BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN025E14

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP14057.1|  unnamed protein product                                234   2e-72   Coffea canephora [robusta coffee]
ref|XP_007218347.1|  hypothetical protein PRUPE_ppa008681mg             209   8e-63   
ref|XP_011076733.1|  PREDICTED: pollen-specific leucine-rich repe...    209   1e-62   Sesamum indicum [beniseed]
ref|XP_010256631.1|  PREDICTED: leucine-rich repeat extensin-like...    209   1e-62   Nelumbo nucifera [Indian lotus]
ref|XP_009588589.1|  PREDICTED: pollen-specific leucine-rich repe...    207   4e-62   Nicotiana tomentosiformis
ref|XP_009779320.1|  PREDICTED: pollen-specific leucine-rich repe...    204   5e-61   Nicotiana sylvestris
ref|XP_004247617.1|  PREDICTED: formin-like protein 14                  205   7e-61   Solanum lycopersicum
ref|XP_008343828.1|  PREDICTED: formin-like protein 20                  204   1e-60   
gb|EYU19982.1|  hypothetical protein MIMGU_mgv1a024988mg                202   3e-60   Erythranthe guttata [common monkey flower]
ref|XP_008392919.1|  PREDICTED: histone-lysine N-methyltransferas...    204   4e-60   
ref|XP_002279465.1|  PREDICTED: formin-1                                199   1e-59   Vitis vinifera
ref|XP_009350922.1|  PREDICTED: formin-like protein 20                  200   8e-59   
gb|KDP44823.1|  hypothetical protein JCGZ_01323                         194   5e-57   Jatropha curcas
gb|KEH34781.1|  C2 domain protein                                       194   5e-57   Medicago truncatula
ref|XP_006601957.1|  PREDICTED: uncharacterized protein LOC102666...    194   1e-56   
ref|XP_002526856.1|  protein with unknown function                      191   1e-55   Ricinus communis
ref|XP_007009086.1|  Calcium-dependent lipid-binding family protein     191   1e-55   
ref|XP_002280187.1|  PREDICTED: formin-like protein 14                  189   4e-55   Vitis vinifera
ref|XP_007163517.1|  hypothetical protein PHAVU_001G240600g             189   4e-55   Phaseolus vulgaris [French bean]
ref|XP_004503391.1|  PREDICTED: uncharacterized acetyltransferase...    197   5e-55   
gb|KJB78797.1|  hypothetical protein B456_013G019500                    188   6e-55   Gossypium raimondii
ref|XP_010095064.1|  hypothetical protein L484_026371                   189   1e-54   Morus notabilis
ref|XP_003600860.1|  BAHD acyltransferase DCR                           197   1e-54   
gb|KJB74226.1|  hypothetical protein B456_011G280500                    186   5e-54   Gossypium raimondii
gb|ACV71018.1|  UPA18                                                   187   6e-54   Capsicum annuum
ref|XP_011041338.1|  PREDICTED: leucine-rich repeat extensin-like...    186   8e-54   Populus euphratica
gb|ABK92946.1|  unknown                                                 183   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002311204.1|  hypothetical protein POPTR_0008s06510g             183   1e-52   Populus trichocarpa [western balsam poplar]
emb|CAN64035.1|  hypothetical protein VITISV_020002                     176   8e-51   Vitis vinifera
ref|XP_009421318.1|  PREDICTED: leucine-rich repeat extensin-like...    171   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002314120.1|  C2 domain-containing family protein                169   2e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011032146.1|  PREDICTED: basic salivary proline-rich prote...    169   3e-47   Populus euphratica
ref|XP_011469892.1|  PREDICTED: proline-rich receptor-like protei...    169   3e-47   Fragaria vesca subsp. vesca
ref|XP_010031258.1|  PREDICTED: formin-like protein 20                  166   8e-46   Eucalyptus grandis [rose gum]
ref|XP_010557218.1|  PREDICTED: leucine-rich repeat extensin-like...    166   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_006425035.1|  hypothetical protein CICLE_v10028899mg             162   2e-44   Citrus clementina [clementine]
ref|XP_010923111.1|  PREDICTED: proline-rich receptor-like protei...    158   5e-43   Elaeis guineensis
ref|XP_009404578.1|  PREDICTED: pollen-specific leucine-rich repe...    159   7e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910417.1|  PREDICTED: extensin-2-like                         157   1e-42   Elaeis guineensis
ref|XP_002299823.2|  hypothetical protein POPTR_0001s25640g             156   2e-42   
ref|XP_010690030.1|  PREDICTED: uncharacterized protein LOC104903656    156   2e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008785412.1|  PREDICTED: extensin-like                           155   5e-42   Phoenix dactylifera
ref|XP_010043451.1|  PREDICTED: formin-like protein 20                  155   4e-41   Eucalyptus grandis [rose gum]
ref|XP_011035190.1|  PREDICTED: uncharacterized protein LOC105133...    153   7e-41   Populus euphratica
ref|XP_006305205.1|  hypothetical protein CARUB_v10009572mg             153   9e-41   
ref|XP_002456650.1|  hypothetical protein SORBIDRAFT_03g040170          150   4e-40   
ref|NP_563785.1|  calcium-dependent lipid-binding domain protein        151   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892394.1|  C2 domain-containing protein                       150   8e-40   
ref|NP_001132444.1|  Ras association and pleckstrin y domain 1 is...    149   2e-39   Zea mays [maize]
ref|XP_006417816.1|  hypothetical protein EUTSA_v10008043mg             149   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_004970615.1|  PREDICTED: leucine-rich repeat extensin-like...    149   2e-39   Setaria italica
emb|CDY06697.1|  BnaA10g04760D                                          148   4e-39   
emb|CDY09924.1|  BnaC08g45270D                                          148   4e-39   Brassica napus [oilseed rape]
ref|XP_010457903.1|  PREDICTED: extensin-like                           148   5e-39   Camelina sativa [gold-of-pleasure]
gb|KFK43060.1|  hypothetical protein AALP_AA1G073200                    147   6e-39   Arabis alpina [alpine rockcress]
ref|XP_010475485.1|  PREDICTED: leucine-rich repeat extensin-like...    148   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006645033.1|  PREDICTED: protein enabled homolog                 146   1e-38   Oryza brachyantha
gb|EAY76529.1|  hypothetical protein OsI_04471                          146   2e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001044834.1|  Os01g0853800                                       146   2e-38   
emb|CDY06250.1|  BnaA09g49530D                                          145   5e-38   
ref|XP_011076131.1|  PREDICTED: WW domain-containing protein C11B...    144   6e-38   Sesamum indicum [beniseed]
ref|XP_010487318.1|  PREDICTED: formin-like protein 3                   145   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009118446.1|  PREDICTED: leucine-rich repeat extensin-like...    145   7e-38   Brassica rapa
dbj|BAJ85055.1|  predicted protein                                      145   8e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010475484.1|  PREDICTED: leucine-rich repeat extensin-like...    145   9e-38   
emb|CDM83636.1|  unnamed protein product                                145   1e-37   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564634.1|  PREDICTED: leucine-rich repeat extensin-like...    144   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_009118971.1|  PREDICTED: extensin                                142   6e-37   Brassica rapa
ref|XP_010255304.1|  PREDICTED: uncharacterized protein LOC104596023    140   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009627866.1|  PREDICTED: uncharacterized protein LOC104118341    139   3e-36   Nicotiana tomentosiformis
ref|XP_004240724.1|  PREDICTED: uncharacterized protein LOC101263030    138   4e-36   Solanum lycopersicum
ref|XP_006827556.1|  hypothetical protein AMTR_s00009p00221230          138   5e-36   Amborella trichopoda
emb|CDY10267.1|  BnaC05g05100D                                          138   2e-35   Brassica napus [oilseed rape]
ref|XP_008234057.1|  PREDICTED: leucine-rich repeat extensin-like...    137   6e-35   
ref|XP_009774894.1|  PREDICTED: uncharacterized protein LOC104224872    135   9e-35   Nicotiana sylvestris
ref|XP_004234422.1|  PREDICTED: probable calcium-binding protein ...    137   9e-35   Solanum lycopersicum
ref|XP_010671655.1|  PREDICTED: uncharacterized protein LOC104888395    134   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006353889.1|  PREDICTED: RNA-binding protein EWS-like isof...    136   2e-34   Solanum tuberosum [potatoes]
ref|XP_006353888.1|  PREDICTED: RNA-binding protein EWS-like isof...    136   2e-34   Solanum tuberosum [potatoes]
gb|ABK23901.1|  unknown                                                 134   6e-34   Picea sitchensis
ref|XP_006363329.1|  PREDICTED: uncharacterized protein LOC102600321    133   6e-34   Solanum tuberosum [potatoes]
ref|XP_004289725.1|  PREDICTED: uncharacterized protein LOC101315189    131   2e-33   Fragaria vesca subsp. vesca
emb|CDP21817.1|  unnamed protein product                                132   2e-33   Coffea canephora [robusta coffee]
gb|KJB39411.1|  hypothetical protein B456_007G012100                    132   3e-33   Gossypium raimondii
ref|XP_006827562.1|  hypothetical protein AMTR_s00009p00222310          131   3e-33   Amborella trichopoda
gb|KCW90655.1|  hypothetical protein EUGRSUZ_A02756                     131   6e-33   Eucalyptus grandis [rose gum]
ref|XP_004140766.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    129   6e-33   
ref|XP_010940561.1|  PREDICTED: transcription elongation factor SPT5    130   8e-33   Elaeis guineensis
ref|XP_010060582.1|  PREDICTED: uncharacterized protein LOC104448451    130   8e-33   Eucalyptus grandis [rose gum]
ref|XP_004157192.1|  PREDICTED: uncharacterized protein LOC101224685    130   8e-33   
ref|XP_009382785.1|  PREDICTED: uncharacterized protein LOC103970647    129   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004974238.1|  PREDICTED: transcriptional repressor scratch...    130   1e-32   Setaria italica
emb|CAI58613.1|  C2 domain-containing protein                           130   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578699.1|  PREDICTED: tropomyosin-1, isoforms 33/34-like      130   2e-32   Brachypodium distachyon [annual false brome]
gb|EYU25119.1|  hypothetical protein MIMGU_mgv1a021760mg                130   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_010025284.1|  PREDICTED: uncharacterized protein LOC104415652    127   3e-32   
ref|XP_008439269.1|  PREDICTED: zinc finger matrin-type protein C...    129   4e-32   Cucumis melo [Oriental melon]
ref|XP_011084443.1|  PREDICTED: uncharacterized protein LOC105166693    128   4e-32   Sesamum indicum [beniseed]
ref|XP_009800792.1|  PREDICTED: WW domain-containing protein C11B...    129   5e-32   Nicotiana sylvestris
ref|XP_009420451.1|  PREDICTED: elastin-like                            128   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO56853.1|  hypothetical protein CISIN_1g023810mg                   127   9e-32   Citrus sinensis [apfelsine]
ref|XP_006422081.1|  hypothetical protein CICLE_v10005598mg             127   1e-31   Citrus clementina [clementine]
ref|XP_002271267.1|  PREDICTED: uncharacterized protein LOC100249100    127   2e-31   Vitis vinifera
emb|CAN68775.1|  hypothetical protein VITISV_006805                     126   3e-31   Vitis vinifera
ref|XP_008779256.1|  PREDICTED: uncharacterized protein LOC103698987    125   5e-31   Phoenix dactylifera
ref|NP_001062521.1|  Os08g0562600                                       125   6e-31   
ref|XP_009612128.1|  PREDICTED: cyclin-dependent kinase inhibitor...    126   7e-31   Nicotiana tomentosiformis
ref|NP_001063992.1|  Os09g0571200                                       125   7e-31   
ref|XP_002318206.1|  hypothetical protein POPTR_0012s12880g             123   9e-31   
ref|XP_002513669.1|  conserved hypothetical protein                     124   1e-30   Ricinus communis
gb|KDP46959.1|  hypothetical protein JCGZ_07976                         124   1e-30   Jatropha curcas
ref|XP_007038773.1|  Calcium-dependent lipid-binding family protein     124   2e-30   
dbj|BAK04302.1|  predicted protein                                      123   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006659707.1|  PREDICTED: uncharacterized protein LOC102701649    122   4e-30   Oryza brachyantha
ref|XP_011030162.1|  PREDICTED: uncharacterized protein LOC105129684    122   6e-30   Populus euphratica
ref|XP_004309433.1|  PREDICTED: uncharacterized protein LOC101294323    122   7e-30   Fragaria vesca subsp. vesca
gb|ACN35874.1|  unknown                                                 122   2e-29   Zea mays [maize]
ref|XP_004967742.1|  PREDICTED: forkhead box protein D1-like            122   2e-29   Setaria italica
gb|ACG40316.1|  SRC2                                                    122   2e-29   Zea mays [maize]
ref|NP_001142084.1|  uncharacterized protein LOC100274244               122   2e-29   Zea mays [maize]
ref|XP_010519178.1|  PREDICTED: uncharacterized protein LOC104798699    121   2e-29   Tarenaya hassleriana [spider flower]
gb|ACG26368.1|  SRC2                                                    122   2e-29   Zea mays [maize]
ref|XP_002462013.1|  hypothetical protein SORBIDRAFT_02g012580          121   4e-29   Sorghum bicolor [broomcorn]
ref|XP_010550541.1|  PREDICTED: uncharacterized protein LOC104821382    120   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_008234191.1|  PREDICTED: WW domain-containing protein C11B...    120   5e-29   Prunus mume [ume]
tpg|DAA60682.1|  TPA: hypothetical protein ZEAMMB73_781558              122   6e-29   
gb|KJB34147.1|  hypothetical protein B456_006G049800                    119   9e-29   Gossypium raimondii
gb|KCW90833.1|  hypothetical protein EUGRSUZ_A02890                     117   1e-28   Eucalyptus grandis [rose gum]
ref|XP_010440511.1|  PREDICTED: uncharacterized protein LOC104723800    119   1e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001145939.1|  uncharacterized protein LOC100279462               119   2e-28   Zea mays [maize]
ref|XP_003634095.1|  PREDICTED: uncharacterized protein LOC100852496    118   2e-28   Vitis vinifera
ref|XP_007218770.1|  hypothetical protein PRUPE_ppa009523mg             118   2e-28   Prunus persica
ref|XP_004956261.1|  PREDICTED: tropomyosin-1, isoforms 33/34-like      119   3e-28   Setaria italica
ref|XP_010671657.1|  PREDICTED: uncharacterized protein LOC104888396    118   3e-28   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN78886.1|  hypothetical protein VITISV_002549                     117   7e-28   Vitis vinifera
ref|XP_010096867.1|  hypothetical protein L484_003038                   117   8e-28   Morus notabilis
ref|XP_008379961.1|  PREDICTED: WW domain-containing protein C11B...    117   9e-28   Malus domestica [apple tree]
gb|EYU19570.1|  hypothetical protein MIMGU_mgv1a018510mg                117   1e-27   Erythranthe guttata [common monkey flower]
ref|NP_001141178.1|  hypothetical protein                               117   1e-27   Zea mays [maize]
ref|XP_009368751.1|  PREDICTED: WW domain-containing protein C11B...    116   1e-27   
ref|XP_002872084.1|  hypothetical protein ARALYDRAFT_910412             115   1e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_007152204.1|  hypothetical protein PHAVU_004G110200g             115   2e-27   Phaseolus vulgaris [French bean]
ref|XP_002275480.1|  PREDICTED: uncharacterized protein LOC100242355    115   3e-27   Vitis vinifera
emb|CAN69351.1|  hypothetical protein VITISV_017753                     115   4e-27   Vitis vinifera
emb|CDX87149.1|  BnaC09g04640D                                          113   5e-27   
ref|XP_010421203.1|  PREDICTED: actin cytoskeleton-regulatory com...    114   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006394656.1|  hypothetical protein EUTSA_v10004867mg             113   9e-27   Eutrema salsugineum [saltwater cress]
gb|ACU21016.1|  unknown                                                 113   9e-27   Glycine max [soybeans]
ref|NP_197783.2|  calcium-dependent lipid-binding domain-containi...    112   9e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10068.1|  unnamed protein product                                113   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454681.1|  PREDICTED: uncharacterized protein LOC104736407    114   1e-26   Camelina sativa [gold-of-pleasure]
gb|KFK27692.1|  hypothetical protein AALP_AA8G416000                    113   1e-26   Arabis alpina [alpine rockcress]
emb|CDY16874.1|  BnaA09g05080D                                          112   1e-26   Brassica napus [oilseed rape]
ref|XP_009141839.1|  PREDICTED: uncharacterized protein LOC103865744    113   2e-26   Brassica rapa
ref|XP_003571266.1|  PREDICTED: uncharacterized protein LOC100829104    112   2e-26   Brachypodium distachyon [annual false brome]
ref|XP_002271409.1|  PREDICTED: BAHD acyltransferase DCR                114   8e-26   Vitis vinifera
ref|XP_010493524.1|  PREDICTED: uncharacterized protein LOC104770764    112   8e-26   Camelina sativa [gold-of-pleasure]
emb|CBI22681.3|  unnamed protein product                                114   2e-25   Vitis vinifera
gb|ACJ84898.1|  unknown                                                 110   3e-25   Medicago truncatula
ref|XP_007152206.1|  hypothetical protein PHAVU_004G110400g             110   5e-25   Phaseolus vulgaris [French bean]
gb|AGV54342.1|  hypothetical protein                                    108   1e-24   Phaseolus vulgaris [French bean]
gb|KEH40144.1|  C2 domain protein                                       109   1e-24   Medicago truncatula
ref|XP_004512835.1|  PREDICTED: probable peroxisomal membrane pro...    108   2e-24   Cicer arietinum [garbanzo]
gb|KCW46456.1|  hypothetical protein EUGRSUZ_K00286                     107   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010035164.1|  PREDICTED: uncharacterized protein DDB_G0290...    109   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010035163.1|  PREDICTED: uncharacterized protein DDB_G0290...    109   5e-24   Eucalyptus grandis [rose gum]
ref|XP_006288435.1|  hypothetical protein CARUB_v10001693mg             106   5e-24   Capsella rubella
ref|XP_010035165.1|  PREDICTED: uncharacterized protein LOC104424437    107   7e-24   Eucalyptus grandis [rose gum]
ref|XP_003548167.1|  PREDICTED: uncharacterized protein LOC100790144    103   7e-23   
ref|XP_010042015.1|  PREDICTED: proline-rich receptor-like protei...    104   7e-23   
gb|ACU21139.1|  unknown                                                 101   3e-22   Glycine max [soybeans]
gb|EAZ08028.1|  hypothetical protein OsI_30293                        98.2    5e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_003549032.1|  PREDICTED: uncharacterized protein LOC100805876  99.8    1e-21   Glycine max [soybeans]
ref|XP_006827559.1|  hypothetical protein AMTR_s00009p00221820        95.9    2e-20   
ref|XP_002444571.1|  hypothetical protein SORBIDRAFT_07g023860        85.5    2e-17   
gb|AGW45459.1|  SRC2                                                  83.6    4e-17   Reaumuria trigyna
gb|EMT02310.1|  hypothetical protein F775_23210                       83.2    2e-16   
ref|XP_001782642.1|  predicted protein                                79.0    3e-14   
gb|KJB26599.1|  hypothetical protein B456_004G249500                  79.7    3e-14   Gossypium raimondii
ref|XP_006444911.1|  hypothetical protein CICLE_v10021815mg           77.4    9e-14   Citrus clementina [clementine]
gb|KDO86360.1|  hypothetical protein CISIN_1g047341mg                 77.4    9e-14   Citrus sinensis [apfelsine]
emb|CDP04279.1|  unnamed protein product                              76.3    5e-13   Coffea canephora [robusta coffee]
ref|XP_011077131.1|  PREDICTED: uncharacterized protein LOC105161211  76.6    5e-13   Sesamum indicum [beniseed]
ref|XP_003590980.1|  hypothetical protein MTR_1g080360                76.6    5e-13   Medicago truncatula
gb|KDP23730.1|  hypothetical protein JCGZ_23563                       76.3    7e-13   Jatropha curcas
gb|KDO53064.1|  hypothetical protein CISIN_1g035970mg                 76.3    8e-13   Citrus sinensis [apfelsine]
ref|XP_006437469.1|  hypothetical protein CICLE_v10033675mg           76.3    8e-13   Citrus clementina [clementine]
ref|XP_004239688.1|  PREDICTED: putative uncharacterized protein ...  75.9    1e-12   
ref|XP_007030351.1|  Calcium-dependent lipid-binding (CaLB domain...  75.1    1e-12   
ref|XP_006345991.1|  PREDICTED: uncharacterized protein LOC102591105  74.7    3e-12   
ref|XP_002965668.1|  hypothetical protein SELMODRAFT_407234           74.3    3e-12   
gb|KJB44809.1|  hypothetical protein B456_007G274200                  74.3    3e-12   Gossypium raimondii
gb|KHN31488.1|  hypothetical protein glysoja_035595                   72.4    3e-12   Glycine soja [wild soybean]
ref|XP_009792812.1|  PREDICTED: uncharacterized protein LOC104239795  74.3    4e-12   Nicotiana sylvestris
ref|XP_002976843.1|  hypothetical protein SELMODRAFT_443351           73.2    4e-12   Selaginella moellendorffii
ref|XP_006842598.1|  hypothetical protein AMTR_s00077p00167680        73.9    4e-12   Amborella trichopoda
ref|XP_009625035.1|  PREDICTED: uncharacterized protein LOC104115988  73.9    5e-12   Nicotiana tomentosiformis
gb|KEH24577.1|  calcium-dependent lipid-binding (CaLB domain) fam...  73.6    6e-12   Medicago truncatula
ref|XP_010674263.1|  PREDICTED: uncharacterized protein LOC104890461  73.6    6e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006358324.1|  PREDICTED: uncharacterized protein LOC102592049  73.2    7e-12   Solanum tuberosum [potatoes]
ref|XP_010038446.1|  PREDICTED: uncharacterized protein LOC104426980  71.2    8e-12   
ref|XP_010667096.1|  PREDICTED: uncharacterized protein LOC104884184  73.6    8e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002971671.1|  hypothetical protein SELMODRAFT_412188           72.8    1e-11   
ref|XP_011069440.1|  PREDICTED: uncharacterized protein LOC105155266  72.8    1e-11   Sesamum indicum [beniseed]
gb|AFK13837.1|  C2 domain-containing protein SRC2                     72.0    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004304780.1|  PREDICTED: uncharacterized protein LOC101296310  72.8    1e-11   Fragaria vesca subsp. vesca
ref|XP_003535375.1|  PREDICTED: uncharacterized protein LOC100795448  72.4    2e-11   Glycine max [soybeans]
ref|XP_009795461.1|  PREDICTED: uncharacterized protein LOC104242159  72.0    2e-11   Nicotiana sylvestris
ref|XP_006577748.1|  PREDICTED: uncharacterized protein LOC102667983  72.0    2e-11   Glycine max [soybeans]
ref|XP_010102203.1|  hypothetical protein L484_024484                 71.6    3e-11   Morus notabilis
ref|XP_011077059.1|  PREDICTED: uncharacterized protein LOC105161156  71.6    3e-11   Sesamum indicum [beniseed]
ref|XP_003556915.1|  PREDICTED: uncharacterized protein LOC100779058  71.6    3e-11   Glycine max [soybeans]
ref|XP_007132356.1|  hypothetical protein PHAVU_011G087800g           71.2    3e-11   Phaseolus vulgaris [French bean]
ref|XP_002521996.1|  conserved hypothetical protein                   71.2    4e-11   Ricinus communis
emb|CDX92066.1|  BnaC03g33680D                                        70.9    4e-11   
gb|KJB46046.1|  hypothetical protein B456_007G345600                  69.7    5e-11   Gossypium raimondii
ref|XP_004152866.1|  PREDICTED: uncharacterized protein LOC101218582  70.5    5e-11   Cucumis sativus [cucumbers]
ref|XP_009134757.1|  PREDICTED: uncharacterized protein LOC103859027  70.9    6e-11   Brassica rapa
ref|XP_008441789.1|  PREDICTED: uncharacterized protein LOC103485843  70.5    6e-11   Cucumis melo [Oriental melon]
ref|XP_006842901.1|  hypothetical protein AMTR_s00075p00073210        70.9    6e-11   Amborella trichopoda
emb|CDP04278.1|  unnamed protein product                              70.5    7e-11   Coffea canephora [robusta coffee]
emb|CDX74193.1|  BnaA03g28540D                                        70.5    7e-11   
ref|XP_004155136.1|  PREDICTED: uncharacterized protein LOC101227028  70.1    7e-11   
ref|XP_004495587.1|  PREDICTED: uncharacterized protein LOC101488962  70.1    8e-11   Cicer arietinum [garbanzo]
ref|XP_004494967.1|  PREDICTED: uncharacterized protein LOC101508328  70.1    9e-11   Cicer arietinum [garbanzo]
ref|XP_007205372.1|  hypothetical protein PRUPE_ppa007276mg           70.1    9e-11   
ref|XP_002319115.2|  hypothetical protein POPTR_0013s04590g           69.7    1e-10   
ref|XP_008218351.1|  PREDICTED: uncharacterized protein LOC103318712  70.1    1e-10   
ref|XP_002316231.2|  hypothetical protein POPTR_0010s19990g           67.4    1e-10   
ref|XP_011038591.1|  PREDICTED: uncharacterized protein LOC105135426  69.3    1e-10   Populus euphratica
