BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN025E24

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002023314.1|  GL20619                                          59.3    4e-08   
gb|AAO92744.1|  ubiquitin                                             53.1    8e-07   Gossypium hirsutum [American cotton]
gb|AAG13985.1|AF298826_1  ubiquitin/ribosomal protein 27a             54.7    9e-07   Prunus avium [gean]
ref|XP_006747376.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  40.0    1e-06   Leptonychotes weddellii
gb|AAZ83341.1|  ubiquitin extension protein                           53.9    2e-06   Gossypium hirsutum [American cotton]
gb|AIX10775.1|  ubiquitin                                             53.9    2e-06   Panax notoginseng [san-qi]
gb|AHA83529.1|  ubiquitin extension protein                           53.9    2e-06   Hevea brasiliensis [jebe]
gb|KJB06862.1|  hypothetical protein B456_001G146500                  53.5    3e-06   Gossypium raimondii
ref|XP_008362581.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.4    3e-06   
emb|CAA80334.1|  ubiquitin extension protein                          52.8    3e-06   Lupinus albus
ref|XP_004489824.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    3e-06   Cicer arietinum [garbanzo]
gb|ADF36485.1|  ubiquitin extension protein                           52.8    3e-06   Ageratina adenophora
ref|XP_006424488.1|  hypothetical protein CICLE_v10029476mg           52.8    3e-06   Citrus clementina [clementine]
ref|XP_005863705.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  41.6    4e-06   Myotis brandtii
ref|XP_002525394.1|  ubiquitin, putative                              52.8    4e-06   Ricinus communis
ref|XP_007157375.1|  hypothetical protein PHAVU_002G065000g           52.8    4e-06   Phaseolus vulgaris [French bean]
ref|XP_004504241.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    4e-06   
ref|XP_006488031.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    4e-06   Citrus sinensis [apfelsine]
gb|KJB49764.1|  hypothetical protein B456_008G136200                  53.5    4e-06   Gossypium raimondii
ref|XP_003613203.1|  Ubiquitin                                        52.8    4e-06   Medicago truncatula
ref|NP_001238181.1|  uncharacterized protein LOC100527579             52.8    4e-06   Glycine max [soybeans]
ref|XP_011079491.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  52.8    4e-06   Sesamum indicum [beniseed]
ref|XP_011040332.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    4e-06   Populus euphratica
ref|NP_001275323.1|  putative ubiquitin extension protein             52.8    4e-06   Solanum tuberosum [potatoes]
emb|CAN80663.1|  hypothetical protein VITISV_036195                   52.8    4e-06   Vitis vinifera
gb|ACJ83917.1|  unknown                                               52.8    4e-06   Medicago truncatula
ref|XP_004229050.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  52.8    4e-06   
sp|P62980.2|RS27A_SOLLC  RecName: Full=Ubiquitin-40S ribosomal pr...  52.8    4e-06   Solanum lycopersicum
ref|XP_002320950.1|  ubiquitin/ribosomal protein 27a                  52.8    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002270170.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  52.8    4e-06   Vitis vinifera
gb|AFK43562.1|  unknown                                               52.8    4e-06   Medicago truncatula
ref|XP_008358198.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    4e-06   
ref|XP_008389677.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  52.8    4e-06   Malus domestica [apple tree]
gb|KDP26615.1|  hypothetical protein JCGZ_17773                       52.8    4e-06   Jatropha curcas
ref|XP_011082406.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  52.8    4e-06   Sesamum indicum [beniseed]
ref|NP_001269170.1|  ubiquitin-40S ribosomal protein S27a-like        52.8    4e-06   Cucumis sativus [cucumbers]
ref|NP_001275598.1|  ubiquitin-40S ribosomal protein S27a-like        52.8    4e-06   Solanum tuberosum [potatoes]
gb|AFK49579.1|  unknown                                               52.8    4e-06   Lotus japonicus
ref|XP_006374591.1|  ubiquitin/ribosomal protein 27a                  52.8    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002279878.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  52.8    4e-06   Vitis vinifera
gb|ABN72579.1|  ubiquitin extension protein                           52.8    4e-06   Hevea brasiliensis [jebe]
gb|ABI84265.1|  ubiquitin/ribosomal protein S27a                      52.8    4e-06   Arachis hypogaea [goober]
gb|EYU46866.1|  hypothetical protein MIMGU_mgv1a015483mg              52.8    4e-06   Erythranthe guttata [common monkey flower]
gb|ABK42077.1|  ubiquitin extension protein                           52.8    4e-06   Capsicum annuum
gb|EYU38434.1|  hypothetical protein MIMGU_mgv1a015486mg              52.8    4e-06   Erythranthe guttata [common monkey flower]
ref|XP_004142977.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    4e-06   Cucumis sativus [cucumbers]
gb|EPS73110.1|  hypothetical protein M569_01646                       52.4    4e-06   Genlisea aurea
sp|P59272.2|RS27A_DAUCA  RecName: Full=Ubiquitin-40S ribosomal pr...  52.4    5e-06   Daucus carota [carrots]
ref|XP_006349858.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    5e-06   Solanum tuberosum [potatoes]
ref|XP_003535084.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.0    6e-06   Glycine max [soybeans]
gb|KGN51791.1|  hypothetical protein Csa_5G600925                     52.8    6e-06   Cucumis sativus [cucumbers]
ref|XP_008793306.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.0    7e-06   Phoenix dactylifera
ref|XP_011003162.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.8    7e-06   Populus euphratica
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  53.1    8e-06   Eucalyptus grandis [rose gum]
ref|XP_008781194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  52.0    8e-06   Phoenix dactylifera
ref|XP_010941490.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.0    8e-06   Elaeis guineensis
ref|XP_003634320.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  51.6    9e-06   Vitis vinifera
gb|AEI29168.1|  ubiquitin-like protein                                51.2    9e-06   Phragmipedium longifolium
ref|XP_003629895.1|  Ubiquitin                                        52.8    1e-05   
ref|XP_010270921.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.6    1e-05   Nelumbo nucifera [Indian lotus]
gb|AAO38879.1|  ubiquitin/ribosomal fusion protein                    51.6    1e-05   Malus domestica [apple tree]
gb|AAZ53360.1|  ubiquitin extension protein                           51.6    1e-05   Nicotiana tabacum [American tobacco]
ref|XP_004288657.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  51.6    1e-05   Fragaria vesca subsp. vesca
ref|XP_010270924.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.6    1e-05   Nelumbo nucifera [Indian lotus]
sp|P47905.2|RS27A_LUPAL  RecName: Full=Ubiquitin-40S ribosomal pr...  51.2    1e-05   Lupinus albus
ref|XP_007051235.1|  Ribosomal protein S27a / Ubiquitin family pr...  51.6    1e-05   
ref|XP_010040181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.2    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  52.4    2e-05   
gb|KCW58175.1|  hypothetical protein EUGRSUZ_H00892                   50.8    2e-05   Eucalyptus grandis [rose gum]
ref|XP_006492389.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  50.8    2e-05   
ref|XP_010248517.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  50.8    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010914705.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.2    2e-05   Elaeis guineensis
ref|XP_010914704.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.2    2e-05   Elaeis guineensis
gb|ACJ84122.1|  unknown                                               50.8    2e-05   Medicago truncatula
ref|XP_002979704.1|  hypothetical protein SELMODRAFT_111605           49.7    2e-05   
ref|XP_008776477.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  50.4    2e-05   Phoenix dactylifera
ref|XP_010914702.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.2    2e-05   Elaeis guineensis
