S EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDFSDEQL  84

Query  268  LKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAE  447
            L ++EYLLK GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDATQV+AE
Sbjct  85   LSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAE  144

Query  448  LEECKKAYPGAWVRILGFDNKR  513
            ++E KKAYP AWVRI+GFDN R
Sbjct  145  VQEAKKAYPQAWVRIIGFDNVR  166



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   239 bits (611),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSVLSSTA+A+ +   AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQ
Sbjct  1    MASSVLSSTAVATVSRTPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQ  59

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYY
Sbjct  60   VWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYY  119

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+VRI+GFDNKR
Sbjct  120  DGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKR  165



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   239 bits (611),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++S+ A  + A+ AQA+MVAPF GLKS ++FPVT+KS  D TSI++NG RVQCMQV
Sbjct  1    MASSLMSNAAAVAAASIAQANMVAPFNGLKSASAFPVTRKSN-DITSIASNGGRVQCMQV  59

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYYD
Sbjct  60   WPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNNSPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+VRI+GFDNKR
Sbjct  120  GRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKR  164



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   239 bits (609),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G+KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPIGMKKYETLSYLPPLTTESLL  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +V+YLL KGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGCTD  QVV EL
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPAQVVNEL  136

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKKAYP A++RI+GFDNKR
Sbjct  137  DECKKAYPNAFIRIIGFDNKR  157



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   239 bits (610),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP GLKKFETLSYLP L+TEQL +++EYLL+  WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAREIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP ++VRI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFVRIIGFDNTR  166



>gb|AIF75365.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   238 bits (607),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTM KLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMRKLPMFGCTDATQVLAEV  129

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  130  EEAKKAYPQAWIRIIGFDNVR  150



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   239 bits (610),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +1

Query  19   MASSVLs--staiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  192
            MASSVLS  + A  +R + AQASMVAPFTGLKS ++FPVT+K+  D TS+S+NG RVQCM
Sbjct  1    MASSVLSPTAVASVNRVSPAQASMVAPFTGLKSVSAFPVTRKTNNDITSLSSNGGRVQCM  60

Query  193  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGY  372
            QVWPP   KKFETLSYLPPLS E L K+V+YLL+ GW+PCLEFE E GFVYRE + SPGY
Sbjct  61   QVWPPIAKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGY  120

Query  373  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            YDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A++RI+GFDNKR
Sbjct  121  YDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFIRIIGFDNKR  167



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   239 bits (609),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SSTA+A+ +   AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQ
Sbjct  1    MASSVISSTAVATVSRTPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQ  59

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYY
Sbjct  60   VWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYY  119

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+VRI+GFDNKR
Sbjct  120  DGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKR  165



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   239 bits (609),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP +++RI+GFDN R
Sbjct  148  EEAKKAYPQSFIRIIGFDNVR  168



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   239 bits (609),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL+
Sbjct  25   PFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLV  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL
Sbjct  85   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E K AYP +++RI+GFDN R
Sbjct  145  AEAKAAYPESFIRIIGFDNVR  165



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP GLKKFETLSYLP L+TEQL +++EYLL+  WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAQEIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP +++RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFIRIIGFDNTR  166



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   238 bits (607),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ASFPV +K  +D T+I+ NG RVQCM VWPP G KKFETLSYLPPLS E L 
Sbjct  17   PFTGLKSMASFPVPRKVNSDITTIANNGGRVQCMLVWPPLGRKKFETLSYLPPLSIESLT  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC+DA+QV+ EL
Sbjct  77   KEVEYLLRKGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCSDASQVMKEL  136

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A+VRI+GFDNKR
Sbjct  137  EECKKEYPTAFVRIIGFDNKR  157



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FP+T+K+ +D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL++E L 
Sbjct  27   PFTGLKSASAFPITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTSESLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V++LL+  WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  87   KEVDFLLRNKWVPCLEFELEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  147  EEAKKAYPNAFIRIIGFDNVR  167



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+ GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETE-GFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A+VRI+GFDNKR
Sbjct  145  EECKKAYPTAFVRIIGFDNKR  165



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  25   PFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLA  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL
Sbjct  85   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E K AYP +++RI+GFDN R
Sbjct  145  AEAKAAYPESFIRIIGFDNVR  165



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   238 bits (606),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP +++RI+GFDN R
Sbjct  148  EEAKKAYPQSFIRIIGFDNVR  168



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   237 bits (605),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++ PVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L 
Sbjct  29   PFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLA  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP +++RI+GFDN R
Sbjct  148  EEAKKAYPQSFIRIIGFDNVR  168



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   237 bits (605),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  192
            MASSVLSS A+A+ + A  AQASMVAPF+GLKS  +FPVT+K+  D +S+ +NG RVQCM
Sbjct  1    MASSVLSSAAVATVSRATPAQASMVAPFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCM  60

Query  193  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGY  372
            QVWPP G KKFETLSYLPPLS E L K+V+YLL+ GW+PCLEFE E GFVYRE + SPGY
Sbjct  61   QVWPPLGKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGY  120

Query  373  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            YDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A++RI+GFDNKR
Sbjct  121  YDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFIRIIGFDNKR  167



>ref|XP_011015710.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like, 
partial [Populus euphratica]
Length=167

 Score =   236 bits (603),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP GLKKFETLSYLP L+TEQL K+++YLL+  WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAKEIDYLLRMKWVPCLEFELEKGWVYREHHRSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCT A+QV+ ELEE KKAYP +++RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTQASQVLIELEEAKKAYPNSFIRIIGFDNVR  166



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   237 bits (604),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MAS+++SS  + +RA+ AQA++VAPFTGLKS ++FP T+K+  D TSI++NG RVQCMQV
Sbjct  1    MASAMMSSATVVNRASPAQATLVAPFTGLKSASAFPTTRKNNRDITSIASNGGRVQCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP G KKFETLSYLP L+  QL K+V+YLL+ GW+PCLEFE E GFVYRE H SPGYYD
Sbjct  61   WPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSGWIPCLEFELEHGFVYREHHHSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A++RI+GFDN+R
Sbjct  121  GRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPDAFIRIIGFDNRR  165



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   236 bits (603),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 142/167 (85%), Gaps = 3/167 (2%)
 Frame = +1