ref|XP_007051663.1|  Calcium-dependent lipid-binding family prote...  68.2    1e-10   
ref|XP_002970540.1|  hypothetical protein SELMODRAFT_441151           68.2    1e-10   Selaginella moellendorffii
ref|XP_006297897.1|  hypothetical protein CARUB_v10013938mg           69.3    2e-10   Capsella rubella
gb|EPS62035.1|  hypothetical protein M569_12761                       66.6    2e-10   Genlisea aurea
gb|EYU39778.1|  hypothetical protein MIMGU_mgv1a009123mg              68.9    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_009591358.1|  PREDICTED: uncharacterized protein LOC104088405  68.2    2e-10   Nicotiana tomentosiformis
ref|XP_001778275.1|  predicted protein                                67.0    2e-10   
ref|XP_010264865.1|  PREDICTED: uncharacterized protein LOC104602763  68.9    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010936043.1|  PREDICTED: uncharacterized protein LOC105055767  67.8    3e-10   Elaeis guineensis
ref|XP_009379739.1|  PREDICTED: uncharacterized protein LOC103968123  68.9    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_010463915.1|  PREDICTED: uncharacterized protein LOC104744544  68.6    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010485810.1|  PREDICTED: putative lysozyme-like protein        68.6    3e-10   Camelina sativa [gold-of-pleasure]
gb|EYU38921.1|  hypothetical protein MIMGU_mgv1a022778mg              67.0    3e-10   Erythranthe guttata [common monkey flower]
gb|AAM67146.1|  unknown                                               68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KJB26681.1|  hypothetical protein B456_004G254600                  67.0    3e-10   Gossypium raimondii
ref|XP_008370760.1|  PREDICTED: uncharacterized protein LOC103434221  68.6    4e-10   Malus domestica [apple tree]
ref|XP_004242771.1|  PREDICTED: formin-J                              68.2    4e-10   Solanum lycopersicum
ref|XP_007132355.1|  hypothetical protein PHAVU_011G087700g           68.2    4e-10   Phaseolus vulgaris [French bean]
ref|XP_002301388.2|  hypothetical protein POPTR_0002s16800g           66.6    4e-10   
ref|XP_008366882.1|  PREDICTED: uncharacterized protein LOC103430513  68.2    4e-10   
ref|XP_007147256.1|  hypothetical protein PHAVU_006G109100g           66.6    4e-10   Phaseolus vulgaris [French bean]
ref|XP_008340669.1|  PREDICTED: uncharacterized protein LOC103403599  68.2    5e-10   Malus domestica [apple tree]
ref|XP_009591729.1|  PREDICTED: uncharacterized protein LOC104088710  67.8    6e-10   Nicotiana tomentosiformis
ref|XP_002311697.2|  C2 domain-containing family protein              68.2    6e-10   Populus trichocarpa [western balsam poplar]
gb|KHG21324.1|  BON1-associated 2 -like protein                       66.6    6e-10   Gossypium arboreum [tree cotton]
gb|KCW57324.1|  hypothetical protein EUGRSUZ_H00123                   67.8    6e-10   Eucalyptus grandis [rose gum]
ref|XP_002884443.1|  hypothetical protein ARALYDRAFT_477695           67.4    6e-10   
ref|XP_002325345.1|  hypothetical protein POPTR_0019s03780g           67.4    6e-10   Populus trichocarpa [western balsam poplar]
gb|ABK22654.1|  unknown                                               65.5    7e-10   Picea sitchensis
ref|XP_002978619.1|  hypothetical protein SELMODRAFT_443918           67.4    7e-10   
ref|XP_002314508.1|  C2 domain-containing family protein              67.8    7e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010025827.1|  PREDICTED: uncharacterized protein LOC104416087  67.8    7e-10   Eucalyptus grandis [rose gum]
ref|XP_007147205.1|  hypothetical protein PHAVU_006G104400g           67.0    9e-10   Phaseolus vulgaris [French bean]
ref|NP_566225.4|  calcium-dependent lipid-binding family protein      67.4    9e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KJB74862.1|  hypothetical protein B456_012G012900                  66.6    9e-10   Gossypium raimondii
ref|XP_011036375.1|  PREDICTED: uncharacterized protein LOC105133911  67.0    9e-10   Populus euphratica
ref|XP_008796382.1|  PREDICTED: uncharacterized protein LOC103711856  66.2    9e-10   Phoenix dactylifera
ref|XP_010558947.1|  PREDICTED: uncharacterized protein LOC104827473  67.0    1e-09   Tarenaya hassleriana [spider flower]
gb|ABK28543.1|  unknown                                               67.0    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CBI31532.3|  unnamed protein product                              65.5    1e-09   Vitis vinifera
ref|XP_006408192.1|  hypothetical protein EUTSA_v10020890mg           67.0    1e-09   Eutrema salsugineum [saltwater cress]
ref|XP_009343786.1|  PREDICTED: uncharacterized protein LOC103935702  67.0    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_010248679.1|  PREDICTED: uncharacterized protein LOC104591520  65.1    1e-09   Nelumbo nucifera [Indian lotus]
gb|KFK39933.1|  hypothetical protein AALP_AA3G308600                  67.0    1e-09   Arabis alpina [alpine rockcress]
gb|AAF26778.1|AC016829_2  hypothetical protein                        66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EYU39518.1|  hypothetical protein MIMGU_mgv1a007478mg              66.6    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_004234051.1|  PREDICTED: uncharacterized protein LOC101265801  67.0    1e-09   Solanum lycopersicum
ref|XP_006339653.1|  PREDICTED: uncharacterized protein LOC102592387  65.5    1e-09   Solanum tuberosum [potatoes]
ref|XP_004297932.1|  PREDICTED: uncharacterized protein LOC101311957  67.0    1e-09   Fragaria vesca subsp. vesca
gb|KCW57325.1|  hypothetical protein EUGRSUZ_H00124                   63.5    2e-09   
emb|CBI23723.3|  unnamed protein product                              66.6    2e-09   
ref|XP_008224037.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  66.6    2e-09   
ref|XP_011093070.1|  PREDICTED: uncharacterized protein LOC105173112  65.1    2e-09   
ref|XP_006577334.1|  PREDICTED: BON1-associated protein 2-like        64.3    2e-09   
ref|XP_011023248.1|  PREDICTED: uncharacterized protein LOC105124808  65.1    2e-09   
gb|KFK37859.1|  hypothetical protein AALP_AA3G038400                  65.9    2e-09   
ref|XP_011093241.1|  PREDICTED: uncharacterized protein LOC105173247  64.7    2e-09   
emb|CDY42921.1|  BnaC05g47300D                                        65.9    2e-09   
ref|XP_004495257.1|  PREDICTED: proteoglycan 4-like                   66.6    2e-09   
ref|XP_008388740.1|  PREDICTED: uncharacterized protein LOC103451084  65.9    2e-09   
ref|XP_006409691.1|  hypothetical protein EUTSA_v10022712mg           65.9    2e-09   
ref|XP_007226487.1|  hypothetical protein PRUPE_ppa026634mg           66.2    2e-09   
emb|CAN83108.1|  hypothetical protein VITISV_026570                   66.2    2e-09   
ref|XP_011029742.1|  PREDICTED: uncharacterized protein LOC105129399  66.2    3e-09   
ref|XP_002282144.1|  PREDICTED: uncharacterized protein LOC100256206  65.9    3e-09   
ref|XP_002528347.1|  hypothetical protein RCOM_1217340                65.9    3e-09   
emb|CDY49343.1|  BnaA05g33050D                                        65.5    3e-09   
ref|XP_004229965.1|  PREDICTED: BON1-associated protein 2             64.7    3e-09   
ref|XP_009123999.1|  PREDICTED: uncharacterized protein LOC103848923  65.5    3e-09   
ref|XP_010269468.1|  PREDICTED: abl interactor homolog                64.7    4e-09   
ref|XP_007144140.1|  hypothetical protein PHAVU_007G132000g           65.9    4e-09   
gb|AFG52315.1|  hypothetical protein 2_3193_01                        62.4    4e-09   
ref|XP_010105208.1|  hypothetical protein L484_011265                 65.5    4e-09   
ref|XP_009357966.1|  PREDICTED: uncharacterized protein LOC103948651  65.5    4e-09   
ref|XP_004173200.1|  PREDICTED: uncharacterized LOC101215059          65.5    4e-09   
ref|XP_010669605.1|  PREDICTED: uncharacterized protein LOC104886787  64.3    4e-09   
ref|XP_008460692.1|  PREDICTED: uncharacterized protein LOC103499460  65.5    4e-09   
ref|XP_004147189.1|  PREDICTED: uncharacterized protein LOC101215059  65.5    4e-09   
gb|KJB49505.1|  hypothetical protein B456_008G122700                  64.7    5e-09   
ref|XP_006356117.1|  PREDICTED: uncharacterized protein LOC102592369  65.1    5e-09   
ref|XP_003535258.1|  PREDICTED: uncharacterized protein LOC100787698  65.5    5e-09   
ref|XP_003590735.1|  RNA-binding protein 12B                          65.5    5e-09   
ref|XP_002885870.1|  hypothetical protein ARALYDRAFT_480303           65.1    5e-09   
ref|XP_010920373.1|  PREDICTED: CASP-like protein 4A1                 65.1    5e-09   
ref|XP_010092894.1|  hypothetical protein L484_022489                 63.9    6e-09   
gb|AFG52320.1|  hypothetical protein 2_3193_01                        61.6    6e-09   
ref|XP_010488836.1|  PREDICTED: uncharacterized protein LOC104766620  64.7    6e-09   
ref|XP_010467176.1|  PREDICTED: uncharacterized protein LOC104747266  64.7    6e-09   
ref|XP_011041447.1|  PREDICTED: uncharacterized protein LOC105137420  64.7    6e-09   
ref|XP_010518533.1|  PREDICTED: uncharacterized protein LOC104793798  64.7    6e-09   
ref|XP_011091348.1|  PREDICTED: uncharacterized protein LOC105171810  65.1    6e-09   
ref|XP_002520901.1|  conserved hypothetical protein                   64.7    6e-09   
ref|XP_010533203.1|  PREDICTED: uncharacterized protein LOC104809...  64.7    6e-09   
gb|EPS68074.1|  hypothetical protein M569_06693                       63.2    7e-09   
ref|XP_004133823.1|  PREDICTED: uncharacterized protein LOC101212280  63.9    7e-09   
ref|XP_003555498.1|  PREDICTED: uncharacterized protein LOC100812185  65.1    7e-09   
gb|KCW85316.1|  hypothetical protein EUGRSUZ_B02156                   64.3    7e-09   
ref|XP_004235211.1|  PREDICTED: uncharacterized protein LOC101249714  64.3    7e-09   
gb|AEW08214.1|  hypothetical protein 2_3193_01                        61.6    7e-09   
ref|NP_178968.1|  C2 domain-containing protein                        64.3    8e-09   
ref|XP_002276427.1|  PREDICTED: uncharacterized protein LOC100258448  63.2    8e-09   
ref|XP_003553776.1|  PREDICTED: uncharacterized protein LOC100793541  63.2    9e-09   
ref|XP_010549648.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  64.3    9e-09   
ref|XP_010043310.1|  PREDICTED: uncharacterized protein LOC104432551  63.9    9e-09   
gb|KJB28545.1|  hypothetical protein B456_005G054200                  63.9    1e-08   
ref|XP_010025828.1|  PREDICTED: uncharacterized protein LOC104416088  61.2    1e-08   
ref|XP_006489752.1|  PREDICTED: uncharacterized protein DDB_G0271...  64.3    1e-08   
ref|XP_009410493.1|  PREDICTED: uncharacterized protein LOC103992499  63.5    1e-08   
gb|KDO41882.1|  hypothetical protein CISIN_1g041258mg                 63.9    1e-08   
ref|XP_006420366.1|  hypothetical protein CICLE_v10006849mg           63.9    1e-08   
ref|XP_008437926.1|  PREDICTED: uncharacterized protein LOC103483209  62.8    1e-08   
ref|XP_006358166.1|  PREDICTED: uncharacterized protein LOC102591162  63.2    1e-08   
ref|XP_009791711.1|  PREDICTED: uncharacterized protein LOC104238906  63.2    1e-08   
ref|XP_009764572.1|  PREDICTED: uncharacterized protein LOC104216252  62.8    2e-08   
emb|CDX81442.1|  BnaC09g08530D                                        63.5    2e-08   
ref|XP_009112245.1|  PREDICTED: uncharacterized protein LOC103837642  63.5    2e-08   
emb|CDY37207.1|  BnaA09g08280D                                        63.5    2e-08   
ref|XP_006396291.1|  hypothetical protein EUTSA_v10028892mg           62.4    2e-08   
ref|XP_009136211.1|  PREDICTED: uncharacterized protein LOC103860372  63.5    2e-08   
emb|CDX89605.1|  BnaC03g45190D                                        63.5    2e-08   
ref|XP_009385178.1|  PREDICTED: uncharacterized protein LOC103972545  62.8    2e-08   
emb|CDY37206.1|  BnaA09g08270D                                        63.2    2e-08   
ref|XP_009111426.1|  PREDICTED: uncharacterized protein LOC103836878  62.0    2e-08   
ref|XP_006300066.1|  hypothetical protein CARUB_v10016294mg           63.2    2e-08   
ref|XP_009804994.1|  PREDICTED: uncharacterized protein DDB_G0292...  63.5    2e-08   
ref|XP_003590193.1|  hypothetical protein MTR_1g045780                63.2    2e-08   
ref|XP_010914471.1|  PREDICTED: uncharacterized protein LOC105039856  62.0    3e-08   
ref|XP_009795412.1|  PREDICTED: uncharacterized protein LOC104242110  63.2    3e-08   
ref|XP_011461965.1|  PREDICTED: uncharacterized protein LOC105350754  60.8    3e-08   
ref|XP_010275059.1|  PREDICTED: uncharacterized protein LOC104610232  60.5    3e-08   
gb|KDP28538.1|  hypothetical protein JCGZ_14309                       61.6    3e-08   
emb|CDP17419.1|  unnamed protein product                              62.0    3e-08   
emb|CDO99320.1|  unnamed protein product                              62.8    3e-08   
ref|XP_010544424.1|  PREDICTED: uncharacterized protein LOC104817045  61.6    3e-08   
ref|XP_010456220.1|  PREDICTED: BON1-associated protein 2-like        61.2    4e-08   
emb|CDY48509.1|  BnaA09g00140D                                        62.8    4e-08   
ref|XP_009767920.1|  PREDICTED: uncharacterized protein LOC104218993  62.4    4e-08   
ref|NP_192029.1|  calcium-dependent lipid-binding domain-containi...  61.2    4e-08   
ref|XP_007035276.1|  Calcium-dependent lipid-binding family prote...  62.4    5e-08   
gb|KDP21615.1|  hypothetical protein JCGZ_03286                       61.6    5e-08   
emb|CDY07180.1|  BnaCnng01950D                                        62.8    5e-08   
gb|ABK26354.1|  unknown                                               61.6    5e-08   
gb|KDP27783.1|  hypothetical protein JCGZ_18863                       61.6    5e-08   
gb|KJB38350.1|  hypothetical protein B456_006G251000                  60.8    7e-08   
ref|XP_006855523.1|  hypothetical protein AMTR_s00057p00209740        61.2    8e-08   
ref|XP_009604695.1|  PREDICTED: uncharacterized protein LOC104099416  61.6    8e-08   
ref|XP_010422779.1|  PREDICTED: BON1-associated protein 2-like        60.5    8e-08   
ref|XP_006289671.1|  hypothetical protein CARUB_v10003230mg           60.1    1e-07   
ref|XP_009590587.1|  PREDICTED: ankyrin repeat-containing protein...  61.2    1e-07   
ref|XP_007145354.1|  hypothetical protein PHAVU_007G232100g           61.2    1e-07   
gb|EYU43768.1|  hypothetical protein MIMGU_mgv1a006114mg              61.2    1e-07   
emb|CDY18242.1|  BnaC05g02650D                                        60.8    1e-07   
ref|XP_009600682.1|  PREDICTED: uncharacterized protein LOC104096081  60.8    1e-07   
gb|ABK23345.1|  unknown                                               59.3    1e-07   
ref|XP_010556931.1|  PREDICTED: uncharacterized protein LOC104826097  61.2    1e-07   
ref|XP_004247791.2|  PREDICTED: uncharacterized protein LOC101245204  61.2    1e-07   
ref|XP_004497792.1|  PREDICTED: uncharacterized protein LOC101505544  60.8    1e-07   
gb|KDO67597.1|  hypothetical protein CISIN_1g020960mg                 60.5    2e-07   
ref|XP_006342681.1|  PREDICTED: uncharacterized protein LOC102596842  60.8    2e-07   
ref|XP_004253020.1|  PREDICTED: uncharacterized protein LOC101244358  60.5    2e-07   
ref|XP_010251574.1|  PREDICTED: uncharacterized protein LOC104593437  59.7    2e-07   
ref|XP_011073723.1|  PREDICTED: uncharacterized protein LOC105158612  60.5    2e-07   
ref|XP_002872904.1|  C2 domain-containing protein                     59.3    2e-07   
ref|XP_010427687.1|  PREDICTED: BON1-associated protein 2-like        59.3    2e-07   
ref|XP_011044520.1|  PREDICTED: actin cytoskeleton-regulatory com...  59.7    2e-07   
ref|XP_006293875.1|  hypothetical protein CARUB_v10022860mg           60.5    2e-07   
ref|XP_008798687.1|  PREDICTED: uncharacterized protein LOC103713510  58.9    2e-07   
ref|XP_006435975.1|  hypothetical protein CICLE_v10033529mg           59.7    2e-07   
ref|XP_001759306.1|  predicted protein                                60.1    2e-07   
ref|XP_002881275.1|  C2 domain-containing protein                     60.1    2e-07   
ref|XP_006410470.1|  hypothetical protein EUTSA_v10016412mg           60.1    3e-07   
ref|XP_009621969.1|  PREDICTED: uncharacterized protein LOC104113496  60.1    3e-07   
ref|XP_009377282.1|  PREDICTED: BON1-associated protein 2             58.5    3e-07   
ref|XP_010914657.1|  PREDICTED: uncharacterized protein LOC105039993  58.5    4e-07   
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         58.9    4e-07   
gb|KJB49405.1|  hypothetical protein B456_008G117300                  57.4    4e-07   
emb|CDP08734.1|  unnamed protein product                              58.9    5e-07   
gb|KDP37957.1|  hypothetical protein JCGZ_04600                       57.4    5e-07   
ref|XP_010413889.1|  PREDICTED: uncharacterized protein LOC104700118  59.3    5e-07   
ref|XP_009143873.1|  PREDICTED: uncharacterized protein LOC103867544  59.3    5e-07   
ref|XP_002519702.1|  conserved hypothetical protein                   57.8    5e-07   
ref|XP_002315561.1|  shock protein SRC2                               58.5    5e-07   
gb|KDP33324.1|  hypothetical protein JCGZ_12873                       58.9    5e-07   
gb|KFK31057.1|  hypothetical protein AALP_AA6G062700                  58.9    5e-07   
ref|XP_008362824.1|  PREDICTED: uncharacterized protein LOC103426513  58.5    6e-07   
ref|XP_008801291.1|  PREDICTED: uncharacterized protein LOC103715451  58.5    6e-07   
ref|XP_008800861.1|  PREDICTED: formin-like protein 18                58.5    7e-07   
ref|XP_010999508.1|  PREDICTED: formin-G                              58.5    7e-07   
emb|CDY23753.1|  BnaC04g43690D                                        58.5    8e-07   
ref|XP_009401202.1|  PREDICTED: uncharacterized protein LOC103985274  57.8    8e-07   
ref|XP_009141305.1|  PREDICTED: uncharacterized protein LOC103865261  58.5    9e-07   
emb|CDY37732.1|  BnaA04g19360D                                        58.5    9e-07   
ref|XP_010522448.1|  PREDICTED: uncharacterized protein LOC104801063  58.5    9e-07   
ref|XP_010469493.1|  PREDICTED: uncharacterized protein LOC104749540  58.2    1e-06   
ref|XP_010509905.1|  PREDICTED: serine/arginine repetitive matrix...  58.2    1e-06   
gb|KJB68200.1|  hypothetical protein B456_010G231500                  57.0    1e-06   
ref|XP_009401591.1|  PREDICTED: uncharacterized protein LOC103985575  57.4    1e-06   
ref|NP_180890.1|  calcium-dependent lipid-binding domain-containi...  58.2    1e-06   
ref|XP_006371351.1|  hypothetical protein POPTR_0019s09350g           57.4    1e-06   
ref|XP_011076565.1|  PREDICTED: cleavage and polyadenylation spec...  57.4    1e-06   
ref|XP_006486118.1|  PREDICTED: probable inactive serine/threonin...  57.4    1e-06   
ref|XP_007011415.1|  Calcium-dependent lipid-binding family protein   57.4    2e-06   
gb|ACN40336.1|  unknown                                               57.4    2e-06   
ref|XP_007218843.1|  hypothetical protein PRUPE_ppa010336mg           56.6    2e-06   
ref|XP_001761054.1|  predicted protein                                56.2    2e-06   
ref|XP_010026783.1|  PREDICTED: protein bunched, class 2/F/G isof...  57.4    2e-06   
gb|KCW60206.1|  hypothetical protein EUGRSUZ_H02915                   57.4    2e-06   
gb|AES82742.2|  calcium-dependent lipid-binding (CaLB domain) fam...  56.6    2e-06   
ref|XP_010109170.1|  hypothetical protein L484_017111                 57.0    2e-06   
gb|ABK24127.1|  unknown                                               55.5    2e-06   
gb|KHN46184.1|  hypothetical protein glysoja_039908                   57.0    2e-06   
ref|XP_004494776.1|  PREDICTED: uncharacterized protein LOC101496947  56.6    2e-06   
ref|XP_003626524.1|  hypothetical protein MTR_7g116840                56.6    3e-06   
ref|XP_011468966.1|  PREDICTED: BON1-associated protein 2 isoform X2  56.6    3e-06   
ref|XP_011468965.1|  PREDICTED: BON1-associated protein 2 isoform X1  56.2    3e-06   
ref|XP_008233233.1|  PREDICTED: uncharacterized protein LOC103332288  56.2    3e-06   
ref|XP_003569491.1|  PREDICTED: uncharacterized protein LOC100842238  56.2    4e-06   
ref|XP_002511946.1|  conserved hypothetical protein                   55.8    4e-06   
ref|XP_006389230.1|  shock protein SRC2                               56.2    4e-06   
ref|XP_002516905.1|  conserved hypothetical protein                   55.8    4e-06   
gb|KCW65300.1|  hypothetical protein EUGRSUZ_G02756                   53.9    4e-06   
ref|XP_006303752.1|  hypothetical protein CARUB_v10011922mg           56.2    5e-06   
ref|XP_009399250.1|  PREDICTED: MAPK-interacting and spindle-stab...  55.8    5e-06   
ref|XP_010245272.1|  PREDICTED: uncharacterized protein LOC104588843  54.7    5e-06   
emb|CDM83573.1|  unnamed protein product                              55.8    5e-06   
gb|ABF69997.1|  C2 domain-containing protein / XYPPX domain-conta...  55.8    6e-06   
ref|XP_007051905.1|  BON association protein 2, putative              53.9    6e-06   
gb|KHN40007.1|  hypothetical protein glysoja_009384                   55.5    7e-06   
ref|XP_009347863.1|  PREDICTED: uncharacterized protein LOC103939495  55.1    7e-06   
ref|XP_010031055.1|  PREDICTED: uncharacterized protein LOC104420965  55.5    8e-06   
ref|XP_009400560.1|  PREDICTED: uncharacterized protein LOC103984726  55.1    8e-06   
gb|ABR17336.1|  unknown                                               55.5    8e-06   
ref|XP_009350266.1|  PREDICTED: uncharacterized protein LOC103941795  55.1    8e-06   
ref|XP_010557577.1|  PREDICTED: uncharacterized protein LOC104826528  55.5    9e-06   
ref|XP_003544269.1|  PREDICTED: uncharacterized protein LOC100802456  55.1    1e-05   
ref|XP_010255486.1|  PREDICTED: BON1-associated protein 2             53.1    1e-05   
ref|XP_009406969.1|  PREDICTED: uncharacterized protein LOC103989745  54.7    1e-05   
gb|ABR18223.1|  unknown                                               54.3    2e-05   
ref|XP_008679175.1|  PREDICTED: uncharacterized protein LOC103654122  54.3    2e-05   
ref|XP_009118638.1|  PREDICTED: uncharacterized protein LOC103843645  54.7    2e-05   
emb|CDY53195.1|  BnaAnng12200D                                        54.7    2e-05   
ref|XP_004508275.1|  PREDICTED: uncharacterized protein LOC101495376  53.5    2e-05   
ref|XP_010922806.1|  PREDICTED: WW domain-binding protein 11          54.3    2e-05   
ref|XP_009119477.1|  PREDICTED: uncharacterized protein LOC103844449  54.7    2e-05   
ref|XP_003518284.1|  PREDICTED: ataxin-2-like                         54.3    2e-05   
ref|XP_008803020.1|  PREDICTED: WAS/WASL-interacting protein fami...  54.3    2e-05   
ref|XP_006842600.1|  hypothetical protein AMTR_s00077p00168270        53.9    2e-05   
ref|XP_003529574.1|  PREDICTED: toll-interacting protein-like         53.9    2e-05   
ref|XP_002266989.1|  PREDICTED: formin-A                              53.9    2e-05   
ref|XP_010055064.1|  PREDICTED: uncharacterized protein LOC104443389  53.9    2e-05   
ref|XP_003609663.1|  hypothetical protein MTR_4g119780                53.1    3e-05   
ref|XP_010475114.1|  PREDICTED: uncharacterized protein LOC104754591  53.9    3e-05   
ref|XP_008791481.1|  PREDICTED: uncharacterized protein LOC103708363  53.5    3e-05   
ref|XP_010483923.1|  PREDICTED: uncharacterized protein LOC104762347  53.9    3e-05   
ref|XP_010936622.1|  PREDICTED: uncharacterized protein LOC105056210  52.8    3e-05   
ref|NP_001152648.1|  C2 domain containing protein                     53.5    3e-05   
ref|XP_002302565.1|  BON association protein 1                        52.4    3e-05   
gb|KDP30266.1|  hypothetical protein JCGZ_17048                       52.8    3e-05   
gb|KEH35505.1|  calcium-dependent lipid-binding (CaLB domain) fam...  53.5    3e-05   
ref|XP_009420756.1|  PREDICTED: uncharacterized protein LOC104000435  53.5    3e-05   
ref|XP_003572941.1|  PREDICTED: uncharacterized protein LOC100843074  53.5    3e-05   
ref|XP_004490527.1|  PREDICTED: uncharacterized protein LOC101506482  53.5    3e-05   
ref|NP_001043768.1|  Os01g0659800                                     53.5    3e-05   
emb|CDY59181.1|  BnaC08g50140D                                        53.5    4e-05   
ref|XP_010262513.1|  PREDICTED: uncharacterized protein LOC104601031  53.1    4e-05   
gb|AFK33423.1|  unknown                                               52.8    4e-05   
ref|XP_011012859.1|  PREDICTED: formin-like protein 18                53.1    5e-05   
ref|XP_002889512.1|  hypothetical protein ARALYDRAFT_470434           53.1    5e-05   
ref|XP_002968005.1|  hypothetical protein SELMODRAFT_440190           52.0    5e-05   
emb|CAN79006.1|  hypothetical protein VITISV_040896                   53.1    5e-05   