ref|XP_001774978.1|  predicted protein                                50.4    2e-05   
ref|XP_010914703.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.2    3e-05   
sp|P31753.2|RS27A_ASPOF  RecName: Full=Ubiquitin-40S ribosomal pr...  49.7    3e-05   Asparagus officinalis
gb|AER12038.1|  ubiquitin extension protein                           50.1    3e-05   Paeonia suffruticosa [moutan peony]
ref|XP_010914701.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  51.2    3e-05   
gb|ABH08969.1|  ubiquitin extension protein                           50.1    4e-05   Morus bombycis
gb|AAL66206.1|AF386524_1  ubiquitin extension protein                 49.7    4e-05   Pyrus communis
gb|ABR16172.1|  unknown                                               49.7    4e-05   Picea sitchensis
ref|XP_010251196.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  49.7    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006846976.1|  hypothetical protein AMTR_s00017p00094950        49.3    6e-05   Amborella trichopoda
gb|AFX96040.1|  ubiquitin extension protein                           49.3    6e-05   Grimmia pilifera
ref|XP_001754264.1|  predicted protein                                49.3    6e-05   
ref|XP_001762629.1|  predicted protein                                49.3    6e-05   
ref|XP_010675161.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  49.3    6e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|AEI29167.1|  ubiquitin-like protein                                48.9    6e-05   Phalaenopsis hybrid cultivar
ref|NP_001238483.1|  uncharacterized protein LOC100527854             49.3    7e-05   
gb|KJB22478.1|  hypothetical protein B456_004G049300                  48.5    9e-05   Gossypium raimondii
gb|KDO86852.1|  hypothetical protein CISIN_1g031604mg                 48.5    9e-05   Citrus sinensis [apfelsine]
ref|XP_006832935.1|  hypothetical protein AMTR_s00095p00146440        48.5    1e-04   Amborella trichopoda
ref|XP_009772672.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  48.5    1e-04   Nicotiana sylvestris
ref|XP_009383724.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  48.5    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003062279.1|  predicted protein                                48.1    2e-04   Micromonas pusilla CCMP1545
ref|XP_009385375.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  48.1    2e-04   
ref|XP_003568865.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  48.1    2e-04   Brachypodium distachyon [annual false brome]
gb|AGC65581.1|  UBQ5                                                  48.1    2e-04   Agrostis stolonifera [creeping bent grass]
ref|NP_001042915.1|  Os01g0328400                                     48.1    2e-04   
ref|XP_004968668.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  48.1    2e-04   Setaria italica
gb|AIH15195.1|  ubiquitin-40S ribosomal protein S27a-like protein     48.1    2e-04   Hedychium coronarium
ref|XP_009416508.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  48.1    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEE98366.1|  ubiquitin                                             48.1    2e-04   Deschampsia antarctica
gb|ACA24140.1|  ubiquitin                                             48.1    2e-04   Lolium temulentum
gb|AEO11783.1|  ubiquitin                                             47.8    2e-04   Lolium perenne [perennial ryegrass]
gb|ABR29645.1|  ubiquitin                                             47.8    2e-04   Lolium perenne [perennial ryegrass]
gb|AAP22047.1|  40S ribosomal protein                                 46.2    2e-04   Oreochromis mossambicus [Hawaiian perch]
gb|AEE98367.1|  ubiquitin                                             46.6    2e-04   Deschampsia antarctica
ref|XP_009414918.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  47.8    3e-04   
ref|XP_006001599.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  47.8    3e-04   Latimeria chalumnae
ref|XP_010513784.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  46.6    3e-04   Camelina sativa [gold-of-pleasure]
gb|ABV58643.1|  ubquitin                                              46.6    4e-04   Catharanthus roseus [chatas]
gb|AAW56553.1|  ubiquitin/s27a 40s ribosomal protein                  47.4    4e-04   Nicotiana benthamiana
ref|XP_006071278.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  35.4    4e-04   
tpg|DAA26453.1|  TPA: ubiquitin and ribosomal protein S27a-like       47.0    4e-04   Bos taurus [bovine]
gb|KFK35409.1|  hypothetical protein AALP_AA5G280900                  47.0    5e-04   Arabis alpina [alpine rockcress]
gb|AEC11011.1|  ubiquitin extension protein                           45.1    5e-04   Camellia sinensis [black tea]
ref|XP_004330561.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  47.0    5e-04   
ref|XP_009133797.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  47.0    5e-04   Brassica rapa
ref|XP_009104378.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  47.0    5e-04   Brassica rapa
ref|NP_566095.1|  ubiquitin-40S ribosomal protein S27a-2              47.0    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506742.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  47.0    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003567648.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  47.0    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_010451574.1|  PREDICTED: ubiquitin-like protein 1-40S ribo...  48.1    5e-04   
ref|XP_010507927.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  47.0    5e-04   Camelina sativa [gold-of-pleasure]
sp|P0CG86.1|RS271_HORVU  RecName: Full=Ubiquitin-40S ribosomal pr...  46.6    5e-04   Hordeum vulgare [barley]
ref|XP_004977103.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  46.6    5e-04   Setaria italica
gb|AFI60245.1|  ubiquitin                                             46.6    5e-04   Panicum virgatum
ref|XP_009116899.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  47.0    5e-04   Brassica rapa
ref|XP_006866205.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  46.6    5e-04   Chrysochloris asiatica
ref|XP_006402395.1|  hypothetical protein EUTSA_v10006290mg           46.6    6e-04   Eutrema salsugineum [saltwater cress]
ref|XP_006397903.1|  hypothetical protein EUTSA_v10001668mg           46.6    6e-04   Eutrema salsugineum [saltwater cress]
ref|NP_191784.1|  ubiquitin-40S ribosomal protein S27a-3              46.6    6e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ACO08429.1|  Ubiquitin                                             46.6    6e-04   Oncorhynchus mykiss
ref|XP_002876668.1|  hypothetical protein ARALYDRAFT_486730           46.6    6e-04   
ref|NP_001133210.1|  ribosomal protein S27-3                          46.6    6e-04   Salmo salar
gb|ACH71005.1|  ribosomal protein S27-3                               46.6    6e-04   Salmo salar
emb|CAG12343.1|  unnamed protein product                              46.2    6e-04   Tetraodon nigroviridis
ref|XP_010413295.1|  PREDICTED: ubiquitin-40S ribosomal protein S...  46.6    6e-04   Camelina sativa [gold-of-pleasure]
gb|AEY84966.1|  ubiquitin                                             45.1    7e-04   Alopecurus myosuroides
gb|AAM27203.1|AF502248_1  40s ribosomal protein S27a                  46.6    7e-04   Epinephelus coioides [estuary cod]
ref|NP_956796.1|  ubiquitin-40S ribosomal protein S27a                46.6    7e-04   Danio rerio [leopard danio]
ref|XP_011482499.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  46.6    7e-04   
gb|AAH49478.1|  Zgc:66168 protein                                     46.6    8e-04   Danio rerio [leopard danio]
gb|AGO97083.1|  ubiquitin                                             46.2    8e-04   Cymbidium faberi
gb|AEA51100.1|  ubiquitin                                             46.6    8e-04   Oryzias melastigma [Java medaka]
ref|XP_002457768.1|  hypothetical protein SORBIDRAFT_03g013260        46.2    8e-04   Sorghum bicolor [broomcorn]
ref|XP_008640291.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a  46.2    0.001   
ref|XP_002501200.1|  predicted protein                                46.2    0.001   Micromonas commoda
dbj|BAA25826.1|  ribosomal protein S27a                               44.3    0.001   Homo sapiens [man]