Query  19   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  192
            MASSV+SS  +A+ + A  AQASMVAPFTGLKSTA+FPVT+K   D TS+ +NG RVQCM
Sbjct  1    MASSVISSATVAAVSRAVPAQASMVAPFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCM  59

Query  193  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGY  372
            +VWPP GLKKFETLSYLP L+ EQL K+V+YLL+ GWVPCLEFE E GFVYRE H SPGY
Sbjct  60   KVWPPLGLKKFETLSYLPQLTQEQLSKEVDYLLRSGWVPCLEFELEHGFVYREHHHSPGY  119

Query  373  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            YDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A++RI+GFDN R
Sbjct  120  YDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPNAYIRIIGFDNVR  166



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   236 bits (603),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP GLKKFETLSYLP L+TEQL K+++YLL+  WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAKEIDYLLRMKWVPCLEFELEKGWVYREHHRSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCT A+QV+ ELEE KKAYP +++RI+GFDN R
Sbjct  121  DGRYWTMWKLPMFGCTQASQVLIELEEAKKAYPNSFIRIIGFDNVR  166



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   236 bits (602),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K     TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSATSFPVSRKQNLYITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++V+YLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  146  EEAKKAYPQAWIRIIGFDNVR  166



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQ WPP G+KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQAWPPIGMKKYETLSYLPPLTTESLL  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +V+YLL KGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGC D  QVV EL
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCIDPAQVVNEL  136

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKKAYP A++RI+GFDNKR
Sbjct  137  DECKKAYPNAFIRIIGFDNKR  157



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score =   236 bits (602),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LL
Sbjct  27   PFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALL  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K++ YLL+ GW+PCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPM+GCTDATQV+ E+
Sbjct  87   KEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEV  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E +K YP ++VRI+GFDNKR
Sbjct  147  GEVQKEYPHSFVRIIGFDNKR  167



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++ S+A  +RAT AQ++MVAPF GL+S+A+ P T+K+ AD +++ +NG + +CMQV
Sbjct  1    MASSMMVSSAAVARATPAQSNMVAPFNGLRSSAALPATRKANADLSTLLSNGGKARCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPLSTE L K+VEYL++ GW+PC+EF  E GFVYRE+HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSTEALAKEVEYLIRNGWIPCIEFSKE-GFVYREYHASPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKR
Sbjct  120  GRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPDYFVRIIGFDNKR  164



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPL+TE LL
Sbjct  17   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPVGKKKFETLSYLPPLTTESLL  75

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +V+YLL KGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQVV EL
Sbjct  76   SEVQYLLNKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDPTQVVNEL  135

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFD+ R
Sbjct  136  EEAKKAYPNAFIRIIGFDSFR  156



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LL
Sbjct  27   PFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K++EYLL+  WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  86   KEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  K YP A+VRI+GFDNKR
Sbjct  146  DEAIKTYPNAFVRIIGFDNKR  166



>gb|AIF75298.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
Length=160

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFTGLKSLAGFPVTRKANNDITSVTNNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLR  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+KGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  79   KEVDYLLRKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKEL  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP A++RI+GFDN R
Sbjct  139  QEAKAAYPSAFIRIIGFDNVR  159



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ +QL 
Sbjct  22   PFTGLKSSAGFPVTKKTNNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTEDQLA  81

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL
Sbjct  82   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKEL  141

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E K AYP +++RI+GFDN R
Sbjct  142  AEAKAAYPESFIRIIGFDNVR  162



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L 
Sbjct  27   PFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL
Sbjct  87   KQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  K YP + +RI+GFDNKR
Sbjct  147  QEASKTYPTSHIRIIGFDNKR  167



>gb|AIF75299.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75304.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75305.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=160

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLR  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+KGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  79   KEVDYLLRKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKEL  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP A++RI+GFDN R
Sbjct  139  QEAKAAYPSAFIRIIGFDNVR  159



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   235 bits (599),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP GLKK+ETLSYLP L+ EQLL
Sbjct  27   PFNGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPRGLKKYETLSYLPDLTDEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YL++ GWVPCLEFE EKGFVYRE+H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+
Sbjct  86   KEIDYLIRSGWVPCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDATQVLNEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
             EC K YP  WVRI+GFDN R
Sbjct  146  GECLKEYPNCWVRIIGFDNVR  166



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS  QLL
Sbjct  26   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLS--QLL  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            ++VEYLLK GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  84   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP AW+RI+GFDN R
Sbjct  144  EEAKKAYPQAWIRIIGFDNVR  164



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LL
Sbjct  27   PFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K++EYLL+  WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV  EL
Sbjct  86   KEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVFKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  K YP A+VRI+GFDNKR
Sbjct  146  DEAIKTYPNAFVRIIGFDNKR  166



>sp|O65194.1|RBS_MEDSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Medicago sativa]
 gb|AAC13293.1| ribulose-1,5-bisphosphate carboxylase small subunit [Medicago 
sativa]
Length=180

 Score =   234 bits (597),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  25   PFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLA  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGW+PCLEFE EKGFVYRE H SPGYYDGRYWTMW+LP+FG TD++QV+ EL
Sbjct  85   KEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
             +CK  YP +++RI+GFDN R
Sbjct  145  ADCKAEYPDSFIRIIGFDNVR  165



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   234 bits (597),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L 
Sbjct  27   PFTGLKSTAAFPATQKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSLESLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL
Sbjct  87   KQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  K YP + +RI+GFDNKR
Sbjct  147  QEASKTYPTSHIRIIGFDNKR  167



>ref|XP_006430779.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44019.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=182

 Score =   234 bits (597),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LL
Sbjct  27   PFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALL  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K++ YL++ GW+PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+
Sbjct  87   KEISYLIRSGWIPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMYGCTDATQVLKEV  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E +K YP ++VRI+GFDNKR
Sbjct  147  GEVQKEYPHSFVRIIGFDNKR  167



>gb|ABK96590.1| unknown [Populus trichocarpa x Populus deltoides]
Length=189

 Score =   234 bits (597),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWPP GLKKFETLSYLP L+TEQL +++EYLL+  WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAREIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYY  120

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNK  510
            DGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP ++VRI+GF+ +
Sbjct  121  DGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFVRIIGFETR  165



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   234 bits (596),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS ++FPVT+K A D T++++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  26   PFNGLKSASAFPVTRK-ANDITTLASNGGRVQCMQVWPPVGLKKFETLSYLPPLSVESLA  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+  WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTDA+QV+AEL
Sbjct  85   KEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTDASQVIAEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KK YP A++RI+GFDN R
Sbjct  145  EEAKKTYPEAFIRIIGFDNIR  165