>emb|CDP14057.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 153/182 (84%), Gaps = 7/182 (4%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MA   +RPP+K  D+D+T+VSAKHLKNV+WR+GDLKPYVI W+DPDRRLATKSDDSGS +
Sbjct  1    MAATASRPPSKLCDLDITIVSAKHLKNVSWRNGDLKPYVIFWVDPDRRLATKSDDSGSNR  60

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNERFV+PLTLPPQ+SLL +EIFHS PSETPKPLVGTLR  LKDL VDS DS++L+ F
Sbjct  61   PVWNERFVLPLTLPPQDSLLTLEIFHSKPSETPKPLVGTLRFQLKDL-VDSDDSSKLRTF  119

Query  382  QLRRPSGRPQGKIRLKIAVRK--IQEYQIpppasyyyssa----ppppaTRDYGAYNPAP  543
             LRRPSGRPQGKIRLK+A+R+  +Q+YQ+ PP++YYYSSA     P  A RDY  Y+ +P
Sbjct  120  DLRRPSGRPQGKIRLKLALRERPVQDYQVTPPSTYYYSSAPPPPLPHSAARDYRGYSTSP  179

Query  544  YS  549
            Y+
Sbjct  180  YT  181



>ref|XP_007218347.1| hypothetical protein PRUPE_ppa008681mg [Prunus persica]
 gb|EMJ19546.1| hypothetical protein PRUPE_ppa008681mg [Prunus persica]
Length=322

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +1

Query  16   TVMATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGS  195
            T+MAT+   PP K  D+D+T+VSAKHLKNVNW++GDLKPY + W+D DRRLATKSDDSGS
Sbjct  40   TLMATSRP-PPPKHLDLDLTIVSAKHLKNVNWKNGDLKPYAVFWVDSDRRLATKSDDSGS  98

Query  196  TKPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK  375
            T+PVWNERF VPLTLP  +S L +EIFHS PS+TPKPLVGTLR+PLKDL  D  DST+++
Sbjct  99   TRPVWNERFTVPLTLPVHDSFLTLEIFHSKPSDTPKPLVGTLRVPLKDL-PDPDDSTRIR  157

Query  376  AFQLRRPSGRPQGKIRLKIAVRK  444
             FQL RPSGRPQGKIR+K+AVR+
Sbjct  158  TFQLVRPSGRPQGKIRVKLAVRE  180



>ref|XP_011076733.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Sesamum indicum]
Length=313

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +1

Query  22   MATAGA-RPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGST  198
            MAT+ A RPP K YD+DVTVVSAKHLKNVNWR+GDLKPYVILW++P+RR ATK DDSGST
Sbjct  1    MATSTAPRPPPKLYDLDVTVVSAKHLKNVNWRNGDLKPYVILWVEPERRQATKPDDSGST  60

Query  199  KPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST-QLK  375
            +PVWNERFV+PLTL P++S+L +EIFHS PSETPKPLVG LR  L DL+V S +S  +L+
Sbjct  61   RPVWNERFVLPLTLHPRDSILTLEIFHSKPSETPKPLVGALRFELGDLLVGSDESAVRLR  120

Query  376  AFQLRRPSGRPQGKIRLKIAV--RKIQEYQ  459
             F+L+RPSGRPQGKIRLK+ +  R ++ Y 
Sbjct  121  TFELQRPSGRPQGKIRLKLCLIERPVENYH  150



>ref|XP_010256631.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Nelumbo 
nucifera]
Length=311

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 144/184 (78%), Gaps = 9/184 (5%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MAT+   PP K  D+D+T+VSAKHLKNVNWR+GDLKPY I W+DPDRRLATK DDSGST+
Sbjct  1    MATSRP-PPPKLLDLDITIVSAKHLKNVNWRNGDLKPYAIFWVDPDRRLATKPDDSGSTR  59

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNERF + + +P Q+S+L +EIFHS PSETPKP VG+LR+PL+DL VDS DS +++ F
Sbjct  60   PVWNERFTLSINVPLQDSILNLEIFHSKPSETPKPSVGSLRLPLRDL-VDSDDSNRIRTF  118

Query  382  QLRRPSGRPQGKIRLKIAVRK-----IQEYQIp--ppasyyyssappppaTRDYGAYNPA  540
            +LRRPSGRPQGKIR+K+AVR+       +Y +   P   Y  +  PPPPA+RDY  Y+P+
Sbjct  119  ELRRPSGRPQGKIRIKLAVRERPAPPAPDYHVTPPPSYYYSSAPPPPPPASRDYRGYSPS  178

Query  541  PYSS  552
            PYS+
Sbjct  179  PYST  182



>ref|XP_009588589.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Nicotiana tomentosiformis]
Length=319

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 126/151 (83%), Gaps = 5/151 (3%)
 Frame = +1

Query  22   MAT-AGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGST  198
            MAT + +RPP+K YD+++T+VSAKHLKNVNW HGDLKPYVI W+DPD R AT++DDSG+T
Sbjct  1    MATGSSSRPPSKPYDLEITIVSAKHLKNVNWHHGDLKPYVIFWVDPDNRRATQADDSGNT  60

Query  199  KPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKA  378
            +PVWNERFV+ L   P +++L +E+FHS PSETPKPLVGTLRIPLKDL V+  D  +++ 
Sbjct  61   RPVWNERFVLHLPQSPHDTVLTLEVFHSKPSETPKPLVGTLRIPLKDL-VNLDDPNKIRP  119

Query  379  FQLRRPSGRPQGKIRLKIAVRKI---QEYQI  462
            F+LRRPSGRP GKIRLKIA+R+    Q+YQI
Sbjct  120  FELRRPSGRPHGKIRLKIAIRESPTPQDYQI  150



>ref|XP_009779320.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nicotiana sylvestris]
Length=310

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 126/151 (83%), Gaps = 5/151 (3%)
 Frame = +1

Query  22   MAT-AGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGST  198
            MAT + +RPP+K YD+++T+VSAKHLKNVNW HGDLKPY+I W+DPD R AT++DDSG+T
Sbjct  1    MATGSSSRPPSKPYDLEITIVSAKHLKNVNWHHGDLKPYLIFWVDPDNRRATQADDSGNT  60

Query  199  KPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKA  378
            +PVWNERFV+ L   P +++L +E+FHS PSETPKPLVGTLRIPLK+L V+  D  +++ 
Sbjct  61   RPVWNERFVLHLPQSPHDAVLTLEVFHSKPSETPKPLVGTLRIPLKEL-VNLDDPNKIRT  119

Query  379  FQLRRPSGRPQGKIRLKIAVRKI---QEYQI  462
            F+LRRPSGRP GKIRLK+A+R+    Q+YQI
Sbjct  120  FELRRPSGRPHGKIRLKLAIRESPNPQDYQI  150



>ref|XP_004247617.1| PREDICTED: formin-like protein 14 [Solanum lycopersicum]
Length=324

 Score =   205 bits (521),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 128/154 (83%), Gaps = 8/154 (5%)
 Frame = +1

Query  22   MAT-AGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGST  198
            MAT + +RPP K+YD+++T+VSAKHLKNVNW HGDLKPYVI W+DPD+R AT++DDSG+T
Sbjct  1    MATGSSSRPPQKTYDLEITIVSAKHLKNVNWHHGDLKPYVIFWVDPDQRRATQADDSGNT  60

Query  199  KPVWNERFVVPL---TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ  369
            +PVWNERFV+ L     PP +++L +E+FHS PSETPKPLVGTLR+PLK+L V+  D  +
Sbjct  61   RPVWNERFVLHLPQSQSPPHDAVLTLEVFHSKPSETPKPLVGTLRVPLKEL-VNVDDFNK  119

Query  370  LKAFQLRRPSGRPQGKIRLKIAVRKIQ---EYQI  462
            ++ F+LRRPSGRP GKIRLK+A+R++    +YQI
Sbjct  120  IRTFELRRPSGRPHGKIRLKLAIRELSPPLDYQI  153



>ref|XP_008343828.1| PREDICTED: formin-like protein 20 [Malus domestica]
Length=312

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP K  D+D+T+VSAKHLKNVNW++GDLKPY + W+DPDRRLATKSDDSGST+PVWNERF
Sbjct  7    PPQKPLDLDLTIVSAKHLKNVNWKNGDLKPYAVFWVDPDRRLATKSDDSGSTRPVWNERF  66

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             VPLTL   +S L +EIFHS PSET KPLVGTLR+PLKDL  D  DST+++ FQL RPSG
Sbjct  67   TVPLTLSLHDSFLTLEIFHSKPSETSKPLVGTLRVPLKDL-PDQDDSTRIRTFQLVRPSG  125

Query  403  RPQGKIRLKIAVRK  444
            RPQGKIR+K+AVR+
Sbjct  126  RPQGKIRVKLAVRE  139



>gb|EYU19982.1| hypothetical protein MIMGU_mgv1a024988mg [Erythranthe guttata]
Length=307