>ref|XP_002023314.1| GL20619 [Drosophila persimilis]
 gb|EDW27462.1| GL20619 [Drosophila persimilis]
Length=231

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    FVKTLTVQYHLPRGCILRHHQTMLKAKIPEHEGLPPDQ*RLVFDGNHLQD  152
            FVKTL  Q H PRG  L HH+   KAKI + EG+PPDQ RL+F G  L+D
Sbjct  80   FVKTLDWQDHHPRGRALGHHRESFKAKIQDKEGIPPDQQRLIFAGKQLED  129



>gb|AAO92744.1| ubiquitin [Gossypium hirsutum]
Length=65

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  IYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             YK +E GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  23   FYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCG  60



>gb|AAG13985.1|AF298826_1 ubiquitin/ribosomal protein 27a [Prunus avium]
Length=156

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YKG++ GK  +L +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKGDDSGKVQKLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_006747376.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Leptonychotes 
weddellii]
 ref|XP_006752306.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Leptonychotes 
weddellii]
Length=155

 Score = 40.0 bits (92),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            Y   E GK  RL  E P+ EC  G F+ +  DRHYCG
Sbjct  105  YTVNENGKISRLHWECPSDECGAGVFMASYFDRHYCG  141


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +3

Query  72   LKAKIPEHEGLPPDQ*RLVFDGNHLQDVPHPCrltlttrssslhlvlrlrDGAKKPKKKT  251
            +KAKI   EG+PPDQ RL+F G  L+D           ++S+LHLVLRL DGAKK KK  
Sbjct  26   IKAKIQNKEGIPPDQQRLIFAGKQLED-GRTLSDYNIQKASTLHLVLRLHDGAKKRKKSY  84

Query  252  LPP  260
              P
Sbjct  85   TTP  87



>gb|AAZ83341.1| ubiquitin extension protein [Gossypium hirsutum]
 gb|KJB41754.1| hypothetical protein B456_007G119500 [Gossypium raimondii]
 gb|KJB69904.1| hypothetical protein B456_011G049100 [Gossypium raimondii]
Length=156

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|AIX10775.1| ubiquitin, partial [Panax notoginseng]
Length=155

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK E+ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  105  YKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  141



>gb|AHA83529.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK E+ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|KJB06862.1| hypothetical protein B456_001G146500 [Gossypium raimondii]
Length=183

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  133  YKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCG  169



>ref|XP_008362581.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like, partial 
[Malus domestica]
Length=115

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  63   QFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  101



>emb|CAA80334.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_004489824.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|ADF36485.1| ubiquitin extension protein [Ageratina adenophora]
 gb|AID52926.1| ubiquitin [Carthamus tinctorius]
Length=153

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_006424488.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
 gb|ESR37728.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
Length=156