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++ ST  +    A QASMVAPFTGLKS++ FPVT+K   D T++++NG +V CMQV
Sbjct  1    MASSIVPSTMASLNRAAPQASMVAPFTGLKSSSVFPVTRKQNNDITTLASNGGKVHCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP G KKFETLSYLPPLS E L K+V+YLL+ GWVPCLEFE E GFVYRE H SPGYYD
Sbjct  61   WPPVGKKKFETLSYLPPLSEESLAKEVDYLLRMGWVPCLEFELEHGFVYRENHRSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GR WTMWKLPMFGCTD++QV+ ELEE KKAYP +++RI+GFDNKR
Sbjct  121  GRCWTMWKLPMFGCTDSSQVLKELEEAKKAYPNSFIRIIGFDNKR  165



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+KS+ D +++ +NG +VQCMQVWPP G KKFETLSYLPPLS E LL
Sbjct  29   PFTGLKSVSAFPVTRKSSNDLSTVPSNGGKVQCMQVWPPLGKKKFETLSYLPPLSEESLL  88

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  89   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  148

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  149  EEAKKAYPEAFIRIIGFDNVR  169



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  24   PFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  83   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  143  EEAKKAYPEAFIRIIGFDNVR  163



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  26   PFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  145  EEAKKAYPEAFIRIIGFDNVR  165



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSIS--TNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQ  264
            PFTGLKS ++FPVT+K+  D TS+   +NG RVQCMQVWPP G KKFETLSYLPPLS E 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLPLPSNGGRVQCMQVWPPTGKKKFETLSYLPPLSPES  86

Query  265  LLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVA  444
            L K+V+YLL+ GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+A
Sbjct  87   LAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLA  146

Query  445  ELEECKKAYPGAWVRILGFDNKR  513
            ELEE KKAYP A++RI+GFDNKR
Sbjct  147  ELEEAKKAYPNAFIRIIGFDNKR  169



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST++FPVT+K+  D T+++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSTSAFPVTRKTNTDITTLANNGGRVQCMQVWPPLGKKKFETLSYLPDLTREQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGC+DA QV+ EL
Sbjct  87   KEVEYLLRKGWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCSDAVQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  KAYP ++VRI+GFDN R
Sbjct  147  DEAIKAYPNSFVRIIGFDNVR  167



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   232 bits (592),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKSTA+FPVT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLPPL+ E+L 
Sbjct  27   PFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPPLTNEELA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+ GWVPCLEFE E G+VYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  86   KEVDYLLRSGWVPCLEFELEHGWVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLNEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  146  EECKKEYPNAFIRIIGFDNVR  166



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   232 bits (592),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  24   PFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  83   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A+ RI+GFDN R
Sbjct  143  EEAKKAYPEAFTRIIGFDNVR  163



>sp|Q42516.1|RBS1_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37438.1|AF150665_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
 emb|CAA60636.1| ribulose 1,5-bisphosphate carboxylase-oxygenase [Amaranthus hypochondriacus]
Length=183

 Score =   232 bits (592),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A+FP+TKKS+ DF+S+ +NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  27   PFNGLKSFATFPITKKSSNDFSSLPSNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             QV+YLL KGW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+
Sbjct  87   AQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEV  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDNKR
Sbjct  147  EEAKKAYPSAFIRIIGFDNKR  167



>sp|P17673.1|RBS_TRIRP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Trifolium repens]
 emb|CAA36542.1| ribulose bisphosphate carboxylase [Trifolium repens]
Length=178

 Score =   232 bits (591),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A FPVTKK+  D TSI++NGSRV CMQVWPP G KKFETLSYLPPL+ EQLL
Sbjct  24   PFTGLKSSAGFPVTKKNN-DITSITSNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLL  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPC+EFE EKGFV+R++++SPGYYDGRYWTMW+LP+FG TDA QV+ E+
Sbjct  83   KEVEYLLRKGWVPCVEFELEKGFVHRQYNSSPGYYDGRYWTMWRLPLFGTTDAAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
             ECK  YP A++RI+GFDN R
Sbjct  143  AECKAEYPEAFIRIIGFDNVR  163



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   231 bits (590),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+  WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  147  EEAKKAYPNAFIRIIGFDNTR  167



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   231 bits (590),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+  WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  147  EEAKKAYPNAFIRIIGFDNTR  167



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   231 bits (590),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L 
Sbjct  25   PFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALS  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YL++  W+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+
Sbjct  85   KEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEV  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
             ECKK YP A++R++GFDN R
Sbjct  145  GECKKEYPNAFIRVIGFDNIR  165



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   231 bits (590),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 143/167 (86%), Gaps = 3/167 (2%)
 Frame = +1

Query  19   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  192
            MASS+LSS A+AS  +A  AQASMVAPFTGLKS A+FPVT+K+  D T++++NG RVQCM
Sbjct  1    MASSILSSAAVASVNSASPAQASMVAPFTGLKSAAAFPVTRKNN-DITTLASNGGRVQCM  59

Query  193  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGY  372
            +VWPP GLKKFETLSYLP +S EQL K+V+YLL+KGW+PC+EF+   GFVYRE H SPGY
Sbjct  60   KVWPPLGLKKFETLSYLPDMSNEQLGKEVDYLLRKGWIPCIEFDIHSGFVYRENHRSPGY  119

Query  373  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            YDGRYWTMWKLPMFGCTD++QVV E+EE KK YP A++R++GFDN R
Sbjct  120  YDGRYWTMWKLPMFGCTDSSQVVNEIEEAKKEYPDAYIRVIGFDNVR  166



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  26   PFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E KKAYP A++RI+GFDN R
Sbjct  145  REAKKAYPEAFIRIIGFDNVR  165



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G+KKFETLSYLPPLS E LL
Sbjct  27   PFNGLKSISAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGMKKFETLSYLPPLSEESLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  146  EEAKKAYPEAFIRIIGFDNVR  166



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   230 bits (587),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL 
Sbjct  21   PFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQAQLG  80

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YL++ GW+PCLEF  + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  81   KEVDYLIRLGWIPCLEFSVQGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEV  140