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = +1

Query  22   MATAGA-RPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGST  198
            MAT  A RPP K YD+DVT+VSAKHLKNVNWR+GDLKPYVILW+D DRR ATK DDSGST
Sbjct  1    MATGTAPRPPPKLYDLDVTIVSAKHLKNVNWRNGDLKPYVILWVDADRRQATKPDDSGST  60

Query  199  KPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDS-TQLK  375
            +PVWNERFV+PLTL P++S+L +EIFHS PSET KPLVGTLR  L++++V+S +S  +LK
Sbjct  61   RPVWNERFVLPLTLSPRDSVLTLEIFHSKPSETAKPLVGTLRFELREIMVNSDESPIRLK  120

Query  376  AFQLRRPSGRPQGKIRLKIAV--RKIQEYQ  459
              +L RPSGRP GKIRLK+ +  R ++ Y 
Sbjct  121  TLELHRPSGRPHGKIRLKLGLIERPVENYH  150



>ref|XP_008392919.1| PREDICTED: histone-lysine N-methyltransferase 2E [Malus domestica]
Length=356

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 135/176 (77%), Gaps = 7/176 (4%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP K  D+D+T+VSAKHLKNVNW++GDLKPY + W+DPDRRLATKSDDSGST+PVWNERF
Sbjct  42   PPQKPLDLDLTIVSAKHLKNVNWKNGDLKPYAVFWVDPDRRLATKSDDSGSTRPVWNERF  101

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             VPLTL    S L +EIFHS PS+TPKPLV TLR+PLKDL  +  DST+++ FQL RPSG
Sbjct  102  TVPLTLSLHHSFLTLEIFHSKPSDTPKPLVXTLRVPLKDL-PNQDDSTRIRTFQLVRPSG  160

Query  403  RPQGKIRLKIAVRKI-----QEYQIp-ppasyyyssappppaTRDYGAYNPAPYSS  552
            RPQGKIR+K+AVR+       +Y I  PP+ +      PPP  RD+ +Y+P+PY S
Sbjct  161  RPQGKIRVKLAVRERPLPPPPDYHITPPPSYFXXXXPMPPPPVRDFXSYSPSPYIS  216



>ref|XP_002279465.1| PREDICTED: formin-1 [Vitis vinifera]
Length=267

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 5/138 (4%)
 Frame = +1

Query  31   AGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVW  210
            A +RP     D+D+TVVSAKHL+NVNW+HG+LKPY I W+DPDRRLATK D+SGST PVW
Sbjct  2    ASSRP----LDIDLTVVSAKHLQNVNWKHGELKPYAIFWVDPDRRLATKPDESGSTCPVW  57

Query  211  NERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLR  390
            NERF V + LP  +S+L +E+FHS PSETPKPLVG+L++PLKDL VDS DS ++K FQLR
Sbjct  58   NERFTVSVNLPLHDSVLTLEVFHSKPSETPKPLVGSLQVPLKDL-VDSDDSNRIKTFQLR  116

Query  391  RPSGRPQGKIRLKIAVRK  444
            RPSGRPQGKIR+K+A+R+
Sbjct  117  RPSGRPQGKIRVKLAIRE  134



>ref|XP_009350922.1| PREDICTED: formin-like protein 20 [Pyrus x bretschneideri]
Length=351

 Score =   200 bits (509),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP K  D+D+T+VSAKHLKNVNW++GDLKPY + W DPDRRLATKSDDSGST PVWNER 
Sbjct  42   PPQKPLDLDLTIVSAKHLKNVNWKNGDLKPYAVFWADPDRRLATKSDDSGSTCPVWNERX  101

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             VPLTL   +S L +EIFHS PS+TPKPLVGTLR+PLKDL ++  DST+++ FQL RPSG
Sbjct  102  TVPLTLSLHDSFLTLEIFHSKPSDTPKPLVGTLRVPLKDL-LNQDDSTRIRTFQLVRPSG  160

Query  403  RPQGKIRLKIAVRK  444
            RPQGKIR+K+AVR+
Sbjct  161  RPQGKIRVKLAVRE  174



>gb|KDP44823.1| hypothetical protein JCGZ_01323 [Jatropha curcas]
Length=306

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP+K  D+++T+VSAKHLKNVNW++GDLK Y + W+DPDRRLATKSD+SGST+PVWNE F
Sbjct  7    PPSKPLDLELTIVSAKHLKNVNWKNGDLKAYAVFWVDPDRRLATKSDNSGSTRPVWNEHF  66

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
              PL+LP QES L +EIFHS PSETPKPLVGTLR+ LKDL  D  D+ +++ F+L RPSG
Sbjct  67   TFPLSLPLQESYLTLEIFHSKPSETPKPLVGTLRVALKDL-PDPEDANRIRNFELTRPSG  125

Query  403  RPQGKIRLKIAVRK  444
            RPQGKI++K+ VR+
Sbjct  126  RPQGKIKIKLGVRE  139



>gb|KEH34781.1| C2 domain protein [Medicago truncatula]
Length=317

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP+KS D+D+T++SAKHLKNVNW+ GDLKPYV+ W+DPDRRLATKSDDSG+T PVWNERF
Sbjct  7    PPSKSIDLDLTIISAKHLKNVNWKTGDLKPYVVFWLDPDRRLATKSDDSGNTSPVWNERF  66

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             +PL+LP Q+S L +EIFHS PS+TPKPLV TLR+PLKDL  D   ST +K F + RPSG
Sbjct  67   TLPLSLPLQDSTLTLEIFHSKPSDTPKPLVATLRLPLKDL-PDLHHSTIVKKFSVVRPSG  125

Query  403  RPQGKIRLKIAV  438
            RPQGKI LKI++
Sbjct  126  RPQGKIHLKISL  137



>ref|XP_006601957.1| PREDICTED: uncharacterized protein LOC102666594 isoform X1 [Glycine 
max]
 ref|XP_006601958.1| PREDICTED: uncharacterized protein LOC102666594 isoform X2 [Glycine 
max]
 ref|XP_006601959.1| PREDICTED: uncharacterized protein LOC102666594 isoform X3 [Glycine 
max]
 ref|XP_006601960.1| PREDICTED: uncharacterized protein LOC102666594 isoform X4 [Glycine 
max]
Length=333

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP+KS D+D+T+VSAKHLKNVNW++G+LKPYV+ W+DP+RRLATKSDDSG+T PVWNERF
Sbjct  41   PPSKSVDLDLTIVSAKHLKNVNWKNGNLKPYVVFWVDPERRLATKSDDSGNTSPVWNERF  100

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             +PL LP  +S L +EIFHS PS+TPKPLV TLR+PLKDL  D  DST+L+ F L RPSG
Sbjct  101  ALPLPLPLHDSFLTLEIFHSKPSDTPKPLVATLRLPLKDL-HDLHDSTRLRKFPLSRPSG  159

Query  403  RPQGKIRLKIAV  438
            RP GKI LK+ +
Sbjct  160  RPHGKIHLKLGL  171



>ref|XP_002526856.1| protein with unknown function [Ricinus communis]
 gb|EEF35487.1| protein with unknown function [Ricinus communis]
Length=312

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 110/141 (78%), Gaps = 12/141 (9%)
 Frame = +1

Query  73   TVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQE  252
            T+VSAKHLKNVNW++GDLK Y + W+DPDRRLATKSDDSGST+PVWNERF +PL+LP  +
Sbjct  17   TIVSAKHLKNVNWKNGDLKAYAVFWVDPDRRLATKSDDSGSTRPVWNERFTLPLSLPLHD  76

Query  253  SLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIRLKI  432
            S   +EIFHS PSETPKPLVGTLR+ LKDL  D  DST+++ F+L RPSGRPQGKIR+KI
Sbjct  77   SYFTLEIFHSKPSETPKPLVGTLRVGLKDL-FDPDDSTRIRTFELTRPSGRPQGKIRIKI  135

Query  433  AVR-----------KIQEYQI  462
              R           ++Q+Y I
Sbjct  136  GFRERPLPPPPPPPQVQDYHI  156



>ref|XP_007009086.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
 gb|EOY17896.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
Length=315

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MA +   PP +  D+D+T+VSAKHLKNVNWR+GDLKPY + W++PDRRL+T+SDDSGST+
Sbjct  1    MAASSRPPPPRLLDLDLTIVSAKHLKNVNWRNGDLKPYAVFWVNPDRRLSTRSDDSGSTR  60

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNERF +PL +P  +++L +EIFHS PSETPKPLVGTLR+ LK+L  D  D ++++ F
Sbjct  61   PVWNERFTLPLAVPLYDAVLTLEIFHSKPSETPKPLVGTLRVELKEL-PDPEDGSKIRTF  119

Query  382  QLRRPSGRPQGKIRLKIAVRK  444
             + RPSGRPQGKIR+K+ +R+
Sbjct  120  SVLRPSGRPQGKIRVKLGIRE  140



>ref|XP_002280187.1| PREDICTED: formin-like protein 14 [Vitis vinifera]
 emb|CBI15995.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            +K  D+DVT+VSAKHLKNVNWR+GDLKPY I W+DP+RR ATK DD GST+PVWNE F +
Sbjct  15   SKLMDLDVTIVSAKHLKNVNWRNGDLKPYAIFWVDPERRFATKPDDCGSTRPVWNEHFSI  74

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRP  408
            P+  PP +S+  +EIFHS PSETPKPLVG LR P+KDLV     +  ++  +LRRPSGRP
Sbjct  75   PINTPPYDSVFTLEIFHSKPSETPKPLVGVLRFPIKDLVDSDESANSIRTLELRRPSGRP  134

Query  409  QGKIRLKIAVRK  444
             GKIR+K+A+R+
Sbjct  135  NGKIRIKLALRE  146



>ref|XP_007163517.1| hypothetical protein PHAVU_001G240600g [Phaseolus vulgaris]
 gb|ESW35511.1| hypothetical protein PHAVU_001G240600g [Phaseolus vulgaris]
Length=312

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP+KS D+D+T+V+AKHLKNVNW++GDLKPYV+ W+DP+RRLATKSDDSG+T PVWNERF
Sbjct  7    PPSKSVDLDLTIVAAKHLKNVNWKNGDLKPYVVFWVDPERRLATKSDDSGNTSPVWNERF  66

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             +PL LP  +S L +EIFHS PS+T KPLV TLR+PLKDL  D  DST+L+   L RPSG
Sbjct  67   ALPLPLPLHDSFLTLEIFHSKPSDTLKPLVATLRLPLKDL-HDLNDSTRLRKLPLSRPSG  125

Query  403  RPQGKIRLKIAVRKIQEYQ  459
            RP GKI LK+ +    ++Q
Sbjct  126  RPHGKIHLKLGLLGRPQFQ  144



>ref|XP_004503391.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=797

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP+KS D+D+T++SAKHLKNVNW++GDLKPYV+ W+DPDRRLATKSDDSG+T P+WNERF
Sbjct  7    PPSKSVDLDLTILSAKHLKNVNWKNGDLKPYVVFWLDPDRRLATKSDDSGNTSPIWNERF  66

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             +PL LP Q+S L +EIFHS PS+TPKPLV TLR+PLKDL  D  DSTQ++ F L RPSG
Sbjct  67   TLPLPLPLQDSSLTLEIFHSKPSDTPKPLVATLRLPLKDL-HDLHDSTQIRKFPLIRPSG  125

Query  403  RPQGKIRLKIAV  438
            RP GKI LKI +
Sbjct  126  RPHGKIHLKIGL  137



>gb|KJB78797.1| hypothetical protein B456_013G019500 [Gossypium raimondii]
Length=294

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MA +   PP  S D+D+TVVSAKHLKNVNWR+GDLKPY + W+DPDRRL+T+SDD+GST+
Sbjct  1    MAASYRPPPPSSIDLDLTVVSAKHLKNVNWRNGDLKPYAVFWVDPDRRLSTRSDDAGSTR  60

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNERF +PL  P  + +L +EIFHS PSETPKPLV TLR+ LK+L  D  D ++++ F
Sbjct  61   PVWNERFTLPLPSPLHDVVLTLEIFHSKPSETPKPLVATLRVELKEL-PDPDDRSKIRTF  119

Query  382  QLRRPSGRPQGKIRLKIAVRK  444
             L RPSGRPQGKIR+K+ +R+
Sbjct  120  PLLRPSGRPQGKIRVKLGIRE  140



>ref|XP_010095064.1| hypothetical protein L484_026371 [Morus notabilis]
 gb|EXB58170.1| hypothetical protein L484_026371 [Morus notabilis]
Length=344

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRH-GDLKPYVILWIDPDRRLATKSDDSGST  198
            MA++   PP+K  D+D+T+VSAKHLKNVNWR+ G+LKPY + W+DPDRRLATKSDDSGST
Sbjct  44   MASSRLPPPSKPLDLDLTIVSAKHLKNVNWRNFGELKPYAVFWLDPDRRLATKSDDSGST  103

Query  199  KPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKA  378
            +PVWNERF +PLT    +S L +EIFHS PS+T KPLVGTLR+PLKD   D  D  +++ 
Sbjct  104  RPVWNERFTLPLTASLHDSFLTLEIFHSKPSDTTKPLVGTLRVPLKD-QPDLDDPNRIRT  162

Query  379  FQLRRPSGRPQGKIRLKIAVRK  444
            F L RPSGRPQGKIR+K+AVR+
Sbjct  163  FTLIRPSGRPQGKIRIKLAVRE  184



>ref|XP_003600860.1| BAHD acyltransferase DCR [Medicago truncatula]
Length=840

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP+KS D+D+T++SAKHLKNVNW+ GDLKPYV+ W+DPDRRLATKSDDSG+T PVWNERF
Sbjct  7    PPSKSIDLDLTIISAKHLKNVNWKTGDLKPYVVFWLDPDRRLATKSDDSGNTSPVWNERF  66

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             +PL+LP Q+S L +EIFHS PS+TPKPLV TLR+PLKDL  D   ST +K F + RPSG
Sbjct  67   TLPLSLPLQDSTLTLEIFHSKPSDTPKPLVATLRLPLKDL-PDLHHSTIVKKFSVVRPSG  125

Query  403  RPQGKIRLKIAV  438
            RPQGKI LKI++
Sbjct  126  RPQGKIHLKISL  137



>gb|KJB74226.1| hypothetical protein B456_011G280500 [Gossypium raimondii]
Length=305

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MAT    PP +  D+D+T+VSAKHLKNVNW++GDLKPY + W+DPDRRL+T+SDDSGST+
Sbjct  1    MATHSRPPPPRPLDLDLTIVSAKHLKNVNWQNGDLKPYAVFWVDPDRRLSTRSDDSGSTR  60

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNERF +PL +PP E++L +EIFHS PSETPKPLV TLR+ LK+L  D  D ++++ F
Sbjct  61   PVWNERFTLPLVVPPHETVLTLEIFHSKPSETPKPLVATLRVELKEL-PDLDDGSKIRTF  119

Query  382  QLRRPSGRPQGKIRLKIAVRK  444
             L RPSGRPQGKIRLK+ +R+
Sbjct  120  SLLRPSGRPQGKIRLKLGIRE  140



>gb|ACV71018.1| UPA18 [Capsicum annuum]
Length=341

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 118/140 (84%), Gaps = 4/140 (3%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D+++T+VSAKHLKNVNW +GDL+PYVI W+DPD+R AT+SDDSG+T+PVWNERF++ 
Sbjct  13   KTSDLEITIVSAKHLKNVNWHNGDLRPYVIFWVDPDQRRATQSDDSGNTRPVWNERFILH  72

Query  232  LTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQ  411
            L    Q+++L +EIFHS PS+TPKPLVGTLR+PLK+L V+  D  ++++F+LRRPSGRP 
Sbjct  73   LPQSRQDTVLTLEIFHSKPSDTPKPLVGTLRVPLKEL-VNIDDFGKVRSFELRRPSGRPH  131

Query  412  GKIRLKIAVR---KIQEYQI  462
            GKI+LK+ VR   +I +YQI
Sbjct  132  GKIKLKLGVREVSRIHDYQI  151



>ref|XP_011041338.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Populus 
euphratica]
Length=311

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP    D+D+T++SAKHLKNVNW+ G LKPY + W+DP RRL+TKSD+SGST+PVWNERF
Sbjct  7    PPQVPLDLDLTIISAKHLKNVNWKTGALKPYAVFWVDPSRRLSTKSDESGSTRPVWNERF  66

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
             +PLT   ++S L +EIFHS PSETPKPLVGTLR+ LKDL  D  DS +++  +L RPSG
Sbjct  67   TLPLTFALRDSFLTLEIFHSKPSETPKPLVGTLRVALKDL-SDPDDSNRVRTLELTRPSG  125

Query  403  RPQGKIRLKIAVRK  444
            RPQGKIR+K+ VR+
Sbjct  126  RPQGKIRIKLGVRE  139



>gb|ABK92946.1| unknown [Populus trichocarpa]
Length=311

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +1

Query  73   TVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQE  252
            T++SAKHLKNVNW+ GDLKPY + W+DP RRL+TKSD+SGST+PVWNERF +PLT   ++
Sbjct  17   TIISAKHLKNVNWKTGDLKPYAVFWVDPSRRLSTKSDESGSTRPVWNERFTLPLTFALRD  76

Query  253  SLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIRLKI  432
            S L +EIFHS PSETPKPLVGTLR+ LKDL  D  DS +++  +L RPSGRPQGKIR+K+
Sbjct  77   SFLTLEIFHSKPSETPKPLVGTLRVALKDL-SDPDDSNRVRTLELTRPSGRPQGKIRIKL  135

Query  433  AVRK  444
             VR+
Sbjct  136  GVRE  139



>ref|XP_002311204.1| hypothetical protein POPTR_0008s06510g [Populus trichocarpa]
 gb|EEE88571.1| hypothetical protein POPTR_0008s06510g [Populus trichocarpa]
Length=311

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +1

Query  73   TVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQE  252
            T++SAKHLKNVNW+ GDLKPY + W+DP RRL+TKSD+SGST+PVWNERF +PLT   ++
Sbjct  17   TIISAKHLKNVNWKTGDLKPYAVFWVDPSRRLSTKSDESGSTRPVWNERFTLPLTFALRD  76

Query  253  SLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIRLKI  432
            S L +EIFHS PSETPKPLVGTLR+ LKDL  D  DS +++  +L RPSGRPQGKIR+K+
Sbjct  77   SFLTLEIFHSKPSETPKPLVGTLRVALKDL-SDPDDSNRVRTLELTRPSGRPQGKIRIKL  135

Query  433  AVRK  444
             VR+
Sbjct  136  GVRE  139



>emb|CAN64035.1| hypothetical protein VITISV_020002 [Vitis vinifera]
Length=239

 Score =   176 bits (446),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +1

Query  31   AGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVW  210
            A +RP     D+D+TVVSAKHLKNVNW+HG+LKPY I W+DPDRRLATK D+SGST PVW
Sbjct  2    ASSRP----LDIDITVVSAKHLKNVNWKHGELKPYAIFWVDPDRRLATKPDESGSTCPVW  57

Query  211  NERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLR  390
            NERF + + LP  +S+L +E+FHS PSETPKPLVG+L++     + DS DS  +K FQLR
Sbjct  58   NERFTLSVNLPLHDSVLTLEVFHSKPSETPKPLVGSLQV-XLKDLXDSDDSNXIKTFQLR  116

Query  391  RPSGRPQGKIRLKIAVR  441
            RPSGRPQGKIR+K+A+R
Sbjct  117  RPSGRPQGKIRVKLAIR  133



>ref|XP_009421318.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Musa 
acuminata subsp. malaccensis]
Length=358

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 109/140 (78%), Gaps = 13/140 (9%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D++VTVVSAKHLKNVNWR+GDLKPYV+ ++DPD R+ATK DD+GS +PVWNER  +PL L
Sbjct  18   DLEVTVVSAKHLKNVNWRNGDLKPYVVAYLDPDCRVATKPDDAGSIRPVWNERLALPLPL  77

Query  241  PPQESL--LAVEIFHSVPSETPKPLVGTLRIPLKDLV----------VDSGDSTQLKAFQ  384
            P  E+L  L +++FHS PSETPKPLVGT R P+KDL+          VD G  + ++  +
Sbjct  78   PSSETLLFLTLDVFHSKPSETPKPLVGTARSPVKDLLDPDAFTVGGGVD-GSPSPIRTLE  136

Query  385  LRRPSGRPQGKIRLKIAVRK  444
            LRRPSGRPQGKIR+K+A+R+
Sbjct  137  LRRPSGRPQGKIRIKLAIRE  156



>ref|XP_002314120.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ABK93791.1| unknown [Populus trichocarpa]
 gb|EEE88075.1| C2 domain-containing family protein [Populus trichocarpa]
Length=308