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_005863705.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Myotis 
brandtii]
 gb|EPQ06150.1| Ubiquitin-40S ribosomal protein S27a [Myotis brandtii]
Length=157

 Score = 41.6 bits (96),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            +K +E G   RL +E P+ EC  G F+   LDRHYCG
Sbjct  107  HKVDENGTTSRLHRECPSGECGAGVFMAGHLDRHYCG  143


 Score = 35.4 bits (80),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  72   LKAKIPEHEGLPPDQ*RLVFDGNHLQDVPHPCrltlttrssslhlvlrlrDGAKKPKKKT  251
            ++AK+ + +G+PPDQ RL+F GN++     P       + S+LHLVLRL  GAKK KK++
Sbjct  26   VRAKMQDKKGIPPDQQRLIFAGNNVYKNGRPLSDYNIQKESTLHLVLRLCGGAKKGKKQS  85



>ref|XP_002525394.1| ubiquitin, putative [Ricinus communis]
 ref|XP_009617530.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009629268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009761349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 ref|XP_009773069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 emb|CAA11268.1| ubiquitin extension protein [Nicotiana tabacum]
 gb|AAX07419.1| ubiquitin/s27a 40S ribosomal protein [Nicotiana benthamiana]
 gb|EEF37032.1| ubiquitin, putative [Ricinus communis]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_007157375.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 ref|XP_007157378.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
 gb|ESW29369.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 gb|ESW29372.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_004504241.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_006488031.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
Length=164

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  114  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  150



>gb|KJB49764.1| hypothetical protein B456_008G136200, partial [Gossypium raimondii]
Length=210

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  160  YKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCG  196



>ref|XP_003613203.1| Ubiquitin [Medicago truncatula]
 gb|AES96161.1| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|NP_001238181.1| uncharacterized protein LOC100527579 [Glycine max]
 ref|XP_003517689.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
 gb|ACU16690.1| unknown [Glycine max]
 gb|KHN00366.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
 gb|KHN14565.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_011079491.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLREECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_011040332.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|NP_001275323.1| putative ubiquitin extension protein [Solanum tuberosum]
 gb|ABY21245.1| putative ubiquitin extension protein [Solanum tuberosum]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  104  QFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>emb|CAN80663.1| hypothetical protein VITISV_036195 [Vitis vinifera]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  104  QFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|ACJ83917.1| unknown [Medicago truncatula]
 gb|ACJ86209.1| unknown [Medicago truncatula]
 gb|AET04371.2| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  104  QFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_004229050.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Solanum lycopersicum]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>sp|P62980.2|RS27A_SOLLC RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum lycopersicum]
 sp|P62981.2|RS27A_SOLTU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum tuberosum]
 emb|CAA41207.1| ubiquitin [Solanum lycopersicum]
 emb|CAA77735.1| ubiquitin monomer/ribosomal protein [Solanum tuberosum]
 gb|AAA19247.1| ubiquitin/ribosomal fusion protein [Solanum tuberosum]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_002320950.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_011040582.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
 gb|ABK92725.1| unknown [Populus trichocarpa]
 gb|EEE99265.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|AFK43562.1| unknown [Medicago truncatula]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  104  QFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_008358198.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_008389677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008389867.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008343199.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008350959.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008353873.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008360710.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_009363083.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009367168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009376181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|KDP26615.1| hypothetical protein JCGZ_17773 [Jatropha curcas]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_011082406.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
 gb|AFJ42574.1| ubiquitin extension protein 5 [Sesamum indicum]
 gb|KDP45613.1| hypothetical protein JCGZ_17220 [Jatropha curcas]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|NP_001269170.1| ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus]
 ref|XP_008446192.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cucumis melo]
 gb|AAQ76040.1| ubiquitin extension protein [Cucumis sativus]
 gb|ADN33826.1| ubiquitin extension protein [Cucumis melo subsp. melo]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|NP_001275598.1| ubiquitin-40S ribosomal protein S27a-like [Solanum tuberosum]
 ref|XP_002297752.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_002301539.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 ref|XP_002515213.1| ubiquitin, putative [Ricinus communis]
 ref|XP_004252948.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252949.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252950.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_006376957.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_006438329.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 ref|XP_006483898.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 ref|XP_007044700.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 ref|XP_007221513.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 ref|XP_007223652.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 ref|XP_008227802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Prunus mume]
 ref|XP_009609224.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609225.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609226.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009775091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_009775093.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_010044607.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eucalyptus grandis]
 ref|XP_010999619.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Populus euphratica]
 emb|CAA71132.1| ubiquitin extension protein [Solanum tuberosum]
 gb|ABA46785.1| ubiquitin extension protein-like protein [Solanum tuberosum]
 gb|ABK92566.1| unknown [Populus trichocarpa]
 gb|ABK93901.1| unknown [Populus trichocarpa]
 gb|ABK94236.1| unknown [Populus trichocarpa]
 gb|ABK94239.1| unknown [Populus trichocarpa]
 gb|ABK94284.1| unknown [Populus trichocarpa]
 gb|ACG70965.1| ubiquitin extensive-like protein [Ziziphus jujuba]
 gb|EEE80812.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 gb|EEE82557.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|EEF47197.1| ubiquitin, putative [Ricinus communis]
 gb|EMJ22712.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 gb|EMJ24851.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 gb|EOY00532.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|ERP54754.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ESR51569.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 gb|KCW86699.1| hypothetical protein EUGRSUZ_B03309 [Eucalyptus grandis]
 gb|KDO60231.1| hypothetical protein CISIN_1g031613mg [Citrus sinensis]
 emb|CDO98715.1| unnamed protein product [Coffea canephora]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|AFK49579.1| unknown [Lotus japonicus]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_006374591.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ERP52388.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_002279878.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN71283.1| hypothetical protein VITISV_027093 [Vitis vinifera]
 emb|CAN70884.1| hypothetical protein VITISV_029192 [Vitis vinifera]
 gb|KDP28317.1| hypothetical protein JCGZ_14088 [Jatropha curcas]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|ABN72579.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|ABI84265.1| ubiquitin/ribosomal protein S27a [Arachis hypogaea]
Length=155