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP +++RI+GFDNKR
Sbjct  141  EECKKEYPQSFIRIIGFDNKR  161



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS+++STA  +RA  AQ+SMVAPF GL+S+ +FP T+K+  D +++ +NG RV CMQV
Sbjct  1    MASSMMASTAAVARAGPAQSSMVAPFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPLS E L K+V+YLL+  WVPC+EF  E GFVYRE HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKR
Sbjct  120  GRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKR  164



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A+FPVTK S+ D +S+ +NG RVQCMQVWPP G KKFETLSYLPPL+TE LL
Sbjct  29   PFTGLKSIAAFPVTK-SSNDLSSLPSNGGRVQCMQVWPPLGKKKFETLSYLPPLTTEALL  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +V+YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV EL
Sbjct  88   GEVQYLLNKGWIPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNEL  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A+VRI+GFD  R
Sbjct  148  EEVKKAYPQAFVRIIGFDKNR  168



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  29   PFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             QV+YLL KGW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+
Sbjct  88   AQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEV  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDNKR
Sbjct  148  EEAKKAYPTAFIRIIGFDNKR  168



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   230 bits (586),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS+++STA  +R   AQ +MVAPF GL+S+ +FP T+K+  D +++ +NG RV CMQV
Sbjct  1    MASSMMASTAAVARVGPAQTNMVAPFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPLS E L K+V+YLL+  WVPC+EF  E GFVYRE HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKR
Sbjct  120  GRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKR  164



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score =   230 bits (586),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL 
Sbjct  21   PFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQVQLG  80

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YL++ GW+PCLEF    GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  81   KEVDYLIRLGWIPCLEFSVVGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEV  140

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDNKR
Sbjct  141  EECKKEYPQAFIRIIGFDNKR  161



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score =   230 bits (586),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  26   PFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             QV+YLL  GW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+
Sbjct  85   AQVQYLLNNGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEV  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDNKR
Sbjct  145  EEAKKAYPSAFIRIIGFDNKR  165



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score =   229 bits (585),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKSTA+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSTAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+  WVPCLEFE EKG+V+RE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVHREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLVEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
             E KKAYP A++RI+GFDN R
Sbjct  147  GEAKKAYPNAFIRIIGFDNTR  167



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   229 bits (585),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+  +L 
Sbjct  26   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEAELA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+  WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  86   KEIDYLLRSKWVPCLEFELEKGWVYRENHRSPGYYDGRYWTMWKLPMFGCTEASQVLVEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E KKAYP A++RI+GFDN R
Sbjct  146  QEAKKAYPNAFIRIIGFDNVR  166



>gb|AAF19793.1|AF162210_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Lactuca sativa]
Length=181

 Score =   229 bits (585),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L 
Sbjct  25   PFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALS  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YL++  WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+
Sbjct  85   KEIDYLIRNKWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEV  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
             ECKK YP A++R++GFD+ R
Sbjct  145  GECKKEYPNAFIRVIGFDSVR  165



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   229 bits (584),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF+GLKST++FPV++KS  D TS++TNG RV CMQVWPP  LKKFETLSYLP LS E LL
Sbjct  24   PFSGLKSTSAFPVSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLL  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K++ YLL KGWVPCLEFE     VYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV AE+
Sbjct  84   KEINYLLIKGWVPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEV  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
             ECK AYP A VRI+GFDNKR
Sbjct  144  VECKNAYPDAHVRIIGFDNKR  164



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   229 bits (583),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A+FP TKK A DF+++ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL 
Sbjct  24   PFTGLKSNAAFPTTKK-ANDFSTLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  83   KEVDYLLRKKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
             ECKK YP AW+RI+GFDN R
Sbjct  143  AECKKEYPQAWIRIIGFDNVR  163



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score =   229 bits (583),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLR  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+KGWVPCLEFE   GF YRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRKGWVPCLEFEVGYGFPYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP A+VRI+GFDN R
Sbjct  147  QEAKAAYPKAFVRIIGFDNVR  167



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   229 bits (583),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FP TKK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSASAFPGTKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  87   KEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKA P +++RI+GFDN R
Sbjct  147  EEAKKANPNSFIRIIGFDNVR  167



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   228 bits (582),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPV +K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQLL
Sbjct  27   PFVGLKSMAGFPV-RKVNNDITSIASNGGRVHCMQVWPPIGKKKFETLSYLPPLTEEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLP+FGCT+A QV+ EL
Sbjct  86   KEVEYLLRKGWVPCLEFELEKGFVYREHNNSPGYYDGRYWTMWKLPLFGCTEAVQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  KAYP A+VRI+GFDN R
Sbjct  146  QEVVKAYPNAFVRIIGFDNVR  166



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  27   PFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  146  EEAKKAYPEAFIRIIGFDNVR  166



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  27   PFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLI  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  146  EEAKKAYPEAFIRIIGFDNVR  166



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  192
            MASS+LSS A+AS  +A  AQASMVAPFTGLKS+A FP+T+K+  D T++++NG +VQCM
Sbjct  1    MASSILSSAAVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCM  60

Query  193  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGY  372
            +VWPP GL+KFETLSYLP +S EQL K+ +YLL+ GWVPC+EF+   GFVYRE H SPGY
Sbjct  61   KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGY  120

Query  373  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            YDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++R++GFDN R
Sbjct  121  YDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVR  167



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  192
            MASS+LSS  +AS  +A  AQASMVAPFTGLKS+A FP+T+K+  D T++++NG +VQCM
Sbjct  1    MASSILSSAVVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCM  60

Query  193  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGY  372
            +VWPP GL+KFETLSYLP +S EQL K+ +YLL+ GWVPC+EF+   GFVYRE H SPGY
Sbjct  61   KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGY  120

Query  373  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            YDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++R++GFDN R
Sbjct  121  YDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVR  167



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  +FPVTKKS  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL 
Sbjct  25   PFTGLKSNVAFPVTKKSN-DFSSLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+  WVPCLEFE E GF YRE + SPGYYDGRYWTMWKLPMFGC DA+QV+ EL
Sbjct  84   KEVEYLLRNKWVPCLEFELEHGFPYRENNRSPGYYDGRYWTMWKLPMFGCNDASQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
             ECKK YP +WVRI+GFDN R
Sbjct  144  NECKKEYPQSWVRIIGFDNVR  164



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FP  KK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L 
Sbjct  29   PFTGLKSASAFPGAKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLA  87