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 126/180 (70%), Gaps = 14/180 (8%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWID-PDRRLATKSDDSGSTKPVWNERFV  225
            +KS+D+++T++SAKHLKNVNWR+GDLKPY   ++D  DRRLAT +DDS ST+PVWNERF 
Sbjct  4    SKSHDLEITIISAKHLKNVNWRNGDLKPYATFYLDNSDRRLATHADDSLSTRPVWNERFT  63

Query  226  VPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-DSGDSTQLKAFQLRRPSG  402
            +P+T    +S+L +EIFHS PSETP+PLVGT++ PL +L+V D   S ++   +L RPSG
Sbjct  64   LPITRQIYDSVLTLEIFHSKPSETPQPLVGTVKFPLSNLMVSDESLSCEVLTLELLRPSG  123

Query  403  RPQGKIRLKIAVRK------IQEYQIp------ppasyyyssappppaTRDYGAYNPAPY  546
            RPQGK+R+K+ V++      +Q+Y            +      PPPP  RDY  Y+P+PY
Sbjct  124  RPQGKVRVKLEVKERPLPPPVQDYHTAPNYSHYYNPAPAPPPPPPPPPARDYREYSPSPY  183



>ref|XP_011032146.1| PREDICTED: basic salivary proline-rich protein 1 [Populus euphratica]
Length=305

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 125/179 (70%), Gaps = 13/179 (7%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWID-PDRRLATKSDDSGSTKPVWNERFV  225
            +KSYD+++T++SAKHLKNVNWR+GDLKPY   ++D  D RLAT +DDS ST+PVWNERF 
Sbjct  4    SKSYDLEITIISAKHLKNVNWRNGDLKPYATFYLDNSDHRLATHADDSLSTRPVWNERFT  63

Query  226  VPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-DSGDSTQLKAFQLRRPSG  402
            +P+T    +S+L +EIFHS PSETP+PLVGT++ PL +L+  D   S +++  +L RPSG
Sbjct  64   LPITRQIYDSVLTLEIFHSKPSETPQPLVGTVKFPLSNLIASDESLSCEVRTLELLRPSG  123

Query  403  RPQGKIRLKIAVRK------IQEYQIpppasy-----yyssappppaTRDYGAYNPAPY  546
            RPQGK+R+K+ V++      +Q+Y   P  S+          PP P  RDY  Y P+PY
Sbjct  124  RPQGKVRVKLEVKERPLPPPVQDYHTAPNYSHYYNPAPAPPPPPAPPARDYREYAPSPY  182



>ref|XP_011469892.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Fragaria 
vesca subsp. vesca]
Length=311

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  73   TVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQE  252
            T+VSAKHLKNVNW++GDLKPY + W+DPDRRLATKSDDSGST+PVWNERF +PL+L   +
Sbjct  17   TIVSAKHLKNVNWKNGDLKPYAVFWVDPDRRLATKSDDSGSTRPVWNERFTLPLSLSLHD  76

Query  253  SLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIRLKI  432
            SLL +EIFHS PS+TPKPLVG+LR+PL+DL  D  D T+++ F+L RPSGRP GKIR+K+
Sbjct  77   SLLTLEIFHSKPSDTPKPLVGSLRLPLRDL-PDPDDPTRIRTFELVRPSGRPHGKIRVKL  135

Query  433  AVRK  444
            A R+
Sbjct  136  AFRE  139



>ref|XP_010031258.1| PREDICTED: formin-like protein 20 [Eucalyptus grandis]
 gb|KCW50518.1| hypothetical protein EUGRSUZ_J00241 [Eucalyptus grandis]
Length=352

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 111/148 (75%), Gaps = 8/148 (5%)
 Frame = +1

Query  22   MATAGARPP---AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSG  192
            MA++   PP   AK  ++D+TVVSAKHLKNVNWR GDLKPY I W+DPDRRLAT+ DD+G
Sbjct  1    MASSRIPPPSAAAKLLELDLTVVSAKHLKNVNWRSGDLKPYAIFWVDPDRRLATRPDDAG  60

Query  193  STKPVWNERFVV----PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGD  360
            ST+PVWNE+F +    P    P  + L +E+FHS PSETPKPLVG+L +PL+DL  D  D
Sbjct  61   STRPVWNEQFSIPLPFPALPLPDSAALTLEVFHSKPSETPKPLVGSLLLPLRDL-SDPHD  119

Query  361  STQLKAFQLRRPSGRPQGKIRLKIAVRK  444
              +++ ++L RPSGRP GKIR+K+A+ +
Sbjct  120  RDRIRTYELLRPSGRPHGKIRIKLALHE  147



>ref|XP_010557218.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Tarenaya 
hassleriana]
Length=359

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++ +D+ +TVVSAKHLKNVNWR GDLKP+V+L++DPD RL+T+SDDSGSTKPVWNER  +
Sbjct  4    SEPFDLVITVVSAKHLKNVNWREGDLKPFVVLYLDPDHRLSTRSDDSGSTKPVWNERITL  63

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST---QLKAFQLRRPS  399
            PLT P  ES++ VEIFHS  S+  K LVG++R PL  L VDS  +     ++A +L RPS
Sbjct  64   PLTRPVHESVVTVEIFHSKSSDLAKTLVGSVRFPLAHL-VDSDPAILPDSVQALELVRPS  122

Query  400  GRPQGKIRLKIAVRK  444
            GRPQGKIRLK+A+++
Sbjct  123  GRPQGKIRLKLAIKE  137



>ref|XP_006425035.1| hypothetical protein CICLE_v10028899mg [Citrus clementina]
 ref|XP_006488489.1| PREDICTED: amyloid beta A4 precursor protein-binding family B 
member 1-interacting protein-like isoform X1 [Citrus sinensis]
 ref|XP_006488490.1| PREDICTED: amyloid beta A4 precursor protein-binding family B 
member 1-interacting protein-like isoform X2 [Citrus sinensis]
 ref|XP_006488491.1| PREDICTED: amyloid beta A4 precursor protein-binding family B 
member 1-interacting protein-like isoform X3 [Citrus sinensis]
 gb|ESR38275.1| hypothetical protein CICLE_v10028899mg [Citrus clementina]
 gb|KDO66826.1| hypothetical protein CISIN_1g021710mg [Citrus sinensis]
 gb|KDO66827.1| hypothetical protein CISIN_1g021710mg [Citrus sinensis]
Length=308

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 107/131 (82%), Gaps = 3/131 (2%)
 Frame = +1

Query  55   SYDVDVTVVSAKHLKNVNWRHG-DLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            ++D+++T++ AKHLKNVNWR+G DLKPYV+ ++DP  RLAT+SDDSGST+PVWNERF +P
Sbjct  18   THDLEITIICAKHLKNVNWRNGGDLKPYVVFYVDPAYRLATQSDDSGSTRPVWNERFTLP  77

Query  232  LTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-VDSGDSTQ-LKAFQLRRPSGR  405
            +T   +ES+L +EIFHS  SETPKPLVG+++ PL  LV  DS + TQ ++  ++ RPSGR
Sbjct  78   ITHSVRESVLTLEIFHSKLSETPKPLVGSVKFPLAHLVDSDSSEPTQYVRKLEVLRPSGR  137

Query  406  PQGKIRLKIAV  438
            PQGKIR+K+ +
Sbjct  138  PQGKIRVKLVL  148



>ref|XP_010923111.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Elaeis 
guineensis]
 ref|XP_010923112.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Elaeis 
guineensis]
Length=321

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 107/155 (69%), Gaps = 19/155 (12%)
 Frame = +1

Query  31   AGARPP-AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPV  207
            A  RPP  K  D+++TVVSAKHLKNVNWRHGDLKPY + ++DPDRR ATK DD+G+T+PV
Sbjct  2    ASPRPPQVKPLDLEITVVSAKHLKNVNWRHGDLKPYAVAYLDPDRRAATKPDDAGNTRPV  61

Query  208  WNERFVVPLTL----PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL-----------  342
            WNER  +PL L    PP    L ++IFHS PSETPKPLVGT    +KDL           
Sbjct  62   WNERLSLPLPLSLIDPPL--FLTLDIFHSKPSETPKPLVGTAHCSVKDLLGSDAFAVAAS  119

Query  343  -VVDSGDSTQLKAFQLRRPSGRPQGKIRLKIAVRK  444
             V   G    +K  +LRRPSGRPQGKIR+K+A+R+
Sbjct  120  GVALDGSPLPIKTLELRRPSGRPQGKIRIKLAIRE  154



>ref|XP_009404578.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Musa acuminata subsp. malaccensis]
Length=354

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 106/140 (76%), Gaps = 16/140 (11%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D++VTVVSA HLKNVNWR+GDLKPYV++++DPDRR A+K DD+GST+PVWNER  +P  L
Sbjct  25   DLEVTVVSANHLKNVNWRNGDLKPYVVVYLDPDRRAASKPDDAGSTRPVWNERLALP--L  82

Query  241  PPQESL--LAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGDSTQ---------LKA  378
            P  E+L  L +++FHS PSETPKPLVGT R  LKDL+     +G +T          ++ 
Sbjct  83   PSAETLLFLTLDVFHSKPSETPKPLVGTARSRLKDLLHQDAFAGYATGRGGGAPPSPVRT  142

Query  379  FQLRRPSGRPQGKIRLKIAV  438
             +LRRPSGRPQGKIR+++A+
Sbjct  143  LELRRPSGRPQGKIRIRLAI  162



>ref|XP_010910417.1| PREDICTED: extensin-2-like [Elaeis guineensis]
 ref|XP_010910418.1| PREDICTED: extensin-2-like [Elaeis guineensis]
 ref|XP_010910419.1| PREDICTED: extensin-2-like [Elaeis guineensis]
Length=329

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 102/143 (71%), Gaps = 15/143 (10%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT-  237
            D++VTVVSA HLKNVNW+HGDLK Y + ++DPDRR+ATK DD+G+T+PVWNER  +PL  
Sbjct  16   DLEVTVVSAMHLKNVNWQHGDLKAYAVAYLDPDRRVATKPDDAGNTRPVWNERLFLPLAP  75

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL-------------VVDSGDSTQLK  375
             L     LL +++FHS PSETPKPLVGT R PLKDL             V   G  + +K
Sbjct  76   TLLDPALLLTLDVFHSKPSETPKPLVGTARCPLKDLLGPDAFEAASSSGVAVDGCPSPIK  135

Query  376  AFQLRRPSGRPQGKIRLKIAVRK  444
              +L RPSGRPQGKIR+K+A+R+
Sbjct  136  TLELSRPSGRPQGKIRIKVAIRE  158



>ref|XP_002299823.2| hypothetical protein POPTR_0001s25640g, partial [Populus trichocarpa]
 gb|EEE84628.2| hypothetical protein POPTR_0001s25640g, partial [Populus trichocarpa]
Length=293

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 10/174 (6%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWID-PDRRLATKSDDSGSTKPVWNERFVV  228
            K   +++T++SAKHLKNVNWR+GDLKPY   ++D  D RLAT +DDS ST+PVWNERF +
Sbjct  5    KPLHLEITIISAKHLKNVNWRNGDLKPYATFYLDNSDHRLATHADDSLSTRPVWNERFTI  64

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-VDSGDSTQLKAFQLRRPSGR  405
            P+     +S+L +++FHS PSETPKPLVGT + PL  L+  D   S  L+  +L RPSGR
Sbjct  65   PMIR--HDSVLTLDVFHSKPSETPKPLVGTGKFPLSQLLDSDETTSYSLRTLELSRPSGR  122

Query  406  PQGKIRLKIAVRK------IQEYQIpppasyyyssappppaTRDYGAYNPAPYS  549
            PQGK+ +K+ V+       +Q+Y   P  S+YY+ AP  P  RDY  Y+P+PY 
Sbjct  123  PQGKVLVKLEVKDRPLPPPVQDYHTAPNYSHYYNPAPVQPPARDYREYSPSPYG  176



>ref|XP_010690030.1| PREDICTED: uncharacterized protein LOC104903656 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690039.1| PREDICTED: uncharacterized protein LOC104903656 [Beta vulgaris 
subsp. vulgaris]
Length=283

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            +++++T++S KHLKNVNW++G+LKPYVI W++PD +L TKSDDS +TKPVWN+RF++P+ 
Sbjct  25   FNLEITIISGKHLKNVNWKNGNLKPYVIFWVNPDNKLTTKSDDSCNTKPVWNQRFILPIN  84

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGK  417
                ++ L++EIFHS+ SETPKP VG+L++ L  L  +  +    + F+L RPSGR QGK
Sbjct  85   SSLSDAFLSLEIFHSITSETPKPFVGSLQVRLATL-PEPENPNLTRTFELLRPSGRVQGK  143

Query  418  IRLKIAVRK  444
            IRLK+++++
Sbjct  144  IRLKLSIKE  152



>ref|XP_008785412.1| PREDICTED: extensin-like [Phoenix dactylifera]
Length=329

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 104/154 (68%), Gaps = 16/154 (10%)
 Frame = +1

Query  31   AGARPP-AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPV  207
            A  RPP  K  D+++TVVSAKHLKNVNW HGDLKPY + ++DPDRR ATK DD+G+T+PV
Sbjct  2    ASPRPPQGKPLDLEITVVSAKHLKNVNWHHGDLKPYAVAYLDPDRRAATKPDDAGNTRPV  61

Query  208  WNER--FVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL-------------  342
            WNER    +P +L      L  +IFHS PSETPKPLVGT R  +KDL             
Sbjct  62   WNERLSLPLPPSLLDPPLFLTFDIFHSKPSETPKPLVGTARCSVKDLLGPDAFAAAASSG  121

Query  343  VVDSGDSTQLKAFQLRRPSGRPQGKIRLKIAVRK  444
            V   G    +K  +LRRPSGRPQGKIR+K+A+R+
Sbjct  122  VALDGSPVPIKTLELRRPSGRPQGKIRIKVAIRE  155



>ref|XP_010043451.1| PREDICTED: formin-like protein 20 [Eucalyptus grandis]
 gb|KCW85464.1| hypothetical protein EUGRSUZ_B02272 [Eucalyptus grandis]
Length=391

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 103/138 (75%), Gaps = 10/138 (7%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPY--VILWIDPDRRLATKSDDSGSTKPVWNERFVVPL  234
            D+++TVVSAKHLKNVNWR+GDLKPY  V L  DP  RL+T+ DDSGST+PVWNE   +PL
Sbjct  8    DLEITVVSAKHLKNVNWRNGDLKPYAAVCLDHDPHLRLSTRPDDSGSTRPVWNETLTIPL  67

Query  235  TLPPQ--------ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLR  390
            + P          ++ LAV++FHS PSETPKPLVG+ R+PL  L+   GD+ ++ A  L 
Sbjct  68   SAPAAAAASSSPGDATLAVQVFHSRPSETPKPLVGSARLPLSQLLDSDGDAPRVYALDLY  127

Query  391  RPSGRPQGKIRLKIAVRK  444
            RPSGRPQGK+R+K+AVR+
Sbjct  128  RPSGRPQGKLRVKLAVRE  145



>ref|XP_011035190.1| PREDICTED: uncharacterized protein LOC105133073 isoform X1 [Populus 
euphratica]
 ref|XP_011035191.1| PREDICTED: uncharacterized protein LOC105133073 isoform X2 [Populus 
euphratica]
Length=360

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 120/173 (69%), Gaps = 10/173 (6%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWID-PDRRLATKSDDSGSTKPVWNERFVV  228
            K   +++T++SAKHLKNVNWR+GDLKPY   ++D  D RLAT +DDS ST+PVWNERF +
Sbjct  66   KPLHLEITIISAKHLKNVNWRNGDLKPYATFYLDNSDNRLATHADDSLSTRPVWNERFTI  125

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-VDSGDSTQLKAFQLRRPSGR  405
            P+     +S+L +++FHS PSETPKPLVGT++ PL  L+  D   S  ++  +L RPSGR
Sbjct  126  PIIR--HDSVLTLDVFHSKPSETPKPLVGTVKFPLSQLLDSDETTSYSVRTLELSRPSGR  183

Query  406  PQGKIRLKIAVRK------IQEYQIpppasyyyssappppaTRDYGAYNPAPY  546
            PQGK+ +K+ V++      +Q+Y   P  S+YY+ AP  P  RDY   +P+PY
Sbjct  184  PQGKVLVKLEVKERPLPPPVQDYHTAPNYSHYYNPAPVQPPARDYRECSPSPY  236



>ref|XP_006305205.1| hypothetical protein CARUB_v10009572mg [Capsella rubella]
 gb|EOA38103.1| hypothetical protein CARUB_v10009572mg [Capsella rubella]
Length=355

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D RL+T+SDDS S KPVWNER  +PLT 
Sbjct  8    DLVVTVVSAKHLKNVNWRNGDLKPYVVLYLDQDHRLSTRSDDSASIKPVWNERITLPLTR  67

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ--LKAFQLRRPSGRPQG  414
               ES+L +EIFHS  S+  K LVG++R PL  L+   G      + + +L RPSGRPQG
Sbjct  68   SVHESVLNIEIFHSNSSDLAKTLVGSVRFPLARLIDSDGSMIPELVNSLELVRPSGRPQG  127

Query  415  KIRLKIAVRK  444
            KIRLK+++++
Sbjct  128  KIRLKLSIKE  137



>ref|XP_002456650.1| hypothetical protein SORBIDRAFT_03g040170 [Sorghum bicolor]
 gb|EES01770.1| hypothetical protein SORBIDRAFT_03g040170 [Sorghum bicolor]
Length=330

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 15/144 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K++D++VTVVS KHLKNVNWR GDL+ Y ++++DP RR AT+ DD G  KP WNER V+P
Sbjct  46   KAFDLEVTVVSGKHLKNVNWRRGDLRAYAVVYLDPSRRAATRPDDGGGCKPTWNERLVLP  105

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-------DSTQL  372
              LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+  +         ++ L
Sbjct  106  --LPPHLSPHDPSILLSLDVFHSKPSDSPKPLVGSARSPLRDLLYPANPNPSHDPAASAL  163

Query  373  KAFQLRRPSGRPQGKIRLKIAVRK  444
             +  L RPSGRPQGKIR+++A+R+
Sbjct  164  VSLPLLRPSGRPQGKIRVRVAIRE  187



>ref|NP_563785.1| calcium-dependent lipid-binding domain protein [Arabidopsis thaliana]
 gb|AAF79559.1|AC022464_17 F22G5.35 [Arabidopsis thaliana]
 gb|AAK96837.1| similar to SRC2 [Arabidopsis thaliana]
 gb|AAM10051.1| similar to SRC2 dbj|BAA19769 [Arabidopsis thaliana]
 gb|AEE28105.1| calcium-dependent lipid-binding domain protein [Arabidopsis thaliana]
Length=352

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D  L+T+SDDS S KPVWNER  +PLT 
Sbjct  8    DLVVTVVSAKHLKNVNWRNGDLKPYVVLYLDQDHPLSTRSDDSSSIKPVWNERITLPLTR  67

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ--LKAFQLRRPSGRPQG  414
               ES+L +E+FHS  S+  K LVG++R PL  L+   G      + + +L RPSGRPQG
Sbjct  68   SVHESVLNIEVFHSNSSDLAKTLVGSVRFPLARLIDSDGSMIPELINSLELVRPSGRPQG  127

Query  415  KIRLKIAVR  441
            KIRLK+A++
Sbjct  128  KIRLKLAIK  136



>ref|XP_002892394.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68653.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=349

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 96/130 (74%), Gaps = 2/130 (2%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D   +T+SDDS S KPVWNER  +PLT 
Sbjct  8    DLVVTVVSAKHLKNVNWRNGDLKPYVVLYLDQDHPHSTRSDDSASIKPVWNERITLPLTR  67

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDS--TQLKAFQLRRPSGRPQG  414
               ES+L +EIFHS  S+  K LVG++R PL  L+   G      + + +L RPSGRPQG
Sbjct  68   SVHESVLNIEIFHSNSSDLAKTLVGSVRFPLARLIDSDGSMIPESINSLELVRPSGRPQG  127

Query  415  KIRLKIAVRK  444
            KIRLK+A+++
Sbjct  128  KIRLKLAIKE  137



>ref|NP_001132444.1| Ras association and pleckstrin y domain 1 isoform 2 [Zea mays]
 gb|ACF81284.1| unknown [Zea mays]
 gb|ACG35101.1| ras association and pleckstrin homology domains 1 isoform 2 [Zea 
mays]
 gb|AFW84533.1| Ras association and pleckstrin y domain 1 isoform 2 [Zea mays]
Length=327