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|EYU46866.1| hypothetical protein MIMGU_mgv1a015483mg [Erythranthe guttata]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|ABK42077.1| ubiquitin extension protein [Capsicum annuum]
Length=179

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  129  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  165



>gb|EYU38434.1| hypothetical protein MIMGU_mgv1a015486mg [Erythranthe guttata]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_004142977.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 ref|XP_004172998.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 gb|KGN62301.1| Ubiquitin extension protein [Cucumis sativus]
Length=156

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|EPS73110.1| hypothetical protein M569_01646, partial [Genlisea aurea]
Length=157

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  107  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  143



>sp|P59272.2|RS27A_DAUCA RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor, partial [Daucus carota]
 gb|AAC26159.1| ubiquitin-carboxyl extension [Daucus carota]
Length=143

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKVDESGKVQRLRKECPNGECGAGTFMANHFDRHYCG  142



>ref|XP_006349858.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
tuberosum]
Length=181

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_003535084.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
Length=155

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKLQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|KGN51791.1| hypothetical protein Csa_5G600925 [Cucumis sativus]
Length=188

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  138  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  174



>ref|XP_008793306.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Phoenix dactylifera]
Length=156

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDTGKVTRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_011003162.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=202

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  152  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  188



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  182  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  218



>ref|XP_008781194.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_008810072.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_010921349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Elaeis guineensis]
Length=156

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_010941490.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=156

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_003634320.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN75420.1| hypothetical protein VITISV_037877 [Vitis vinifera]
Length=156

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN+EC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNSECGAGTFMANHFDRHYCG  142



>gb|AEI29168.1| ubiquitin-like protein [Phragmipedium longifolium]
Length=125

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  73   QFYKVDDSGKVARLRKECPNAECGAGTFMANHFDRHYCG  111



>ref|XP_003629895.1| Ubiquitin [Medicago truncatula]
Length=232

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  183  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCG  219



>ref|XP_010270921.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNA+C  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCG  142



>gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus domestica]
Length=156

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ G+  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGQVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|AAZ53360.1| ubiquitin extension protein [Nicotiana tabacum]
Length=156

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  G+F+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGSFMANHFDRHYCG  142



>ref|XP_004288657.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 ref|XP_004297391.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 gb|AEQ75492.1| ubiquitin extension protein [Rosa multiflora]
Length=156

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  +L +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQKLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_010270924.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNA+C  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCG  142



>sp|P47905.2|RS27A_LUPAL RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Lupinus albus]
 emb|CAA80333.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNTECGAGTFMANHFDRHYCG  142



>ref|XP_007051235.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|EOX95392.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
Length=172

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYC  429
            YK +E GK  RL +E PNAEC  GTF+ N  DRHYC
Sbjct  106  YKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYC  141



>ref|XP_010040181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
 gb|KCW45422.1| hypothetical protein EUGRSUZ_L00891 [Eucalyptus grandis]
Length=156

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNGECGAGTFMANHFDRHYCG  142



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  182  YKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCG  218



>gb|KCW58175.1| hypothetical protein EUGRSUZ_H00892 [Eucalyptus grandis]
Length=145

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYC  429
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYC
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYC  141



>ref|XP_006492389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 gb|KDO86853.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=156

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ +  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMASHFDRHYCG  142



>ref|XP_010248517.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nelumbo nucifera]
Length=156

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  104  QFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCG  142



>ref|XP_010914705.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X5 [Elaeis guineensis]
Length=188

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  140  YKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCG  176



>ref|XP_010914704.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X4 [Elaeis guineensis]
Length=193

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  140  YKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCG  176



>gb|ACJ84122.1| unknown [Medicago truncatula]
Length=155

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ G   RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGTVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>ref|XP_002979704.1| hypothetical protein SELMODRAFT_111605, partial [Selaginella 
moellendorffii]
 ref|XP_002988357.1| hypothetical protein SELMODRAFT_127825, partial [Selaginella 
moellendorffii]
 gb|EFJ10447.1| hypothetical protein SELMODRAFT_127825, partial [Selaginella 
moellendorffii]
 gb|EFJ19106.1| hypothetical protein SELMODRAFT_111605, partial [Selaginella 
moellendorffii]
Length=78

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK +RL +E PN EC  GTF+ N  DRHYCG
Sbjct  29   YKVDDSGKVNRLRKECPNPECGAGTFMANHFDRHYCG  65



>ref|XP_008776477.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Phoenix 
dactylifera]
Length=162

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVTRLRKECPNVECGAGTFMANHFDRHYCG  142



>ref|XP_010914702.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Elaeis guineensis]
Length=211

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  IYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  139  FYKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCG  176



>ref|XP_001774978.1| predicted protein [Physcomitrella patens]
 gb|EDQ60244.1| predicted protein [Physcomitrella patens]
Length=156

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNPECGAGTFMANHFDRHYCG  142



>ref|XP_010914703.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X3 [Elaeis guineensis]
Length=207

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  IYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  139  FYKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCG  176



>sp|P31753.2|RS27A_ASPOF RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor, partial [Asparagus officinalis]
 emb|CAA47346.1| Ubiquitin /Ribosomal peptide [Asparagus officinalis]
Length=118

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  68   QFYKVDDTGKVIRLRKECPNAECGAGTFMANHKDRHYCG  106



>gb|AER12038.1| ubiquitin extension protein, partial [Paeonia suffruticosa]
Length=140

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PN +C  GTF+ N  DRHYCG
Sbjct  88   QFYKVDDSGKVQRLRKECPNGDCGAGTFMANHFDRHYCG  126



>ref|XP_010914701.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Elaeis guineensis]
Length=225

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  140  YKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCG  176



>gb|ABH08969.1| ubiquitin extension protein [Morus bombycis]
Length=156

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKIDDSGKVSRLRKECPNDECGAGTFMANHFDRHYCG  142



>gb|AAL66206.1|AF386524_1 ubiquitin extension protein [Pyrus communis]
Length=154