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKA P +++RI+GFDN R
Sbjct  148  EEAKKANPNSFIRIIGFDNVR  168



>gb|KEH21530.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLL
Sbjct  27   PFTGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YL++ GW+PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+
Sbjct  86   KEIDYLIRNGWIPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEV  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
             EC K YP  WVRI+GFDN R
Sbjct  146  RECLKEYPNCWVRIIGFDNVR  166



>gb|KEH21538.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>ref|XP_003637843.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>gb|KEH21531.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS+++STA  +RA  AQ++MVAPF GL+S+ +FP T+K+  + +++ +NG +V CMQV
Sbjct  1    MASSMMASTAAVARAGPAQSNMVAPFNGLRSSVAFPATRKANKNLSTLPSNGGKVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPLS E L K+V+YLL+  WVPC+EF  E GFVYRE HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKR
Sbjct  120  GRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKR  164



>ref|XP_003600302.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSVLSS A+A+ +   AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+
Sbjct  1    MASSVLSSAAVATVSRTPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMK  59

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWP   +K++ETLSYLPPL+T+QL +QV+YLL   WVPCLEFET+ GFVYRE H SPGYY
Sbjct  60   VWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYY  119

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ R
Sbjct  120  DGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNR  165



>gb|ACJ85905.1| unknown [Medicago truncatula]
 gb|AFK33847.1| unknown [Medicago truncatula]
 gb|KEH21532.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>gb|KEH21536.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>ref|XP_003636970.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  146  DEVVVAYPNAFVRIIGFDNVR  166



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  195
            MASSVLSS  +A+ +   AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+
Sbjct  1    MASSVLSSARVATVSRTPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMK  59

Query  196  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYY  375
            VWP   +K++ETLSYLPPL+T+QL +QV+YLL   WVPCLEFET+ GFVYRE H SPGYY
Sbjct  60   VWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYY  119

Query  376  DGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            DGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+GFD+ R
Sbjct  120  DGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNR  165



>gb|KDP29409.1| hypothetical protein JCGZ_18330 [Jatropha curcas]
Length=153

 Score =   226 bits (575),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST++F VT+K+  D TSIS+ G RVQCMQVWPP G K FETLSYLPPLS +QL 
Sbjct  4    PFTGLKSTSAFSVTRKNNTDITSISSKGGRVQCMQVWPPVGKKFFETLSYLPPLSQDQLA  63

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V YLL+   VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  64   KEVHYLLRMDRVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  123

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE K AYP +++RI+GFDNKR
Sbjct  124  EEAKTAYPNSFIRIIGFDNKR  144



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   226 bits (577),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  143  EECKKEYPGAFIRIIGFDNTR  163



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score =   226 bits (575),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            +QV+YLL   WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  136

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFD+ R
Sbjct  137  EECKKEYPNAFIRIIGFDSNR  157



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   226 bits (576),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  143  EECKKEYPGAFIRIIGFDNTR  163



>ref|XP_008339672.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE K AYP +++RI+GFDN R
Sbjct  147  EEAKTAYPNSFIRIIGFDNVR  167



>gb|AIR75136.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
 gb|AIR75137.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            +QV+YLL   WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  136

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFD+ R
Sbjct  137  EECKKEYPNAFIRIIGFDSNR  157



>gb|AIL82451.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            +QV+YLL   WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  136

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFD+ R
Sbjct  137  EECKKEYPNAFIRIIGFDSNR  157



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP  ++RI+GFDN R
Sbjct  143  QEAKTAYPNGFIRIIGFDNVR  163



>ref|XP_010521010.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASSV+SS    +  + +Q++++APFTGLKS A+FPVT+K+ AD TS+++NGS+V CMQV
Sbjct  1    MASSVVSSATTVAGVSRSQSAVIAPFTGLKSAAAFPVTRKNNADLTSLASNGSKVNCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WP  GL+KFETLSYLP LS  +L K+V+YLL+  W+PCLEFE    FVYRE H SPGYYD
Sbjct  61   WPTTGLRKFETLSYLPDLSDTELAKEVDYLLRNNWIPCLEFELGNAFVYRENHRSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTD+ QV+ EL+E K  +P A +RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDSAQVMKELQEAKTTHPDAHIRIIGFDNVR  165



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP  ++RI+GFDN R
Sbjct  143  QEAKTAYPNGFIRIIGFDNVR  163



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  19   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + PGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  79   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  139  EECKKEYPNAFIRIIGFDNVR  159



>ref|XP_008352922.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ E 
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEX  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE K AYP +++RI+GFDN R
Sbjct  147  EEAKTAYPNSFIRIIGFDNVR  167



>emb|CDP20139.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLL
Sbjct  4    PFTGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLL  62

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YL++ GW+PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+
Sbjct  63   KEIDYLIRNGWIPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEV  122

Query  451  EECKKAYPGAWVRILGFDNKR  513
             EC K YP  WVRI+GFDN R
Sbjct  123  RECLKEYPNCWVRIIGFDNVR  143



>sp|P07689.1|RBS3_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3A, 
chloroplastic; Short=RuBisCO small subunit 3A; Flags: Precursor 
[Pisum sativum]
 emb|CAA27864.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236A carboxylase,ribulose bisphosphate
Length=180

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS   FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLL
Sbjct  26   PFGGLKSMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLL  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  85   KEVEYLLRKGWVPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  145  DEVVAAYPQAFVRIIGFDNVR  165



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  131  EECKKEYPGAFIRIIGFDNTR  151



>sp|P00869.1|RBS2_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3C, 
chloroplastic; Short=RuBisCO small subunit 3C; AltName: Full=PSS15; 
Flags: Precursor [Pisum sativum]
 emb|CAA27865.1| ribulose 1.5-bisphosphate carboxylase (RBC) [Pisum sativum]
 emb|CAA25390.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236B carboxylase,ribulose bisphosphate
Length=180

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS   FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLL
Sbjct  26   PFGGLKSMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLL  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  85   KEVEYLLRKGWVPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFDN R
Sbjct  145  DEVVAAYPQAFVRIIGFDNVR  165



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  143  EECKKEYPGAFIRIIGFDNTR  163



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP  ++RI+GFDN R
Sbjct  143  QEAKTAYPNGFIRIIGFDNVR  163



>gb|AIR75143.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum virgatum]
Length=139