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 15/144 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D++VTVV  KHLKNVNWR GDL+ YV++++DP RR AT+ DD G  KP WNER V+P
Sbjct  43   KALDLEVTVVCGKHLKNVNWRRGDLRAYVVVYLDPSRRAATRPDDGGGCKPTWNERLVLP  102

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-------DSTQL  372
              LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+  +         ++ L
Sbjct  103  --LPPHLSPHDPSILLSLDVFHSKPSDSPKPLVGSARSPLRDLLFPANPNPSHDPAASAL  160

Query  373  KAFQLRRPSGRPQGKIRLKIAVRK  444
             +  L RPSGRPQGKIR+++A+R+
Sbjct  161  VSLPLLRPSGRPQGKIRIRVAIRE  184



>ref|XP_006417816.1| hypothetical protein EUTSA_v10008043mg [Eutrema salsugineum]
 gb|ESQ36169.1| hypothetical protein EUTSA_v10008043mg [Eutrema salsugineum]
Length=354

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++DPD RL+T+SDD  S KPVWNER  +PLT 
Sbjct  8    DLVVTVVSAKHLKNVNWRNGDLKPYVVLYLDPDHRLSTRSDD--SIKPVWNERITLPLTR  65

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGD--STQLKAFQLRRPSGRPQG  414
               ES+L +EIFHS  S+  K LVG++R PL  LV   G      + + +L RPSGRPQG
Sbjct  66   SVHESVLNIEIFHSYSSDLAKTLVGSVRFPLARLVDSEGAVIPELINSLELVRPSGRPQG  125

Query  415  KIRLKIAVRK  444
            KIRLK+ + +
Sbjct  126  KIRLKLTINE  135



>ref|XP_004970615.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Setaria 
italica]
Length=325

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 15/142 (11%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            +D++VTVVS KHLKNVNWR GDL+ YV+ ++DP RR AT+ DD+G  KP WNER V+P  
Sbjct  45   FDLEVTVVSGKHLKNVNWRRGDLRAYVVAYLDPSRRAATRPDDAGGCKPAWNERLVLP--  102

Query  238  LPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-----DSGDS--TQLKA  378
            LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+       S DS  + L +
Sbjct  103  LPPHLSPHDPSILLSLDVFHSKPSDSPKPLVGSARSPLRDLLFPTNPNPSHDSAASPLVS  162

Query  379  FQLRRPSGRPQGKIRLKIAVRK  444
              L RPSGRPQGK+R+++A+R+
Sbjct  163  LPLLRPSGRPQGKLRIRVAIRE  184



>emb|CDY06697.1| BnaA10g04760D [Brassica napus]
Length=319

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 100/134 (75%), Gaps = 7/134 (5%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            +++ D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D R++T+SDD  S KPVWNER  +
Sbjct  5    SETLDLVVTVVSAKHLKNVNWRNGDLKPYVVLYLDSDHRVSTRSDD--SAKPVWNERITL  62

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST--QLKAFQLRRPSG  402
            PLT    ES+L VEIFH   S+  KPLVG++R PL  LV   G      + + +L RPSG
Sbjct  63   PLTRSVHESVLNVEIFH---SDAAKPLVGSVRFPLVRLVDSEGAMVPESISSLELLRPSG  119

Query  403  RPQGKIRLKIAVRK  444
            RPQGKIRLK+A+++
Sbjct  120  RPQGKIRLKLAIKE  133



>emb|CDY09924.1| BnaC08g45270D [Brassica napus]
Length=332

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 102/141 (72%), Gaps = 9/141 (6%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MA++ + P     ++ VTVVSAKHLKNVNWR+GDLKPYV+L++D D RL+T+SDD  STK
Sbjct  1    MASSSSEP----LELIVTVVSAKHLKNVNWRNGDLKPYVVLYLDSDHRLSTRSDD--STK  54

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNER  +PLT    ES+L VEIFHS  S+  K LVG++R PL  L+   G    + + 
Sbjct  55   PVWNERITLPLTRSVHESVLNVEIFHSNSSDLGKALVGSVRFPLVRLIDSEG---AINSL  111

Query  382  QLRRPSGRPQGKIRLKIAVRK  444
            +L RPSGR QGKIRLK+ +++
Sbjct  112  ELIRPSGRTQGKIRLKLEIKE  132



>ref|XP_010457903.1| PREDICTED: extensin-like [Camelina sativa]
Length=359

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D+RL+T+SDDS S KPVWNER  +PLT 
Sbjct  8    DLIVTVVSAKHLKNVNWRNGDLKPYVVLYLDQDQRLSTRSDDSASVKPVWNERITLPLTR  67

Query  241  PPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGD--STQLKAFQLRRPSGRP  408
               ES+L +E+FH  S  S+  K LVG++R PL  L+   G      + + +L RPSGRP
Sbjct  68   SVHESVLNIEVFHSNSNSSDLAKTLVGSVRFPLARLIDSDGSIIPELINSLELVRPSGRP  127

Query  409  QGKIRLKIAVR  441
            QGKIRLK++++
Sbjct  128  QGKIRLKLSIK  138



>gb|KFK43060.1| hypothetical protein AALP_AA1G073200 [Arabis alpina]
Length=324

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  DV VTVVSAK+LKNVNWR+GDLKPYV+L++DP+ RL T+ DD  STKPVWNER  +
Sbjct  4    SEQLDVIVTVVSAKNLKNVNWRNGDLKPYVVLYLDPENRLTTRFDD--STKPVWNERITL  61

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ--LKAFQLRRPSG  402
            P+T    ES+L VE+FHS  S+  K L+G++R PL  L+   G      + + +L RPSG
Sbjct  62   PITRSVHESVLNVEVFHSNSSDLAKTLIGSVRFPLTRLIDSDGSMIHELINSLELVRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RPQGKIRLK+A+++
Sbjct  122  RPQGKIRLKLAIKE  135



>ref|XP_010475485.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X2 [Camelina sativa]
Length=358

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D+RL+T+SDDS S KPVWNER  +PLT 
Sbjct  8    DLIVTVVSAKHLKNVNWRNGDLKPYVVLYLDQDQRLSTRSDDSASIKPVWNERITLPLTR  67

Query  241  PPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ--LKAFQLRRPSGRP  408
               ES+L +E+FH  S  S+  K LVG++R PL  L+   G      + + +L RPSGRP
Sbjct  68   SVHESVLNIEVFHSNSNSSDLAKTLVGSVRFPLARLIDSDGSMIPELINSLELVRPSGRP  127

Query  409  QGKIRLKIAVR  441
            QGKIRLK++++
Sbjct  128  QGKIRLKLSIK  138



>ref|XP_006645033.1| PREDICTED: protein enabled homolog [Oryza brachyantha]
Length=324

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 15/144 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D++VTVVS KHLKNVNWR GDL+ YVI ++DP RR++T+ DD G  KP WNER V+P
Sbjct  47   KAVDLEVTVVSGKHLKNVNWRRGDLRAYVIAYLDPSRRVSTRPDDVGGCKPAWNERIVLP  106

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-------DSTQL  372
              LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+  +         ++ L
Sbjct  107  --LPPHLSAHDPSLLLSLDVFHSKPSDSPKPLVGSARSPLRDLLFSTNPNPSPDSPASSL  164

Query  373  KAFQLRRPSGRPQGKIRLKIAVRK  444
                L RPSGRPQGK+R+++A+R+
Sbjct  165  ITLPLLRPSGRPQGKLRIRLALRE  188



>gb|EAY76529.1| hypothetical protein OsI_04471 [Oryza sativa Indica Group]
Length=327

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 15/144 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D++VTVVS KHLKNVNWR GDL+ YV+ ++DP RR AT+ DD G  KP WNER V+P
Sbjct  46   KAIDLEVTVVSGKHLKNVNWRRGDLRAYVVAYLDPSRRAATRPDDVGGCKPAWNERVVLP  105

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-------DSTQL  372
              LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+  +         ++ L
Sbjct  106  --LPPHLSPHDPSLLLSLDVFHSKPSDSPKPLVGSARSPLRDLLFSTNPNPSPDSPASAL  163

Query  373  KAFQLRRPSGRPQGKIRLKIAVRK  444
                L RPSGRPQGK+R+++A+R+
Sbjct  164  ITLPLLRPSGRPQGKLRIRLALRE  187



>ref|NP_001044834.1| Os01g0853800 [Oryza sativa Japonica Group]
 dbj|BAB84404.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF06748.1| Os01g0853800 [Oryza sativa Japonica Group]
 dbj|BAG91284.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97448.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97596.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97625.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55687.1| hypothetical protein OsJ_04108 [Oryza sativa Japonica Group]
Length=327

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 15/144 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D++VTVVS KHLKNVNWR GDL+ YV+ ++DP RR AT+ DD G  KP WNER V+P
Sbjct  46   KAIDLEVTVVSGKHLKNVNWRRGDLRAYVVAYLDPSRRAATRPDDVGGCKPAWNERVVLP  105

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-------DSTQL  372
              LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+  +         ++ L
Sbjct  106  --LPPHLSPHDPSLLLSLDVFHSKPSDSPKPLVGSARSPLRDLLFSTNPNPSPDSPASAL  163

Query  373  KAFQLRRPSGRPQGKIRLKIAVRK  444
                L RPSGRPQGK+R+++A+R+
Sbjct  164  ITLPLLRPSGRPQGKLRIRLALRE  187



>emb|CDY06250.1| BnaA09g49530D [Brassica napus]
Length=345

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 101/141 (72%), Gaps = 9/141 (6%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MA++ + P     ++ V V+SAKHLKNVNWR+GDLKPYV+L++D D RL+T+SDD  STK
Sbjct  1    MASSSSEP----LELIVNVLSAKHLKNVNWRNGDLKPYVVLYLDSDHRLSTRSDD--STK  54

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNER  +PLT    ES+L+VEIFHS  S+  K LVG++R PL  LV   G      + 
Sbjct  55   PVWNERITLPLTRSVHESVLSVEIFHSNSSDLAKALVGSVRFPLVRLVDYEG---AFNSL  111

Query  382  QLRRPSGRPQGKIRLKIAVRK  444
            +L RPSGR QGKIRLK+ +++
Sbjct  112  ELIRPSGRTQGKIRLKLEIKE  132



>ref|XP_011076131.1| PREDICTED: WW domain-containing protein C11B10.08 [Sesamum indicum]
Length=276

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SAK LKNVNWRHG LKPY +LW+DP  + +T+ D+ G T P W E+ V+P  
Sbjct  5    YEVEVTVTSAKDLKNVNWRHGQLKPYAVLWVDPKNKCSTRVDEDGDTSPYWEEKVVIPFN  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRPQG  414
             P ++S L ++I H+  +E  KPL+G+ ++PL+D+V D+G   ++ +  +L+RPSGRPQG
Sbjct  65   SPIEDSTLYIDIVHANDAEDTKPLIGSAKLPLRDVVDDAGMGARVERKLELKRPSGRPQG  124

Query  415  KIRLKIAVRK  444
            K+ + ++VR+
Sbjct  125  KLEVSVSVRE  134



>ref|XP_010487318.1| PREDICTED: formin-like protein 3 [Camelina sativa]
Length=359

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D+RL+T+SDDS S KPVWNER  +PLT 
Sbjct  8    DLIVTVVSAKHLKNVNWRNGDLKPYVVLYLDQDQRLSTRSDDSASIKPVWNERITLPLTR  67

Query  241  PPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGD--STQLKAFQLRRPSGRP  408
               ES+L +E+FH  S  S+  K LVG++R PL  L+   G      + + +L RPS RP
Sbjct  68   SVHESVLNIEVFHSNSNSSDLAKTLVGSVRFPLARLIDSDGSIIPELINSLELVRPSARP  127

Query  409  QGKIRLKIAVR  441
            QGKIRLK++++
Sbjct  128  QGKIRLKLSIK  138



>ref|XP_009118446.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Brassica 
rapa]
Length=345

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 101/141 (72%), Gaps = 9/141 (6%)
 Frame = +1

Query  22   MATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK  201
            MA++ + P     ++ V V+SAKHLKNVNWR+GDLKPYV+L++D D RL+T+SDD  STK
Sbjct  1    MASSSSEP----LELIVNVLSAKHLKNVNWRNGDLKPYVVLYLDSDHRLSTRSDD--STK  54

Query  202  PVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            PVWNER  +PLT    ES+L VEIFHS  S+  K LVG++R PL  LV   G    + + 
Sbjct  55   PVWNERITLPLTRSVHESVLNVEIFHSNSSDLAKALVGSVRFPLVRLVDSEG---AINSL  111

Query  382  QLRRPSGRPQGKIRLKIAVRK  444
            +L RPSGR QGKIRLK+ +++
Sbjct  112  ELIRPSGRTQGKIRLKLEIKE  132



>dbj|BAJ85055.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 15/144 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D++VTVVS KHLKNVNWR GDL+ Y + ++DP RR AT+ DD+G  KP WNER V  
Sbjct  47   KAMDLEVTVVSGKHLKNVNWRRGDLRAYAVAYLDPSRRTATRPDDAGGCKPAWNERIV--  104

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-----DSGDS--TQL  372
            L LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+       S DS  + +
Sbjct  105  LQLPPHLSPHDPSLLLSLDVFHSKPSDSPKPLVGSARSPLRDLLFPASPNPSSDSPASPI  164

Query  373  KAFQLRRPSGRPQGKIRLKIAVRK  444
                L RPSGRPQGK+R+++A+R+
Sbjct  165  ITLPLLRPSGRPQGKLRIRVALRE  188



>ref|XP_010475484.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X1 [Camelina sativa]
Length=358

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++  D+RL+T+SDDS S KPVWNER  +PLT 
Sbjct  8    DLIVTVVSAKHLKNVNWRNGDLKPYVVLYLGQDQRLSTRSDDSASIKPVWNERITLPLTR  67

Query  241  PPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ--LKAFQLRRPSGRP  408
               ES+L +E+FH  S  S+  K LVG++R PL  L+   G      + + +L RPSGRP
Sbjct  68   SVHESVLNIEVFHSNSNSSDLAKTLVGSVRFPLARLIDSDGSMIPELINSLELVRPSGRP  127

Query  409  QGKIRLKIAVR  441
            QGKIRLK++++
Sbjct  128  QGKIRLKLSIK  138



>emb|CDM83636.1| unnamed protein product [Triticum aestivum]
Length=380

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 100/144 (69%), Gaps = 15/144 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D++VTVVS KHLKNVNWR GDL+ Y + ++DP RR AT+ DD+G  KP WNER    
Sbjct  47   KAMDLEVTVVSGKHLKNVNWRRGDLRAYAVAYLDPSRRTATRPDDAGGCKPAWNERIT--  104

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-------DSTQL  372
            L LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+  +G        ++ +
Sbjct  105  LQLPPHLSPHDPSLLLSLDVFHSKPSDSPKPLVGSARSPLRDLLFPAGPNPSSDSPTSPI  164

Query  373  KAFQLRRPSGRPQGKIRLKIAVRK  444
                L RPSGRPQGK+R+++A+R+
Sbjct  165  ITLPLLRPSGRPQGKLRIRVALRE  188



>ref|XP_003564634.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Brachypodium 
distachyon]
Length=326

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 14/143 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            K+ D++V VVS KHLKNVNWR GDL+ Y + ++DP RR AT+ DD+G  KP WNER V+P
Sbjct  46   KTMDLEVIVVSGKHLKNVNWRRGDLRAYAVAYLDPSRRTATRPDDAGGCKPAWNERIVLP  105

Query  232  LTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-----DSGDS-TQLK  375
              LPP  S      LL++++FHS PS++PKPLVG+ R PL++L+       S DS + L 
Sbjct  106  --LPPHLSPHDPSLLLSIDVFHSKPSDSPKPLVGSARSPLRELLFPANPNPSSDSVSPLI  163

Query  376  AFQLRRPSGRPQGKIRLKIAVRK  444
               L RPSGRPQGK+R+++A+R+
Sbjct  164  TLPLLRPSGRPQGKLRIRLALRE  186



>ref|XP_009118971.1| PREDICTED: extensin [Brassica rapa]
Length=319

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            +++ D+ VTVVSAKHLKNVNWR+GD KPYV+L +D D R++T+SDD  S KPVWNER  +
Sbjct  5    SETLDLVVTVVSAKHLKNVNWRNGDRKPYVVLSLDSDPRVSTRSDD--SAKPVWNERITL  62

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST--QLKAFQLRRPSG  402
            PLT    ES+L VEIFH   S+  KPLVG++R PL  LV   G      + + +L RPSG
Sbjct  63   PLTRSVHESVLNVEIFH---SDAAKPLVGSVRFPLVRLVDSEGAMVPESISSLELLRPSG  119

Query  403  RPQGKIRLKIAVRK  444
            RPQGKIRLK+A+++
Sbjct  120  RPQGKIRLKLAIKE  133



>ref|XP_010255304.1| PREDICTED: uncharacterized protein LOC104596023 [Nelumbo nucifera]
Length=280

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDR-RLATKSDDSGSTKPVWNERFVVPLTL  240
            V+VT+ SA+ LKNVNWRHG LKPYV+ W+DP + + +TK DD G T PVW+E  V+PL  
Sbjct  19   VEVTISSARDLKNVNWRHGSLKPYVVAWVDPPKSKYSTKVDDDGDTSPVWDETLVIPLVA  78

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRPQGK  417
            P  +S L +++ H+  ++  KPL+G+ RIPLK++V D G   +  +  QL+RPSGRPQGK
Sbjct  79   PIDDSTLFLDVVHANAADDTKPLIGSARIPLKEIVDDVGFGERAHRTLQLKRPSGRPQGK  138

Query  418  IRLKIAVRK  444
            I  KI VR+
Sbjct  139  IEAKITVRE  147



>ref|XP_009627866.1| PREDICTED: uncharacterized protein LOC104118341 [Nicotiana tomentosiformis]
Length=266

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+V + SA  LKNVNWR+G LKPY ++W+DP+ + +TK D+ G T P WNE+ VVPL 
Sbjct  5    YEVEVKITSANDLKNVNWRYGPLKPYAVVWVDPNAKCSTKVDEDGDTSPYWNEKLVVPLN  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKA-FQLRRPSGRPQG  414
             P  +S L ++I H+   E  KPL+G+ ++PL  +V D G   +L+   QL+RPSGRPQG
Sbjct  65   SPIDDSTLYIDIVHANAVEDTKPLIGSAKLPLSKVVDDIGIGGELECTLQLKRPSGRPQG  124

Query  415  KIRLKIAVRKIQEYQ  459
            K++++++VR    Y+
Sbjct  125  KVQVEVSVRDQPRYR  139



>ref|XP_004240724.1| PREDICTED: uncharacterized protein LOC101263030 [Solanum lycopersicum]
Length=248

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+V + SAK LKN+NWR+G LKPY ++W+DP+ + +T+ D+ G T P WN++ V+PL 
Sbjct  5    YEVEVKITSAKDLKNINWRYGPLKPYAVVWVDPNAKCSTRVDEDGDTSPYWNDKLVIPLY  64

Query  238  LPPQESLLAVEIFHSVPSET-PKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRPQ  411
             P  ES+L +++ H+V +E   KPL+G+ +IPL ++V ++G   ++ +  QL+RPSGRPQ
Sbjct  65   SPIDESVLYIDMVHAVGAEEDTKPLIGSAKIPLSEVVEEAGVGGEVERTLQLKRPSGRPQ  124

Query  412  GKIRLKIAVR  441
            GK+++++ VR
Sbjct  125  GKVKVQVTVR  134



>ref|XP_006827556.1| hypothetical protein AMTR_s00009p00221230 [Amborella trichopoda]
 gb|ERM94972.1| hypothetical protein AMTR_s00009p00221230 [Amborella trichopoda]
Length=269

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            ++++TVVSAK LKNVNWRHGD+KPYV+ W+DPDR+ +T  D+ G T PVWN +  +PL  
Sbjct  2    ELELTVVSAKDLKNVNWRHGDIKPYVVAWVDPDRKFSTGVDEEGDTSPVWNNKLTIPLRD  61

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSGRPQGK  417
             P++S L +++ H+   E  KPL+G+  + L++++ D+G D    K  +L+R SGRP GK
Sbjct  62   HPEDSTLQIDVVHAGSEEKTKPLIGSATLALREVIEDAGFDHGLSKTLKLKRSSGRPHGK  121

Query  418  IRLKIAVR  441
            I ++I +R
Sbjct  122  IEVEILIR  129



>emb|CDY10267.1| BnaC05g05100D [Brassica napus]
Length=318

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 94/130 (72%), Gaps = 7/130 (5%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D R++T+SDDS   KPVWNER  +PLT 
Sbjct  9    DLVVTVVSAKHLKNVNWRNGDLKPYVVLYLDSDHRVSTRSDDSA--KPVWNERVTLPLTR  66