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++  K  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSRKVQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|ABR16172.1| unknown [Picea sitchensis]
 gb|ABR16495.1| unknown [Picea sitchensis]
 gb|ABR16621.1| unknown [Picea sitchensis]
Length=156

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN +C  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNQDCGAGTFMANHFDRHYCG  142



>ref|XP_010251196.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  +L +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQKLRKECPNQECGAGTFMANHFDRHYCG  142



>ref|XP_006846976.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
 gb|ERN08557.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
Length=156

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  +L +E PN EC  GTF+ N  DRHYCG
Sbjct  104  QFYKVDDSGKVQKLRKECPNQECGAGTFMANHFDRHYCG  142



>gb|AFX96040.1| ubiquitin extension protein [Grimmia pilifera]
Length=156

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN +C  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNPDCGAGTFMANHFDRHYCG  142



>ref|XP_001754264.1| predicted protein [Physcomitrella patens]
 ref|XP_001762712.1| predicted protein [Physcomitrella patens]
 gb|EDQ72511.1| predicted protein [Physcomitrella patens]
 gb|EDQ80714.1| predicted protein [Physcomitrella patens]
Length=155

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN +C  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNPDCGAGTFMANHFDRHYCG  142



>ref|XP_001762629.1| predicted protein [Physcomitrella patens]
 gb|EDQ72428.1| predicted protein [Physcomitrella patens]
Length=155

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PN +C  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQRLRKECPNPDCGAGTFMANHFDRHYCG  142



>ref|XP_010675161.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Beta vulgaris 
subsp. vulgaris]
Length=156

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK  +  K  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  YKVSDSAKIQRLRKECPNAECGAGTFMANHFDRHYCG  142



>gb|AEI29167.1| ubiquitin-like protein [Phalaenopsis hybrid cultivar]
Length=125

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK ++ GK  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  73   QFYKVDDSGKMVRLRKECPNGECGAGTFMANHFDRHYCG  111



>ref|NP_001238483.1| uncharacterized protein LOC100527854 [Glycine max]
 gb|ACU17047.1| unknown [Glycine max]
Length=155

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNAEC  GTF+ N  D HYCG
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMANHFDPHYCG  142



>gb|KJB22478.1| hypothetical protein B456_004G049300, partial [Gossypium raimondii]
Length=131

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  331  EEYGKAHRLMQESPNAECALGTFVTNPLDRHYC  429
            +E GK  RL +E PNAEC  GTF+ N  DRHYC
Sbjct  99   DESGKVQRLRKECPNAECGAGTFMANHFDRHYC  131



>gb|KDO86852.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=145

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYC  429
            YK ++ GK  RL +E PNAEC  GTF+ +  DRHYC
Sbjct  106  YKVDDSGKVQRLRKECPNAECGAGTFMASHFDRHYC  141



>ref|XP_006832935.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
 gb|ERM98213.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
Length=156

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  ++ +E PN EC  GTF+ N  DRHYCG
Sbjct  106  YKVDDSGKVQKIRKECPNQECGAGTFMANHFDRHYCG  142



>ref|XP_009772672.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
Length=156

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  IYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             YK ++ GK  RL +E PNAEC  GTF+ N  DRHY G
Sbjct  105  FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYYG  142



>ref|XP_009383724.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Musa acuminata 
subsp. malaccensis]
Length=157

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVSRLRKECPNAECGAGTFMANHFDRHYCG  143



>ref|XP_003062279.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53098.1| predicted protein [Micromonas pusilla CCMP1545]
Length=155

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             +YK ++ GK  RL +E P AEC  G F+ N  DRHYCG
Sbjct  104  KLYKVDDAGKVTRLRKECPAAECGAGVFMANHFDRHYCG  142



>ref|XP_009385375.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=158

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>ref|XP_003568865.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Brachypodium 
distachyon]
 dbj|BAJ88878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>gb|AGC65581.1| UBQ5, partial [Agrostis stolonifera]
Length=156

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  114  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  144



>ref|NP_001042915.1| Os01g0328400 [Oryza sativa Japonica Group]
 ref|XP_006644130.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Oryza 
brachyantha]
 sp|Q9ARZ9.1|R27AA_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB39294.1| ubiquitin / ribosomal protein S27a.1 [Oryza sativa Japonica Group]
 dbj|BAF04829.1| Os01g0328400 [Oryza sativa Japonica Group]
 gb|EAY73811.1| hypothetical protein OsI_01687 [Oryza sativa Indica Group]
 gb|EAY73815.1| hypothetical protein OsI_01691 [Oryza sativa Indica Group]
 gb|EAZ11698.1| hypothetical protein OsJ_01558 [Oryza sativa Japonica Group]
 dbj|BAG88191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=155

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>ref|XP_004968668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Setaria 
italica]
Length=155

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>gb|AIH15195.1| ubiquitin-40S ribosomal protein S27a-like protein [Hedychium 
coronarium]
Length=157

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>ref|XP_009416508.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391524.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414159.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
Length=157

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>gb|AEE98366.1| ubiquitin [Deschampsia antarctica]
Length=155

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>gb|ACA24140.1| ubiquitin [Lolium temulentum]
Length=155

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>gb|AEO11783.1| ubiquitin [Lolium perenne]
Length=147

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  106  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  136



>gb|ABR29645.1| ubiquitin, partial [Lolium perenne]
Length=155

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>gb|AAP22047.1| 40S ribosomal protein [Oreochromis mossambicus]
Length=58

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  9    YKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCG  45



>gb|AEE98367.1| ubiquitin [Deschampsia antarctica]
Length=73

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNA+C  GTF+ N  DRHYCG
Sbjct  31   GKVTRLRKECPNADCGAGTFMANHFDRHYCG  61



>ref|XP_009414918.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=167

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGTFMANHFDRHYCG  143



>ref|XP_006001599.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Latimeria chalumnae]
Length=156

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P+ EC  G F+ +  DRHYCG
Sbjct  106  YKVDENGKIHRLRRECPSEECGAGVFMASHFDRHYCG  142