 Score =   224 bits (570),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP  +KK+ETLSYLPPL+TE LL
Sbjct  5    PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPTNMKKYETLSYLPPLTTESLL  63

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +V+YLL KGW+PCLEFETE GFVYRE   SPGYYDGRYWTMWKLPMFGCTD  QVV EL
Sbjct  64   AEVQYLLNKGWIPCLEFETEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTDPAQVVNEL  123

Query  451  EECKKAYPGAWVRILG  498
            +ECKKAYP A++RI+G
Sbjct  124  DECKKAYPNAFIRIIG  139



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNKDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  143  EECKKEYPGAFIRIIGFDNTR  163



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  143  EECKKEYPGAFIRIIGFDNTR  163



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  192
            MASS+LSS A+AS  +A  AQASMVAPFTGLKS+A FP+T+K+  D T++++N  +VQCM
Sbjct  1    MASSILSSAAVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNAGKVQCM  60

Query  193  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGY  372
            +VWPP GL+KFETLSYLP +S EQL K+ +YLL+ GWVPC+EF+   GFVYRE H SPG+
Sbjct  61   KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGF  120

Query  373  YDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            YDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++R++GFDN R
Sbjct  121  YDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVR  167



>gb|AEX60840.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  144  EECKKAYPNAFIRIIGFDNVR  164



>ref|XP_009356790.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSFSAFPVTRK-ANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPPLSPESLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ EL
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE K AYP +++RI+GFDN R
Sbjct  147  EEAKTAYPNSFIRIIGFDNVR  167



>gb|KEH21537.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=192

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDN  507
            +E   AYP A+VRI+GFDN
Sbjct  146  DEVVVAYPNAFVRIIGFDN  164



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   224 bits (572),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT K+  D TS+++NGS+V CMQVWPP G KKFETLSYLP LS   L 
Sbjct  27   PFTGLKSSAAFPVTHKTNFDITSLASNGSKVHCMQVWPPVGKKKFETLSYLPDLSEVSLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE + SPGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  87   KEVDYLLRNKWIPCVEFELEHGFVYREHNKSPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  147  EECKKEYPNAFIRIIGFDNSR  167



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   224 bits (572),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP A++RI+GFDN R
Sbjct  143  QEAKTAYPNAFIRIIGFDNVR  163



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   224 bits (570),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  131  EECKKEYPGAFIRIIGFDNTR  151



>gb|AIF75302.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
 gb|AIF75308.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75309.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score =   224 bits (570),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF+GLKS   FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFSGLKSLGGFPVTRKTN-DITSVANNGGRVQCMQVWPPLGKKKFETLSYLPDLNEEQLR  77

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+KGWVPCLEFE E GF YRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRKGWVPCLEFEVEYGFPYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKEL  137

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP A+VRI+GFDN R
Sbjct  138  QEAKAAYPKAFVRIIGFDNVR  158



>gb|AIF75300.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
 gb|AIF75310.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score =   224 bits (570),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF+GLKS   FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFSGLKSLGGFPVTRKTN-DITSVTNNGGRVQCMQVWPPLGKKKFETLSYLPDLNEEQLR  77

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+KGWVPCLEFE E GF YRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRKGWVPCLEFEVEYGFPYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKEL  137

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP A+VRI+GFDN R
Sbjct  138  QEAKAAYPKAFVRIIGFDNVR  158



>gb|AIF75301.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75303.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75306.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75307.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score =   223 bits (569),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF+GLKS   FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFSGLKSLGGFPVTRKTN-DITSVANNGGRVQCMQVWPPLGKKKFETLSYLPDLNEEQLR  77

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+KGWVPCLEFE E GF YRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRKGWVPCLEFEVEYGFPYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKEL  137

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP A+VRI+GFDN R
Sbjct  138  QEAKAAYPKAFVRIIGFDNVR  158



>gb|AIF75288.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   224 bits (570),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  131  EECKKEYPGAFIRIIGFDNTR  151



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   224 bits (571),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 2/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS ++FPVT+K+  D TS+++NG RVQCM VWPP G+KKFETLSYLPPLS E LL
Sbjct  27   PFNGLKSISAFPVTRKNN-DITSVASNGGRVQCM-VWPPLGMKKFETLSYLPPLSEESLL  84

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL  GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EE KKAYP A++RI+GFDN R
Sbjct  145  EEAKKAYPEAFIRIIGFDNVR  165



>gb|KEH21539.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYL++KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E   AYP A+VRI+GFD  R
Sbjct  146  DEVVDAYPNAFVRIIGFDKVR  166



>gb|AFS41763.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
 gb|AFS41764.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score =   223 bits (569),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  16   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  75

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  76   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  135

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  136  EECKKAYPNAFIRIIGFDNVR  156



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score =   224 bits (570),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  144  EECKKAYPNAFIRIIGFDNVR  164



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score =   224 bits (570),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  144  EECKKAYPNAFIRIIGFDNVR  164



>ref|XP_010926041.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   224 bits (570),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST++FPVT++++ DF+ + +NG RV+CMQVWP  G KKFETLSYLPPLS E LL
Sbjct  26   PFTGLKSTSAFPVTRRASNDFSKLPSNGGRVRCMQVWPIEGKKKFETLSYLPPLSIEALL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            KQ+EYLL+ GW+PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC DA QV  EL
Sbjct  86   KQIEYLLRSGWIPCLEF-CKVGFVYRENHQSPGYYDGRYWTMWKLPMFGCNDAAQVAKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP  ++RI+GFDN R
Sbjct  145  DECKKEYPDVFIRIIGFDNVR  165



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   224 bits (570),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  144  EECKKAYPNAFIRIIGFDNVR  164



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   224 bits (570),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  144  EECKKAYPNAFIRIIGFDNVR  164



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A +RI+GFDN R
Sbjct  143  QECKKEYPNALIRIIGFDNNR  163



>gb|AEX60837.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVARKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  144  EECKKAYPNAFIRIIGFDNVR  164



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPVGKKKFETLSYLPDLTDSELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPEAFIRIIGFDNSR  163



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKSTA FP  +K+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTAGFPA-RKTTNDITSIASNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+ GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+ EL
Sbjct  86   KEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  KA+P  +VRI+GFD+ R
Sbjct  146  DEAIKAHPNGFVRIIGFDSYR  166