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST--QLKAFQLRRPSGRPQG  414
               ES+L VEI H   S+  K LVG++R PL  LV   G      + + +L RPSGR QG
Sbjct  67   SVHESVLNVEILH---SDAAKTLVGSVRFPLVRLVDSEGAMVPESISSLELLRPSGRTQG  123

Query  415  KIRLKIAVRK  444
            KIRLK+A+++
Sbjct  124  KIRLKLAIKE  133



>ref|XP_008234057.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=322

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 93/143 (65%), Gaps = 36/143 (25%)
 Frame = +1

Query  16   TVMATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGS  195
            T MAT+   PP K  D+D+T+VSAKHLKNVNW++GDLKPY + W+D DRRLATKSDD   
Sbjct  43   TPMATSRP-PPPKHLDLDLTIVSAKHLKNVNWKNGDLKPYAVFWVDSDRRLATKSDD---  98

Query  196  TKPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK  375
                                           S+TPKPLVGTLR+PLKDL  D  D+T+++
Sbjct  99   -------------------------------SDTPKPLVGTLRVPLKDL-PDPDDATRIR  126

Query  376  AFQLRRPSGRPQGKIRLKIAVRK  444
             FQL RPSGRPQGKIR+K+AVR+
Sbjct  127  TFQLVRPSGRPQGKIRVKLAVRE  149



>ref|XP_009774894.1| PREDICTED: uncharacterized protein LOC104224872 [Nicotiana sylvestris]
Length=265

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+V + SA  LKNV WR+G LKPY ++W+DP+ + +TK DD G T P WNE+ VVPL 
Sbjct  5    YEVEVQITSANDLKNVTWRYGPLKPYAVVWVDPNAKCSTKVDDDGDTSPYWNEKLVVPLN  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKA-FQLRRPSGRPQG  414
                +S L V+I H+   E  KPL+G+ ++PL  ++ D G   +L+   QL+RPSGRPQG
Sbjct  65   SSIDDSTLYVDIVHANAVEDTKPLIGSAKLPLSKVIDDVGIGGELECTLQLKRPSGRPQG  124

Query  415  KIRLKIAVRK  444
            K++++++VR+
Sbjct  125  KVQVEVSVRE  134



>ref|XP_004234422.1| PREDICTED: probable calcium-binding protein CML50 [Solanum lycopersicum]
Length=349

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            ++V+V + SA+ LKNVNWR+G LKPY ++W+DP  + +TK DD+G T P WNE+ V+PL 
Sbjct  5    FEVEVKISSARDLKNVNWRYGRLKPYAVVWVDPKGKCSTKVDDNGDTSPSWNEKLVIPLY  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPSGRPQ  411
             P +ES L +++ H+  +E  KPL+G+ ++PL+++V  V  G+ T+ ++  L+RPSGRP 
Sbjct  65   APIEESTLYIDVVHANATEGTKPLIGSAKLPLREVVDSVGIGNLTE-RSLDLKRPSGRPH  123

Query  412  GKIRLKIAVR  441
            GK+++++AVR
Sbjct  124  GKVKIEVAVR  133



>ref|XP_010671655.1| PREDICTED: uncharacterized protein LOC104888395 [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 96/136 (71%), Gaps = 2/136 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+VT+ SAK LKN+NWR+G ++PYVI+WI+PDR++ +++DD G T P WN+  +V
Sbjct  2    ASRYEVEVTLSSAKDLKNINWRYGPIRPYVIVWINPDRKVTSRTDDEGDTSPQWNQTLMV  61

Query  229  PLTLPPQESLLAVEIFHSVPSETP-KPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSG  402
            PL  P +E+ L +++ H   +E   KPL+G+ ++ L+++V + G  +   +  +L+RPSG
Sbjct  62   PLDRPIEEATLCIDVVHHASAEEDIKPLIGSTKVELRNIVDEVGIGALATRNLKLKRPSG  121

Query  403  RPQGKIRLKIAVRKIQ  450
            RP GK+ L+I VR  Q
Sbjct  122  RPHGKLELEITVRNPQ  137



>ref|XP_006353889.1| PREDICTED: RNA-binding protein EWS-like isoform X2 [Solanum tuberosum]
Length=341

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            ++V+V + SAK LKNVNWR+G LKPY ++W+DP  + +TK DD+G T P WNE+ V+PL 
Sbjct  5    FEVEVKISSAKDLKNVNWRYGRLKPYAVVWVDPKGKCSTKVDDNGDTSPSWNEKLVIPLY  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPSGRPQ  411
             P +ES L +++ H+  +E  KPL+G+ ++PL+++V  V  G+ T+ ++  L+RPSGRP 
Sbjct  65   APIEESTLYIDVVHANATEGTKPLIGSAKLPLREVVDSVGIGNLTE-RSLDLKRPSGRPH  123

Query  412  GKIRLKIAVR  441
            GK+++++ VR
Sbjct  124  GKVKIEVTVR  133



>ref|XP_006353888.1| PREDICTED: RNA-binding protein EWS-like isoform X1 [Solanum tuberosum]
Length=351

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            ++V+V + SAK LKNVNWR+G LKPY ++W+DP  + +TK DD+G T P WNE+ V+PL 
Sbjct  5    FEVEVKISSAKDLKNVNWRYGRLKPYAVVWVDPKGKCSTKVDDNGDTSPSWNEKLVIPLY  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPSGRPQ  411
             P +ES L +++ H+  +E  KPL+G+ ++PL+++V  V  G+ T+ ++  L+RPSGRP 
Sbjct  65   APIEESTLYIDVVHANATEGTKPLIGSAKLPLREVVDSVGIGNLTE-RSLDLKRPSGRPH  123

Query  412  GKIRLKIAVR  441
            GK+++++ VR
Sbjct  124  GKVKIEVTVR  133



>gb|ABK23901.1| unknown [Picea sitchensis]
 gb|ACN40695.1| unknown [Picea sitchensis]
Length=330

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 98/138 (71%), Gaps = 3/138 (2%)
 Frame = +1

Query  37   ARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE  216
            A+PP K  DV++T++SA+ LKNVNWR+GDL+PY + W+DPD +++T+ D  G T P W+E
Sbjct  2    AKPP-KPVDVELTILSARELKNVNWRYGDLRPYAVAWVDPDYKVSTRVDQEGDTNPSWDE  60

Query  217  RFVVPL-TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLR  390
            +  +P+   P +++ L +EI H  PSE  KPLVGT RIPL  ++ + G   +L +  +L+
Sbjct  61   KLTIPVGNRPLEDAELTIEIVHEKPSELTKPLVGTARIPLVQVLDEVGFEERLERTLKLK  120

Query  391  RPSGRPQGKIRLKIAVRK  444
            RPSGRPQGK+ + I +++
Sbjct  121  RPSGRPQGKLEILIRLKE  138



>ref|XP_006363329.1| PREDICTED: uncharacterized protein LOC102600321 [Solanum tuberosum]
Length=270

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+V + SAK LKN+NWR+G LKPY ++W+DP+ + +TK D+ G T P W ++ ++PL 
Sbjct  5    YEVEVKITSAKDLKNINWRYGPLKPYAVVWVDPNSKCSTKVDEDGDTSPYWTDKLLIPLN  64

Query  238  LPPQESLLAVEIFHSVPSET-PKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRPQ  411
             P  ES+L ++I H+V +E   KPL+G+ +I L ++V ++G   ++ +  QL+RPSGRPQ
Sbjct  65   SPIDESVLYIDIVHAVGAEEDTKPLIGSAKISLSEVVDEAGVGGEVERTLQLKRPSGRPQ  124

Query  412  GKIRLKIAVR  441
            GK+ +++ VR
Sbjct  125  GKVEVQVTVR  134



>ref|XP_004289725.1| PREDICTED: uncharacterized protein LOC101315189 [Fragaria vesca 
subsp. vesca]
Length=272

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V++T+ SAK LKNVNWRHG+LKPY ++W+DP+ + +T  D+ G   P W+E   +
Sbjct  2    ASGYEVELTISSAKDLKNVNWRHGELKPYAVVWVDPNNKCSTHVDEYGDDSPTWDETLSI  61

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSGR  405
            PL  P ++S L V++ H    E  KPL+G+ ++PL++++ D G  +  +   +L+RPSGR
Sbjct  62   PLRGPVEDSTLFVDVIHVKADEDVKPLIGSAKLPLREVLDDVGLGAPSVHKLKLKRPSGR  121

Query  406  PQGKIRLKIAVR  441
            PQGK+ +K+ +R
Sbjct  122  PQGKLEVKVTIR  133



>emb|CDP21817.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+V + SAK LKNVNWRHG LKPY ++W+DP  + +T+ DD G T P W E  V+P  
Sbjct  5    YEVEVAITSAKDLKNVNWRHGPLKPYAVVWVDPKAKCSTRVDDEGDTSPYWEETLVIPFD  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRPQG  414
             P ++S L +++ H+  +E  KPL+G+ R+ L D+V ++G   ++ +  +L+RPSGRP G
Sbjct  65   SPIEDSTLLIDVVHAKAAEDTKPLIGSARLRLIDVVDEAGLGRRVERKLELKRPSGRPHG  124

Query  415  KIRLKIAVRKIQEYQ  459
            K++++++VR+   Y+
Sbjct  125  KLQVQVSVREPPRYR  139



>gb|KJB39411.1| hypothetical protein B456_007G012100 [Gossypium raimondii]
Length=313

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 104/167 (62%), Gaps = 5/167 (3%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            ++ VT VS K L+NVNWRHG +KPY ++W+DP  +LATK D+ G T P WN   V+PL  
Sbjct  6    EIQVTFVSGKDLQNVNWRHGPIKPYAVVWVDPSSKLATKVDEKGDTYPTWNSTLVIPLFC  65

Query  241  P-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRPQG  414
            P   ++ L V++ H+   E  KPL+G+ ++ L+D++ DSG   +  K+ +L+RPSGRPQG
Sbjct  66   PINDDTNLYVDVIHAGNEEKTKPLIGSAKLNLRDVLKDSGRYGEYEKSLKLKRPSGRPQG  125

Query  415  KIRLKIAVRKIQEYQIpppasyyyssappppaTRDYGAYNPAPYSSH  555
            K+ +K+ +R    Y +  P       +   P +  YGA  PAPY +H
Sbjct  126  KVDVKVLIRG-PGYHV--PDQSRAIPSYGHPQSAPYGAPQPAPYGAH  169



>ref|XP_006827562.1| hypothetical protein AMTR_s00009p00222310 [Amborella trichopoda]
 gb|ERM94978.1| hypothetical protein AMTR_s00009p00222310 [Amborella trichopoda]
Length=265

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            ++++TVVSAK LKNVNWR+GD+KPY + W+DP  + +T+ D+ G T PVWN +  +PL  
Sbjct  2    ELELTVVSAKDLKNVNWRYGDIKPYAVAWVDPGNKSSTRVDNEGDTSPVWNYKLTIPLRD  61

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSGRPQGK  417
             P++S L +++ H+   E  K  +G+  +PL++++ D+G D +  K  +L+RPSGRPQGK
Sbjct  62   RPEDSTLRIDVVHAGGEEKTKSFIGSATLPLREVIEDAGYDHSFSKKLKLKRPSGRPQGK  121

Query  418  IRLKIAVR  441
            I + I +R
Sbjct  122  IEVVIVIR  129



>gb|KCW90655.1| hypothetical protein EUGRSUZ_A02756 [Eucalyptus grandis]
Length=290

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+++VTV SAK LKNVNWR G  +PY +LW+DP ++ +T+ D+   T PVW++  V+
Sbjct  2    ASRYELEVTVSSAKDLKNVNWRQGPTRPYAVLWVDPSKKCSTRVDEENDTSPVWDQTLVI  61

Query  229  PLTLPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK-AFQLRRPSG  402
            PL   P +++ L +++ H+   E  KPL+G+ R+ L+D++ D+G    LK   QL+RPSG
Sbjct  62   PLPPGPIEDATLYIDVVHAGSEEDTKPLIGSARLKLRDVLDDAGFGEALKRGLQLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ +K+ VR+
Sbjct  122  RPHGKVEVKVCVRE  135



>ref|XP_004140766.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101213996 
[Cucumis sativus]
Length=211

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SAK LKN+NW++G LKPY ++WIDP ++ +TK D+ G T P W+E  V+
Sbjct  2    ASRYELELKIQSAKDLKNINWKYGTLKPYAVVWIDPKQKSSTKVDNQGDTSPFWDETLVI  61

Query  229  PLTLPPQESLLAVEIFHSVPSET-PKPLVGTLRIPLKDLVVDS--GDSTQLKAFQLRRPS  399
            P     ++S L +++ H V ++   KPL+G+ R+PL +L+ D   G+S+Q +  QL+RPS
Sbjct  62   PFFSSIEDSTLHIDVVHVVGADXDTKPLIGSARLPLAELIDDVGLGESSQ-RTLQLKRPS  120

Query  400  GRPQGKIRLKIAVRK  444
            GRPQGKI +K+ VR+
Sbjct  121  GRPQGKIEVKVTVRE  135



>ref|XP_010940561.1| PREDICTED: transcription elongation factor SPT5 [Elaeis guineensis]
Length=285

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+VT+ SA+ LKNVNWRHGDL+PY ++WIDP  + +TK    G   P W+E+ V 
Sbjct  2    ASRYEVEVTIGSARDLKNVNWRHGDLQPYAVVWIDPASKCSTKVAVDGDVNPEWDEKVV-  60

Query  229  PLTLPPQESL----LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRR  393
             L+LPP ++L    L ++I H+  +E  KPLVG+ R+PL++++ D+G   +  +A +L+R
Sbjct  61   -LSLPPGQTLDDAVLFIDIVHAGAAEDVKPLVGSARLPLREVIDDAGIGGKASRALKLKR  119

Query  394  PSGRPQGKIRLKIAVRKIQEY  456
            PSGRP GK+ +++A+++   Y
Sbjct  120  PSGRPHGKLDVRVAIKEPSRY  140



>ref|XP_010060582.1| PREDICTED: uncharacterized protein LOC104448451 [Eucalyptus grandis]
Length=297

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+++VTV SAK LKNVNWR G  +PY +LW+DP ++ +T+ D+   T PVW++  V+
Sbjct  2    ASRYELEVTVSSAKDLKNVNWRQGPTRPYAVLWVDPSKKCSTRVDEENDTSPVWDQTLVI  61

Query  229  PLTLPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK-AFQLRRPSG  402
            PL   P +++ L +++ H+   E  KPL+G+ R+ L+D++ D+G    LK   QL+RPSG
Sbjct  62   PLPPGPIEDATLYIDVVHAGSEEDTKPLIGSARLKLRDVLDDAGFGEALKRGLQLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ +K+ VR+
Sbjct  122  RPHGKVEVKVCVRE  135



>ref|XP_004157192.1| PREDICTED: uncharacterized protein LOC101224685 [Cucumis sativus]
 gb|KGN57401.1| hypothetical protein Csa_3G183350 [Cucumis sativus]
Length=291

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SAK LKN+NW++G LKPY ++WIDP ++ +TK D+ G T P W+E  V+
Sbjct  2    ASRYELELKIQSAKDLKNINWKYGTLKPYAVVWIDPKQKSSTKVDNQGDTSPFWDETLVI  61

Query  229  PLTLPPQESLLAVEIFHSVPS-ETPKPLVGTLRIPLKDLVVDS--GDSTQLKAFQLRRPS  399
            P     ++S L +++ H V + E  KPL+G+ R+PL +L+ D   G+S+Q +  QL+RPS
Sbjct  62   PFFSSIEDSTLHIDVVHVVGADEDTKPLIGSARLPLAELIDDVGLGESSQ-RTLQLKRPS  120

Query  400  GRPQGKIRLKIAVRK  444
            GRPQGKI +K+ VR+
Sbjct  121  GRPQGKIEVKVTVRE  135



>ref|XP_009382785.1| PREDICTED: uncharacterized protein LOC103970647 [Musa acuminata 
subsp. malaccensis]
Length=270

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 99/140 (71%), Gaps = 4/140 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSG-STKPVWNERFV  225
            A  Y+VD+ + SA++LKNVNWRHGDLKPYV+ W+DP  + +TK    G    P+W+E+ V
Sbjct  2    AARYEVDLNIASARNLKNVNWRHGDLKPYVVAWVDPAAKSSTKVAVGGDDDDPIWDEKLV  61

Query  226  VPL--TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRP  396
            +PL   LP +++ L++++ H+   E  KPLVG++R+PL+D++ + G  ++L +  +L+RP
Sbjct  62   LPLPYGLPLEDATLSLDVVHAGSGEGVKPLVGSVRLPLRDVLDEVGLGSKLNRTLKLKRP  121

Query  397  SGRPQGKIRLKIAVRKIQEY  456
            SGRP GK+ + +AV++   Y
Sbjct  122  SGRPHGKLEVTVAVKEPARY  141



>ref|XP_004974238.1| PREDICTED: transcriptional repressor scratch 1-like [Setaria 
italica]
Length=290

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 96/138 (70%), Gaps = 5/138 (4%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA +LKNVNWR+GDLKPY +LW+D   + +T+ D      PVW+++ VVPL 
Sbjct  5    YEVEVTVGSASNLKNVNWRNGDLKPYAVLWVDDGPKCSTRVDLDNGENPVWDDKLVVPLP  64

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
             P      +++L +++ H+  +E  KPLVG+ R+PL+D++ D+G   ++ +   L+RPSG
Sbjct  65   PPSAARLDDAVLCIDVVHANAAEGVKPLVGSARLPLRDVLDDAGIGAKVSRTLTLKRPSG  124

Query  403  RPQGKIRLKIAVRKIQEY  456
            RPQG++ +++AVR+   Y
Sbjct  125  RPQGRLDVRVAVREAARY  142



>emb|CAI58613.1| C2 domain-containing protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96517.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 97/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV +A+ LKNVNWR+GDLKPY +LWID   R +T+ D      P W+++ VVP  
Sbjct  5    YEVEVTVGAARDLKNVNWRNGDLKPYAVLWIDAGARCSTRVDLDNGENPTWDDKVVVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP    Q+++L ++I H+   E  KPLVG+ R+PL+D+V D+G   ++ +  +L+RPSG
Sbjct  63   LPPASRLQDAVLYLDIVHANAPEGVKPLVGSARLPLRDVVDDAGVGGKVSRNLKLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RPQGK+ +++AVR+   Y
Sbjct  123  RPQGKLDVRVAVREPARY  140



>ref|XP_003578699.1| PREDICTED: tropomyosin-1, isoforms 33/34-like [Brachypodium distachyon]
Length=302

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 97/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V++TV SAK LKNVNWR+GDLKPY +LWID   + +T+ D      P W+E+ VVP  
Sbjct  5    YEVELTVGSAKDLKNVNWRNGDLKPYAVLWIDGGAKCSTRVDLDNGENPAWDEKVVVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP    Q+++L +++ H+  +E  KPLVG+ R+PL+D+V D+G   +  +  +L+RPSG
Sbjct  63   LPPTSRIQDAVLYIDVVHANAAEGTKPLVGSARLPLRDVVDDAGIGGRASRNLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RPQG++ +++AV++   Y
Sbjct  123  RPQGRLDVRVAVKEPSRY  140



>gb|EYU25119.1| hypothetical protein MIMGU_mgv1a021760mg [Erythranthe guttata]
Length=304

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 93/139 (67%), Gaps = 10/139 (7%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V++T+ SAK LKNVNWRHG LKPY ++W+DP  + +T+ DD G   P W+E+  +P  
Sbjct  5    YEVEITITSAKDLKNVNWRHGKLKPYAVVWVDPKSKCSTRVDDEGDASPFWDEKLTIPFN  64

Query  238  LPPQESLLAVEIF-------HSVPSETPKPLVGTLRIPLKDLVVDSGDS--TQLKAFQLR  390
             P  ES L ++IF       ++  ++  KPL+G+ ++PL+D+V D G    +++K  +L+
Sbjct  65   SPVDESTLYIDIFVLSRRGPNTNAADGTKPLIGSAKLPLRDVVDDVGLGIRSEMK-LELK  123

Query  391  RPSGRPQGKIRLKIAVRKI  447
            RPSGRPQGK+ + + VR +
Sbjct  124  RPSGRPQGKVEINVIVRDL  142



>ref|XP_010025284.1| PREDICTED: uncharacterized protein LOC104415652, partial [Eucalyptus 
grandis]
Length=195