>ref|XP_010513784.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
Length=110

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  IYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  58   FYKIDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  95



>gb|ABV58643.1| ubquitin, partial [Catharanthus roseus]
Length=124

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
              YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  79   QFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  117



>gb|AAW56553.1| ubiquitin/s27a 40s ribosomal protein [Nicotiana benthamiana]
Length=156

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK ++ GK  RL +E PNA+C  GT++ N  DR+YCG
Sbjct  106  YKVDDSGKVQRLRKECPNAKCGAGTYMANHFDRYYCG  142



>ref|XP_006071278.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
Length=155

 Score = 35.4 bits (80),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            Y  ++ G+   L Q  P  EC  G F+ + L RHYCG
Sbjct  105  YIVDDNGRISHLHQRCPTEECGAGVFMASHLQRHYCG  141


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +3

Query  72   LKAKIPEHEGLPPDQ*RLVFDGNHLQDVPHPCrltlttrssslhlvlrlrDGAKKPKKKT  251
            +KAKI +++G+PPD   L+F G  L+D    C +T   + S+L+L +    GAKK K ++
Sbjct  26   VKAKIQDNKGIPPDGQSLIFAGKQLED---GCTVTTMQKESTLYLNVLNCGGAKKRKGRS  82

Query  252  L  254
            L
Sbjct  83   L  83



>tpg|DAA26453.1| TPA: ubiquitin and ribosomal protein S27a-like [Bos taurus]
Length=156

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E G+  RL QE P+ EC  G F+T+  DRHYCG
Sbjct  106  YKVDENGRISRLCQECPSDECGAGVFMTSHFDRHYCG  142



>gb|KFK35409.1| hypothetical protein AALP_AA5G280900 [Arabis alpina]
 gb|KFK37468.1| hypothetical protein AALP_AA4G260800 [Arabis alpina]
Length=157

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>gb|AEC11011.1| ubiquitin extension protein, partial [Camellia sinensis]
Length=44

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +1

Query  343  KAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            K  RL +E PN EC  GTF+ N  DRHYCG
Sbjct  1    KVQRLRKECPNGECGAGTFMANHFDRHYCG  30



>ref|XP_004330561.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Tursiops 
truncatus]
Length=155

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK  RL QE P+ EC  G F+ +  DRHYCG
Sbjct  105  YKADENGKISRLCQECPSDECGAGVFMASHFDRHYCG  141



>ref|XP_009133797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
 emb|CDY50916.1| BnaC03g72450D [Brassica napus]
 emb|CDX83344.1| BnaA03g21620D [Brassica napus]
Length=157

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|XP_009104378.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3 [Brassica rapa]
 emb|CDY66301.1| BnaA04g27270D [Brassica napus]
 emb|CDY25100.1| BnaC06g18420D [Brassica napus]
 emb|CDY11410.1| BnaA09g39760D [Brassica napus]
 emb|CDX93983.1| BnaC04g21420D [Brassica napus]
 emb|CDX76623.1| BnaC08g32090D [Brassica napus]
 emb|CDX67885.1| BnaA07g19250D [Brassica napus]
Length=157

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|NP_566095.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|NP_001189768.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|XP_002880283.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006296217.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
 sp|P59232.2|R27AB_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK53000.1|AF375416_1 At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAA32907.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAC34235.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM65909.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM98297.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAN28749.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|EFH56542.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10801.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|AEC10802.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|EOA29115.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
Length=157

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|XP_010506742.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|XP_003567648.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Brachypodium 
distachyon]
 sp|P0CG87.1|RS272_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62699.1| ubiquitin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92072.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNA+C  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNADCGAGTFMANHFDRHYCG  143



>ref|XP_010451574.1| PREDICTED: ubiquitin-like protein 1-40S ribosomal protein S27a 
[Camelina sativa]
Length=239

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  IYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             YK +  GK  RL +E PNA C  GTFV +  DRHYCG
Sbjct  109  FYKIDGSGKVQRLRKECPNATCGAGTFVASHFDRHYCG  146



>ref|XP_010507927.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010518402.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>sp|P0CG86.1|RS271_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62698.1| ubiquitin [Hordeum vulgare subsp. vulgare]
Length=155

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNA+C  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNADCGAGTFMANHFDRHYCG  143



>ref|XP_004977103.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Setaria 
italica]
Length=155

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNA+C  GTF+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNADCGAGTFMANHFDRHYCG  143



>gb|AFI60245.1| ubiquitin, partial [Panicum virgatum]
Length=153

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNA+C  GTF+ N  DRHYCG
Sbjct  111  GKVTRLRKECPNADCGAGTFMANHFDRHYCG  141



>ref|XP_009116899.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
Length=157

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  IYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  105  FYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|XP_006866205.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Chrysochloris 
asiatica]
Length=155

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK  RL QE P+ EC  G F+ +  DRHYCG
Sbjct  105  YKVDENGKISRLRQECPSDECGAGVFMASNFDRHYCG  141



>ref|XP_006402395.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
 gb|ESQ43848.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
Length=157

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|XP_006397903.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
 gb|ESQ39356.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
Length=157

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|NP_191784.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
 sp|P59233.2|R27AC_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-3; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32906.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 emb|CAB71885.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 gb|AAK97689.1| AT3g62250/T17J13_210 [Arabidopsis thaliana]
 gb|AAM61537.1| ubiquitin extension protein UBQ5 [Arabidopsis thaliana]
 gb|AAM98116.1| At3g62250/T17J13_210 [Arabidopsis thaliana]
 dbj|BAE98979.1| ubiquitin extension protein [Arabidopsis thaliana]
 gb|AEE80327.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
Length=157

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKIDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>gb|ACO08429.1| Ubiquitin [Oncorhynchus mykiss]
Length=156

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  106  YKVDENGKIHRLRRECPAEECGAGVFMASHFDRHYCG  142



>ref|XP_002876668.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006293091.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
 ref|XP_010512610.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010468976.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 gb|EFH52927.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA25989.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
Length=157