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNTR  163



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  147  EECKKEYPNAFIRIIGFDNVR  167



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  147  EECKKEYPNAFIRIIGFDNVR  167



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A+FP TKK A DF+++ +NG RVQCM+VWPP G KK+ETLSYLP L+  QL 
Sbjct  24   PFTGLKSNAAFPATKK-ANDFSTLPSNGGRVQCMKVWPPLGKKKYETLSYLPNLTEAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  83   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP AW+RI+GFDN R
Sbjct  143  QECKKEYPQAWIRIIGFDNVR  163



>gb|AIR75138.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia tetrandra]
Length=165

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            +QV+YLL   WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  136

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+G D+ R
Sbjct  137  EECKKEYPNAFIRIIGSDSNR  157



>gb|AEX60836.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium raimondii]
Length=168

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  147  EECKKEYPNAFIRIIGFDNVR  167



>sp|P00865.1|RBS1_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Glycine max]
 emb|CAA23736.1| rubpcase [Glycine max]
Length=178

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE + SP YYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPXYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP  ++RI+GFDN R
Sbjct  143  QEAKTAYPNGFIRIIGFDNVR  163



>gb|AFS41765.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium armourianum]
 gb|AFS41767.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
Length=168

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  19   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  79   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  139  EECKKEYPNAFIRIIGFDNVR  159



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF+GLKSTASFP+ +K+  D T++++NG RVQCMQVWPP G  KFETLSYLP L+ EQLL
Sbjct  28   PFSGLKSTASFPINQKTN-DITALASNGGRVQCMQVWPPRGKLKFETLSYLPDLTDEQLL  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+++YLL+  W+PCLEFE  K  +YRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  87   KEIDYLLRSNWIPCLEFEVGKAHIYRENNRSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E KKAYP A VRI+GFDN R
Sbjct  147  QETKKAYPDAHVRIIGFDNNR  167



>gb|AIF75295.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YPGA++RI+GFDN R
Sbjct  131  EECKKEYPGAFIRIIGFDNTR  151



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSATFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A++RI+GFDN R
Sbjct  143  QECKKEYPNAFIRIIGFDNNR  163



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVW P G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWAPVGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP  ++RI+GFDN R
Sbjct  143  QEAKTAYPNGFIRIIGFDNVR  163



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDTISIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP  ++RI+GFDN R
Sbjct  143  QEAKTAYPNGFIRIIGFDNVR  163



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNNR  163



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A+FPVTKK   DF+++++NG RVQCM+VWPP G K++ETLSYLP L+  QL 
Sbjct  19   PFTGLKSNAAFPVTKK-VNDFSTLASNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLA  77

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  137

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP AW+RI+GFDN R
Sbjct  138  QECKKEYPQAWIRIIGFDNVR  158



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB10449.1| hypothetical protein B456_001G201800 [Gossypium raimondii]
Length=182

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  147  EECKKEYPNAFIRIIGFDNVR  167



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YL++  W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNTR  163



>gb|AIR75144.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum bonus-henricus]
Length=150

 Score =   221 bits (563),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP  +KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPTNMKKYETLSYLPPLTTESLL  76

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
             +V+YLL KGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGCTD  QVV EL
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPAQVVNEL  136

Query  451  EECKKAYPGAWVRI  492
            +ECKKAYP A++RI
Sbjct  137  DECKKAYPNAFIRI  150



>gb|AFS41766.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium armourianum]
 gb|AFS41768.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
 gb|AFS41769.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
Length=165

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  16   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  75

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  76   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  135

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  136  EECKKEYPNAFIRIIGFDNVR  156



>gb|AEX60838.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium raimondii]
Length=165

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  144  EECKKEYPNAFIRIIGFDNVR  164



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score =   222 bits (565),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVIRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  144  EECKKAYPNAFIRIIGFDNVR  164



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNTR  163



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   222 bits (565),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNTR  163



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   222 bits (565),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A+FPVTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL 
Sbjct  19   PFTGLKSNAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTESQLA  77

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  137

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP AW+RI+GFDN R
Sbjct  138  QECKKEYPQAWIRIIGFDNVR  158



>sp|P19310.1|RBS4_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40B, 
chloroplastic; Short=RuBisCO small subunit SSU40B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35103.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   222 bits (565),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS+++STA A        + + PF   +S+  FP T+K+  D +++ +NG RV CMQV
Sbjct  1    MASSMMASTAAAVARAGPAQTNMVPFNACRSSVPFPATRKANNDLSTLPSNGGRVSCMQV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WPP GLKKFETLSYLPPLS E L K+V+YLL+  WVPC+EF  E GFVYRE HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYD  119

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +VRI+GFDNKR
Sbjct  120  GRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKR  164



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNTR  163



>gb|AAA82069.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Glycine soja]
Length=178

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+KGW+PCLEFE E GFVYRE + SPGYYDGR WTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRCWTMWKLPMFGCTDASQVLKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E K AYP  ++RI+GFDN R
Sbjct  143  QEAKTAYPNGFIRIIGFDNVR  163



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  144  EECKKEYPNAFIRIIGFDNVR  164



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECK  YP A++RI+GFDN R
Sbjct  143  QECKTEYPNAFIRIIGFDNNR  163



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKSTA FP  +K+  D TSI+ NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTAGFPA-RKTTNDITSIAGNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLA  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+VEYLL+ GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+ EL
Sbjct  86   KEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNEL  145

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +E  KA+P  +VRI+GFD+ R
Sbjct  146  DEAIKAHPNGFVRIIGFDSYR  166



>ref|XP_010551266.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +1

Query  19   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  198
            MASS++SS A  S  + AQ++++APFTGLKS+A+FPVT+K+ AD TS+++NGS+V CM+V
Sbjct  1    MASSIVSSAATVSGVSRAQSAVIAPFTGLKSSAAFPVTRKNNADITSLASNGSKVNCMKV  60

Query  199  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYD  378
            WP  GL+KFETLSYLP L+  +L K+V+YLL+  W+PCLEFE    FVYRE H SPGYYD
Sbjct  61   WPTTGLRKFETLSYLPDLTDAELAKEVDYLLRNNWIPCLEFELGNAFVYRENHRSPGYYD  120

Query  379  GRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKR  513
            GRYWTMWKLPMFGCTD+ QV+ EL+E + A+P   +RI+GFDN R
Sbjct  121  GRYWTMWKLPMFGCTDSAQVMKELQEARTAHPDGHIRIIGFDNVR  165



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   221 bits (563),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELA  70

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YL++  W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  131  EECKKEYPNAFIRIIGFDNTR  151



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score =   222 bits (565),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG +V CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGKVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNTR  163



>gb|AFS41771.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=165

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  16   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  75

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  76   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  135

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  136  EECKKEYPNAFIRIIGFDNVR  156



>gb|AEX60835.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=171

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            E CKK YP A++RI+GFDN R
Sbjct  147  ENCKKEYPNAFIRIIGFDNVR  167



>gb|AFS41754.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEDGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  144  EECKKEYPNAFIRIIGFDNVR  164



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECK  YP A++RI+GFDN R
Sbjct  143  QECKTEYPNAFIRIIGFDNNR  163



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   221 bits (564),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A++RI+GFDN R
Sbjct  143  QECKKEYPNAFIRIIGFDNNR  163



>gb|AFS41729.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41736.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41751.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=182

 Score =   221 bits (564),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            E CKK YP A++RI+GFDN R
Sbjct  147  ENCKKEYPNAFIRIIGFDNVR  167



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   221 bits (564),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECK  YP A++RI+GFDN R
Sbjct  139  QECKTEYPNAFIRIIGFDNNR  159



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score =   221 bits (564),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A+FP TKK A DF+++  NG RVQCM+VWPP GLKK+ETLSYLP L+  QL 
Sbjct  24   PFTGLKSNAAFPATKK-ANDFSTLPNNGGRVQCMKVWPPLGLKKYETLSYLPTLTETQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFVYRE   SPGYYDGR+WTMWKLPMFGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWVPCLEFELEHGFVYREHARSPGYYDGRHWTMWKLPMFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
             ECKK YP AW+RI+GFDN R
Sbjct  143  GECKKEYPQAWIRIIGFDNVR  163



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score =   221 bits (563),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECK  YP A++RI+GFDN R
Sbjct  139  QECKTEYPNAFIRIIGFDNNR  159



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+ASFP T+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSASFPATRKANNDITSITSNGGRVNCMKVWPPVGKKKFETLSYLPDLTDSELA  70

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  131  EECKKEYPEAFIRIIGFDNNR  151



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   221 bits (563),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A++RI+GFDN R
Sbjct  143  QECKKEYPNAFIRIIGFDNNR  163



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score =   221 bits (563),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A++RI+GFDN R
Sbjct  143  QECKKEYPNAFIRIIGFDNNR  163



>ref|XP_008807113.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=180

 Score =   221 bits (563),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKST++FP T++++ DF+ + +NG RVQCM+VWP  G+KKFETLSYLPPL  E LL
Sbjct  26   PFTGLKSTSAFPATRRASNDFSKLPSNGGRVQCMKVWPIEGVKKFETLSYLPPLPIEALL  85

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            KQ+EYLL+  W+PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC DA QV  EL
Sbjct  86   KQIEYLLRSRWIPCLEF-CKIGFVYRENHRSPGYYDGRYWTMWKLPMFGCNDAAQVAKEL  144

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  145  EECKKEYPDAFIRIIGFDNVR  165



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS A+FPVTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL 
Sbjct  19   PFTGLKSNAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLA  77

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  137

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP AW+RI+GFDN R
Sbjct  138  QECKKEYPQAWIRIIGFDNVR  158



>gb|AFS41725.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB43047.1| hypothetical protein B456_007G181300 [Gossypium raimondii]
 gb|KJB43048.1| hypothetical protein B456_007G181400 [Gossypium raimondii]
Length=179

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  144  EECKKEYPNAFIRIIGFDNVR  164



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKTDTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELS  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A++RI+GFDN R
Sbjct  139  QECKKEYPNAFIRIIGFDNNR  159



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECK  YP A++RI+GFDN R
Sbjct  139  QECKTEYPNAFIRIIGFDNNR  159



>gb|AFS41762.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=168

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  19   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  79   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            E CKK YP A++RI+GFDN R
Sbjct  139  ENCKKEYPNAFIRIIGFDNVR  159



>gb|AFS41727.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41734.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41742.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            E CKK YP A++RI+GFDN R
Sbjct  147  ENCKKEYPNAFIRIIGFDNVR  167



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFNGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKK YP A++RI+GFDN R
Sbjct  143  EECKKEYPNAFIRIIGFDNNR  163



>sp|Q39743.1|RBS1_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67845.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   221 bits (562),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLK+ A+FPVTKK   DF+++ +NG RVQCM+VWPP G KK+ETLSYLP L+  QL 
Sbjct  19   PFTGLKANAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKKYETLSYLPDLTEVQLA  77

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  137

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP AW+RI+GFDN R
Sbjct  138  QECKKEYPQAWIRIIGFDNVR  158



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score =   220 bits (561),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A++RI+GFDN R
Sbjct  131  QECKKEYPNAFIRIIGFDNNR  151



>sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Gossypium hirsutum]
 emb|CAA38026.1| ribulose bisphosphate carboxylase [Gossypium hirsutum]
 gb|AEX60834.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41721.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41726.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41741.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41749.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41755.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG14838.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   221 bits (563),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            E CKK YP A++RI+GFDN R
Sbjct  147  ENCKKEYPNAFIRIIGFDNVR  167



>gb|KHG18747.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL  L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLTDLTPVQLA  86

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  146

Query  451  EECKKAYPGAWVRILGFDNKR  513
            EECKKAYP A++RI+GFDN R
Sbjct  147  EECKKAYPNAFIRIIGFDNVR  167



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS+A+FPVT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECK  YP A++RI+GFDN R
Sbjct  139  QECKTEYPNAFIRIIGFDNNR  159



>sp|Q39744.1|RBS2_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67846.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PFTGLKS  +FP TKK A DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL 
Sbjct  24   PFTGLKSNVAFPATKK-ANDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTEAQLA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  83   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP AW+RI+GFDN R
Sbjct  143  QECKKEYPQAWIRIIGFDNVR  163



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  91   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  270
            PF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  271  KQVEYLLKKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  450
            K+V+YLL+  W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  451  EECKKAYPGAWVRILGFDNKR  513
            +ECKK YP A++RI+GFDN R
Sbjct  143  QECKKEYPNAFIRIIGFDNNR  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720