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKIDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>ref|NP_001133210.1| ribosomal protein S27-3 [Salmo salar]
 gb|ACI69454.1| Ubiquitin [Salmo salar]
Length=156

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  106  YKVDENGKIHRLRRECPAEECGAGVFMASHFDRHYCG  142



>gb|ACH71005.1| ribosomal protein S27-3 [Salmo salar]
 gb|ACI66719.1| Ubiquitin [Salmo salar]
 gb|ACN09871.1| Ubiquitin [Salmo salar]
 gb|ACN12218.1| Ubiquitin [Salmo salar]
 gb|ADD37999.1| Ubiquitin [Lepeophtheirus salmonis]
 gb|ADM16009.1| Ubiquitin [Salmo salar]
 emb|CDQ70304.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  106  YKVDENGKIHRLRRECPAEECGAGVFMASHFDRHYCG  142



>emb|CAG12343.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=140

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  90   YKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCG  126



>ref|XP_010413295.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
Length=157

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +  GK  RL +E PNA C  GTF+ +  DRHYCG
Sbjct  106  YKIDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCG  142



>gb|AEY84966.1| ubiquitin, partial [Alopecurus myosuroides]
Length=74

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK   L +E PNAEC  GTF+ N  DRHYCG
Sbjct  33   GKVTXLXKECPNAECGAGTFMANHFDRHYCG  63



>gb|AAM27203.1|AF502248_1 40s ribosomal protein S27a [Epinephelus coioides]
Length=156

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  106  YKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCG  142



>ref|NP_956796.1| ubiquitin-40S ribosomal protein S27a [Danio rerio]
 ref|NP_001187222.1| ubiquitin-40S ribosomal protein S27a [Ictalurus punctatus]
 ref|XP_003455526.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oreochromis 
niloticus]
 ref|XP_003963790.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Takifugu 
rubripes]
 ref|XP_004575832.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Maylandia 
zebra]
 ref|XP_005743613.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Pundamilia 
nyererei]
 ref|XP_005812668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Xiphophorus 
maculatus]
 ref|XP_005945885.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Haplochromis 
burtoni]
 ref|XP_006638483.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Lepisosteus 
oculatus]
 ref|XP_006806933.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Neolamprologus brichardi]
 ref|XP_006806934.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Neolamprologus brichardi]
 ref|XP_007230176.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Astyanax mexicanus]
 ref|XP_007577064.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia formosa]
 ref|XP_008286554.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Stegastes partitus]
 ref|XP_008319624.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cynoglossus 
semilaevis]
 ref|XP_008428691.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia reticulata]
 ref|XP_010748172.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Larimichthys 
crocea]
 ref|XP_010790874.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Notothenia coriiceps]
 ref|XP_010868135.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Esox lucius]
 sp|P68200.2|RS27A_ICTPU RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Ictalurus punctatus]
 gb|AAK95212.1|AF402838_1 40S ribosomal protein S27a [Ictalurus punctatus]
 gb|AAH55524.1| Zgc:66168 [Danio rerio]
 dbj|BAF45917.1| ribosomal protein S27a [Solea senegalensis]
 gb|ACA05172.1| ribosomal protein S27a [Oncorhynchus masou formosanus]
 gb|AAI64449.1| Zgc:66168 protein [Danio rerio]
 gb|ACM08345.1| Ubiquitin [Salmo salar]
 gb|ACO09845.1| Ubiquitin [Osmerus mordax]
 gb|ACQ58277.1| Ubiquitin [Anoplopoma fimbria]
 gb|ADM64585.1| ribosomal protein S27a [Hypophthalmichthys nobilis]
 emb|CDQ88274.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  106  YKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCG  142



>ref|XP_011482499.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryzias latipes]
 ref|XP_011482500.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryzias latipes]
Length=156

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  106  YKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCG  142



>gb|AAH49478.1| Zgc:66168 protein, partial [Danio rerio]
Length=172

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  122  YKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCG  158



>gb|AGO97083.1| ubiquitin, partial [Cymbidium faberi]
Length=140

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHY  426
            YK ++ GK  RL +E PNAEC  GTF+ N  DRHY
Sbjct  106  YKVDDSGKMARLRKECPNAECGAGTFMANHFDRHY  140



>gb|AEA51100.1| ubiquitin, partial [Oryzias melastigma]
Length=169

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK HRL +E P  EC  G F+ +  DRHYCG
Sbjct  127  YKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCG  163



>ref|XP_002457768.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 ref|XP_008655871.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|EES02888.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 gb|AFW80667.1| polyubiquitin-like protein isoform 1 [Zea mays]
 gb|AFW80668.1| polyubiquitin-like protein isoform 2 [Zea mays]
Length=155

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +1

Query  340  GKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            GK  RL +E PNAEC  G F+ N  DRHYCG
Sbjct  113  GKVTRLRKECPNAECGAGVFMANHFDRHYCG  143



>ref|XP_008640291.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Corvus brachyrhynchos]
Length=159

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 6/51 (12%)
 Frame = +3

Query  18   TVQYHLPRGCILRHH----QTM--LKAKIPEHEGLPPDQ*RLVFDGNHLQD  152
            TV Y + RGCI  +      T+  +KAKI + EG+PPDQ RL+F G  L+D
Sbjct  5    TVTYSIIRGCIFGYEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED  55



>ref|XP_002501200.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62458.1| predicted protein [Micromonas sp. RCC299]
Length=152

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  SIYKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
             +YK ++ GK  RL +E P  EC  G F+ N  DRHYCG
Sbjct  104  KLYKVDDAGKVTRLRKECPAPECGAGVFMANHFDRHYCG  142



>dbj|BAA25826.1| ribosomal protein S27a [Homo sapiens]
Length=51

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  322  YKGEEYGKAHRLMQESPNAECALGTFVTNPLDRHYCG  432
            YK +E GK  RL +E P+ EC  G F+ +  DRHYCG
Sbjct  9    YKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCG  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800