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 91/139 (65%), Gaps = 2/139 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+++VT  SAK LKNVNWRHG  +PY +LW DP+ + +T  DD G   PVWN+  V+
Sbjct  3    ASRYELEVTASSAKDLKNVNWRHGPTRPYAVLWADPNNKWSTLVDDEGDANPVWNQTLVM  62

Query  229  PLTLPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            PL L P +++   +++ H+   E  +PL+G+ R+ L+ ++ + G    L ++ QL+RPSG
Sbjct  63   PLHLGPIRDATFYIDVVHAGSEEDTEPLIGSARLNLRHVLDEVGFGNPLGRSLQLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEYQ  459
            RP GK+ +++ VRK   Y+
Sbjct  123  RPHGKVEVRVCVRKTGRYR  141



>ref|XP_008439269.1| PREDICTED: zinc finger matrin-type protein CG9776 [Cucumis melo]
Length=293

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SA+ LKN+NW++G LKPY ++WIDP ++ +TK D  G T P W+E  V+
Sbjct  2    ASRYELELKIQSARDLKNINWKYGTLKPYAVVWIDPQQKSSTKVDAEGDTSPYWDETLVI  61

Query  229  PLTLPPQESLLAVEIFHSVPS-ETPKPLVGTLRIPLKDLVVDS--GDSTQLKAFQLRRPS  399
            P +   ++S L +++ H V + E  KPL+G+ R+PL ++V D   G+S+Q +  QL+RPS
Sbjct  62   PFSSSIEDSTLHIDVVHVVGADEDTKPLIGSARLPLAEVVDDVGLGESSQ-RTLQLKRPS  120

Query  400  GRPQGKIRLKIAVRK  444
            GRPQGKI +K+ VR+
Sbjct  121  GRPQGKIEVKVTVRE  135



>ref|XP_011084443.1| PREDICTED: uncharacterized protein LOC105166693 [Sesamum indicum]
Length=270

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+++VT++SA+ LKNVNWRHG LKPY ++W+DP ++ +T++D+ G   P WN++ ++
Sbjct  2    ASRYELEVTIISAEDLKNVNWRHGKLKPYAVVWLDPSKKSSTRADEEGDASPHWNDKLLI  61

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSGR  405
            P      +S L V++ H+  +E  KPL+G+ ++ ++D+  + G  +   +   L+RPSGR
Sbjct  62   PFNSLIDDSTLYVDVVHANAAEGTKPLIGSAKLSVRDIAENVGLGNVAERKLDLKRPSGR  121

Query  406  PQGKIRLKIAVRK  444
            PQGK+++K+ VR+
Sbjct  122  PQGKLQVKVTVRE  134



>ref|XP_009800792.1| PREDICTED: WW domain-containing protein C11B10.08 [Nicotiana 
sylvestris]
Length=308

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            ++V+V + SAK LKNVNWR+G LKPY ++W+DP  + +TK D++G   P W+E+ V+PL 
Sbjct  5    FEVEVKISSAKDLKNVNWRYGRLKPYAVVWVDPKAKCSTKVDENGDMSPYWDEKLVIPLY  64

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPSGRPQ  411
             P +ES L +++ H+   +  KPL+G+ ++ L+D+V  V  G+S + ++  L+RPSGRPQ
Sbjct  65   SPIEESTLYIDVVHANAEKDTKPLIGSAKLHLRDVVDTVGIGNSCE-RSLDLKRPSGRPQ  123

Query  412  GKIRLKIAVR  441
            GK++++++VR
Sbjct  124  GKVKVEVSVR  133



>ref|XP_009420451.1| PREDICTED: elastin-like [Musa acuminata subsp. malaccensis]
Length=274

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 102/140 (73%), Gaps = 4/140 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATK-SDDSGSTKPVWNERFV  225
            A  Y+V+VTV SA++LKNVNWRHGDLKPYV+ W+DP  + +TK + D     PVW+E+  
Sbjct  2    AARYEVEVTVASARNLKNVNWRHGDLKPYVVAWVDPAAKCSTKVAVDGDDDDPVWDEKLT  61

Query  226  VPL--TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRP  396
            +P+   LP +++ LA ++ H+  +E  KPLVG+ R+PL+D++ + G S +L +A +L+RP
Sbjct  62   LPVPPGLPIEDATLAFDVVHAGAAEGVKPLVGSARLPLRDVLDEVGLSGKLVRALKLKRP  121

Query  397  SGRPQGKIRLKIAVRKIQEY  456
            SGRPQGKI +K+AV++   Y
Sbjct  122  SGRPQGKIEIKVAVKEQARY  141



>gb|KDO56853.1| hypothetical protein CISIN_1g023810mg [Citrus sinensis]
Length=277

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+VT+ SAK LKNVNWRHG  +PY +LW+DP+++ +TK DD G T P W+E   +
Sbjct  2    ASRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAI  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK-AFQLRRPSG  402
            PL  P   ++ L +++ H+   E  K L+G+ ++ LKD++ D G   +     +L+RPSG
Sbjct  62   PLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ +K+AVR+
Sbjct  122  RPHGKVDVKVAVRE  135



>ref|XP_006422081.1| hypothetical protein CICLE_v10005598mg [Citrus clementina]
 gb|ESR35321.1| hypothetical protein CICLE_v10005598mg [Citrus clementina]
Length=277

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+VT+ SAK LKNVNWRHG  +PY +LW+DP+++ +TK DD G T P W+E   +
Sbjct  2    ASRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAI  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK-AFQLRRPSG  402
            PL  P   ++ L +++ H+   E  K L+G+ ++ LKD++ D G   +     +L+RPSG
Sbjct  62   PLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ +K+AVR+
Sbjct  122  RPHGKVDVKVAVRE  135



>ref|XP_002271267.1| PREDICTED: uncharacterized protein LOC100249100 [Vitis vinifera]
Length=286

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 93/134 (69%), Gaps = 3/134 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SAK LKNVNWRHG LKPYV++W+DP  +L+TK D+ G T P WNE  ++
Sbjct  2    AGRYEIELIISSAKDLKNVNWRHGSLKPYVVVWVDPAAKLSTKVDNDGDTFPCWNETLLI  61

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+    ++S L +++ H  +   +  KP+VG+ R+ L+D+V D G   Q ++  +LRRPS
Sbjct  62   PVPSRIEDSTLYLDVVHLKADDEDDTKPVVGSARLFLRDVVDDVGFGAQAIRTLELRRPS  121

Query  400  GRPQGKIRLKIAVR  441
            GRP GK+ +K++VR
Sbjct  122  GRPHGKVEVKVSVR  135



>emb|CAN68775.1| hypothetical protein VITISV_006805 [Vitis vinifera]
Length=286

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 93/134 (69%), Gaps = 3/134 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SAK LKNVNWRHG LKPYV++W+DP  +L+TK D+ G T P WNE  ++
Sbjct  2    AGRYEIELIISSAKDLKNVNWRHGSLKPYVVVWVDPAAKLSTKVDNDGDTFPCWNETLLI  61

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+    ++S L +++ H  +   +  KP+VG+ R+ L+D+V D G   Q ++  +LRRPS
Sbjct  62   PVPSRIEDSTLYLDVVHLKADDEDDTKPVVGSARLFLRDVVDDVGFGAQAIRTLELRRPS  121

Query  400  GRPQGKIRLKIAVR  441
            GRP GK+ +K++VR
Sbjct  122  GRPHGKVEVKVSVR  135



>ref|XP_008779256.1| PREDICTED: uncharacterized protein LOC103698987 [Phoenix dactylifera]
Length=288

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+++VT+ SA+ LKNVNWR+GDL+PY ++WIDP  + +TK    G   P W+E+ V 
Sbjct  2    ASRYELEVTIGSARDLKNVNWRYGDLQPYAVVWIDPVSKCSTKVAVDGDVNPEWDEKLV-  60

Query  229  PLTLPPQESL----LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRR  393
             L+LPP ++L    L++++ H+  +   KPLVG+ R+PL++++ D+G   +  +  +L+R
Sbjct  61   -LSLPPGQTLDDAVLSIDVVHAGAAGDVKPLVGSTRLPLREVIDDAGIGGKASRTLKLKR  119

Query  394  PSGRPQGKIRLKIAVRKIQEY  456
            PSGRPQGK+ +++AV++   Y
Sbjct  120  PSGRPQGKLDVRVAVKEPSRY  140



>ref|NP_001062521.1| Os08g0562600 [Oryza sativa Japonica Group]
 dbj|BAD09616.1| putative C2 domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF24435.1| Os08g0562600 [Oryza sativa Japonica Group]
 gb|EAZ43672.1| hypothetical protein OsJ_28298 [Oryza sativa Japonica Group]
 dbj|BAG87843.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94346.1| unnamed protein product [Oryza sativa Japonica Group]
Length=291

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 98/138 (71%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY +LW+D   + +T+ D   +  P W+++  +P  
Sbjct  5    YEVEVTVSSARDLKNVNWRNGDLKPYAVLWVDDGAKCSTRVDLDNADNPNWDDKLTLP--  62

Query  238  LPPQ----ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     ++LL +++ H+  +E  KPLVG+ R+PL+D++ D+G   ++ ++ +L+RPSG
Sbjct  63   LPPSSRLDDALLYLDVVHANAAEGVKPLVGSARLPLRDVLDDAGVGARVSRSLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RPQG++ L++AVR+   Y
Sbjct  123  RPQGRLDLRLAVRESARY  140



>ref|XP_009612128.1| PREDICTED: cyclin-dependent kinase inhibitor 1C-like [Nicotiana 
tomentosiformis]
Length=332

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            ++V+V + SAK LKNVNWR+G LKPY ++W+DP  + +T+ D++G   P W+E+ V+PL 
Sbjct  27   FEVEVKISSAKDLKNVNWRYGRLKPYAVVWVDPKAKCSTEVDENGDMSPYWDEKLVIPLY  86

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPSGRPQ  411
             P +ES L +++ H+   +  KPL+G+ ++ L+D+V  V  G+  + ++  L+RPSGRPQ
Sbjct  87   SPIEESTLYIDVVHANAEKDTKPLIGSAKLHLRDVVDTVGIGNCCE-RSLDLKRPSGRPQ  145

Query  412  GKIRLKIAVRK  444
            GK+++ ++VR+
Sbjct  146  GKVKVDVSVRE  156



>ref|NP_001063992.1| Os09g0571200 [Oryza sativa Japonica Group]
 dbj|BAD46606.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25906.1| Os09g0571200 [Oryza sativa Japonica Group]
 gb|EAZ10158.1| hypothetical protein OsI_32474 [Oryza sativa Indica Group]
 gb|EAZ45746.1| hypothetical protein OsJ_30427 [Oryza sativa Japonica Group]
 dbj|BAG88381.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+VTV SA+ LKNVNWR+GDLKPY ++WID   + +T+ D   +  P W+++  V
Sbjct  3    ASRYEVEVTVASARDLKNVNWRNGDLKPYAVVWIDDGAKCSTRVDLDNADNPTWDDKLTV  62

Query  229  PLTLPPQ----ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRR  393
            P  LPP     +++L +++ H+  ++  KPLVG+ R+PL+D++ D+G   +  ++ +L+R
Sbjct  63   P--LPPSTRLDDAVLYLDVVHANATDGVKPLVGSARLPLRDVLADTGIGARASRSLRLKR  120

Query  394  PSGRPQGKIRLKIAVRKIQEY  456
            PSGRP G++ +++AVR+ + Y
Sbjct  121  PSGRPHGRLEVRVAVREPKRY  141



>ref|XP_002318206.1| hypothetical protein POPTR_0012s12880g [Populus trichocarpa]
 gb|EEE96426.1| hypothetical protein POPTR_0012s12880g [Populus trichocarpa]
Length=216

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 92/134 (69%), Gaps = 4/134 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+ +VT+ SAK+LKNVNWRHG LKPY ++W+D + + +T+ DD G T P W++  V+
Sbjct  2    ASRYEFEVTISSAKYLKNVNWRHGSLKPYAVVWVDSNYKCSTQVDDEGDTSPFWDQTLVI  61

Query  229  PL-TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPS  399
            PL +   ++  L ++I H+   E  KPL+G+ ++ L D++  V+ G+    +A QL+RPS
Sbjct  62   PLPSGRIEDHTLHIDIVHAGSEEGTKPLIGSAKLKLIDVLDDVEIGERAT-RALQLKRPS  120

Query  400  GRPQGKIRLKIAVR  441
            GRPQGK+ +K+ +R
Sbjct  121  GRPQGKLDVKVTIR  134



>ref|XP_002513669.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49072.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+V++ SAK LKNVNWRHG L+PY ++WIDP+ + +T+ D+ G T P W++  V+
Sbjct  2    ASRYEVEVSISSAKDLKNVNWRHGLLRPYAVVWIDPNSKWSTRVDEEGDTCPFWDQILVI  61

Query  229  PLTLPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            PL   P ++  L +++ H+   E  KPL+G+ R+ L +++ D G   +L +  QL+RPSG
Sbjct  62   PLPPGPIEDHTLYIDVVHANAEEDTKPLIGSARLKLSEVLDDVGIGQRLNRILQLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RPQGK+ + + +R+
Sbjct  122  RPQGKMDVNVTIRQ  135



>gb|KDP46959.1| hypothetical protein JCGZ_07976 [Jatropha curcas]
Length=274

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+VT+ SAK LKNVNWR+G L+PY ++W+DP+ + +T+ D+ G   P W++  V+
Sbjct  2    ASRYEVEVTITSAKDLKNVNWRNGRLRPYAVVWVDPEHKCSTRVDEEGDMNPFWDQTLVI  61

Query  229  PLTLPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPSG  402
            PL   P ++  L ++I H+   E  KPL+G+ R+ L D++ D G   + +++ QL+RPSG
Sbjct  62   PLPPGPIEDHTLYIDIVHAGREEDTKPLIGSARLKLVDVLDDVGFGERTVRSLQLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RPQGK+ + + +R+
Sbjct  122  RPQGKLDVAVTIRQ  135



>ref|XP_007038773.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
 gb|EOY23274.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
Length=277

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A   +++VT+ SA+ LKNVNWRHG ++PYV++W+DP  + ++K D+ G T P+W+E  V+
Sbjct  2    ASPLEIEVTLSSAEALKNVNWRHGPIRPYVVVWVDPKNKCSSKVDEEGDTCPIWDETLVI  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSG  402
            PL  P   +S L V++ H+   E  KPL+G+ ++ L+D++ D+G      K   L+RPSG
Sbjct  62   PLPGPIYDDSTLFVDVVHAGSEEDTKPLIGSAKLKLRDVLDDAGFGERHKKTLHLKRPSG  121

Query  403  RPQGKIRLKIAVRKIQEY  456
            RPQGK+ +K+ +++ + Y
Sbjct  122  RPQGKVDVKVLIQEPRYY  139



>dbj|BAK04302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=280

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 95/135 (70%), Gaps = 8/135 (6%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY ++W+D   + +T+ D      P W+E+ VVP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLKPYAVVWVDDGAKCSTRVDLDHGENPEWDEKLVVP--  62

Query  238  LPP-----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPS  399
            LPP     ++++L +++ H+  ++  KPLVG+ R+PL+D++ D+G      ++ +L RPS
Sbjct  63   LPPSTARLEDAVLRIDVVHADAADGTKPLVGSARLPLRDVLDDAGLGGRASRSLRLNRPS  122

Query  400  GRPQGKIRLKIAVRK  444
            GRPQG++ +++AVR+
Sbjct  123  GRPQGRLDVRVAVRE  137



>ref|XP_006659707.1| PREDICTED: uncharacterized protein LOC102701649 [Oryza brachyantha]
Length=256

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 94/133 (71%), Gaps = 7/133 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDL PY +LWID   R +T+ D      P W+++  +P  
Sbjct  5    YEVEVTVSSARDLKNVNWRNGDLNPYAVLWIDDGARCSTRVDLDNGDNPDWDDKLTLP--  62

Query  238  LPPQ----ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L +++ H+  ++  KPLVG+ R+PL+D++ D+G   ++ ++ +L+RPSG
Sbjct  63   LPPSSRLDDAVLYIDVVHANAADGVKPLVGSARLPLRDVLDDAGIGARVSRSLRLKRPSG  122

Query  403  RPQGKIRLKIAVR  441
            RPQG++ L++AVR
Sbjct  123  RPQGRLELRLAVR  135



>ref|XP_011030162.1| PREDICTED: uncharacterized protein LOC105129684 [Populus euphratica]
Length=278

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPL-  234
            Y+V+VT+ SAK LKNVNWRHG LKPY ++W+D + + +T+ DD G T P W++  V+PL 
Sbjct  5    YEVEVTISSAKDLKNVNWRHGSLKPYAVVWVDSNYKCSTRVDDEGDTSPFWDQTLVIPLP  64

Query  235  TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPSGRP  408
            +   ++  L ++I H+   E  KPL+G+ ++ L D++  VD G+    +A QL+RPSGRP
Sbjct  65   SGRIEDHTLHIDIVHAGSEEGTKPLIGSAKLKLIDVLDDVDIGERA-TRALQLKRPSGRP  123

Query  409  QGKIRLKIAVR  441
            QGK+ +K+ +R
Sbjct  124  QGKLDVKVTIR  134



>ref|XP_004309433.1| PREDICTED: uncharacterized protein LOC101294323 [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A +++V V + SAK LKNVNWRHG +KPY + W++P  + +TK D+ G T P W+E  ++
Sbjct  2    ASTHEVQVKISSAKDLKNVNWRHGPVKPYAVAWVEPSNKCSTKVDEHGDTSPEWDETLII  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSG  402
            P+  P   ++ L ++I H+      K LVG+ R+PL+D+V D G D    +   ++RPSG
Sbjct  62   PIPGPVNNDTTLYIDIVHAGTEPDTKQLVGSARLPLRDVVDDVGYDERSSRTLTIKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RPQGK+ +K+ VR+
Sbjct  122  RPQGKVDVKVTVRE  135



>gb|ACN35874.1| unknown [Zea mays]
Length=331

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY ++WID   + +T+ D      P W+E+ +VP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLKPYAVVWIDSGSKCSTRVDLDNGESPAWDEKLLVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L V++ H+  ++  KPLVG+ R+PL+D++ D+G   +  ++ +L+RPSG
Sbjct  63   LPPTSRLDDAVLYVDVVHANAAQGVKPLVGSARLPLRDVLGDAGVGGKASRSLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RP G++ +++AV++   Y
Sbjct  123  RPHGRLDVRVAVKEPSRY  140



>ref|XP_004967742.1| PREDICTED: forkhead box protein D1-like [Setaria italica]
Length=292

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 100/146 (68%), Gaps = 13/146 (9%)
 Frame = +1

Query  25   ATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKP  204
            A+ G+R     Y+V+VTV SA+ LKNVNWR+G+LKPY +LW+D   + +T  D      P
Sbjct  17   ASMGSR-----YEVEVTVGSARDLKNVNWRNGELKPYAVLWVDDGPKSSTHVDLDDGENP  71

Query  205  VWNERFVVPLTLPP-----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ  369
            VW+E+ VV   LPP     ++++L ++I H+  +E  KPLVG+ R+PL+D++ D+G   +
Sbjct  72   VWDEKLVV--QLPPSAARLEDAVLHIDIVHANAAEGVKPLVGSARLPLRDVLDDAGVGGK  129

Query  370  L-KAFQLRRPSGRPQGKIRLKIAVRK  444
            + +  +L+RPSGRPQGK+  ++A+R+
Sbjct  130  VSRTLRLKRPSGRPQGKLDARVAIRE  155



>gb|ACG40316.1| SRC2 [Zea mays]
Length=329

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY ++WID   + +T+ D      P W+E+ +VP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLKPYAVVWIDSGSKCSTRVDLDNGESPAWDEKLLVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L V++ H+  ++  KPLVG+ R+PL+D++ D+G   +  ++ +L+RPSG
Sbjct  63   LPPTSRLDDAVLYVDVVHANAAQGVKPLVGSARLPLRDVLDDAGVGGKASRSLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RP G++ +++AV++   Y
Sbjct  123  RPHGRLDVRVAVKEPSRY  140



>ref|NP_001142084.1| uncharacterized protein LOC100274244 [Zea mays]
 gb|ACF78795.1| unknown [Zea mays]
 gb|ACF87601.1| unknown [Zea mays]
 gb|ACR37819.1| unknown [Zea mays]
 tpg|DAA39587.1| TPA: hypothetical protein ZEAMMB73_202732 [Zea mays]
Length=331

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY ++WID   + +T+ D      P W+E+ +VP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLKPYAVVWIDSGSKCSTRVDLDNGESPAWDEKLLVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L V++ H+  ++  KPLVG+ R+PL+D++ D+G   +  ++ +L+RPSG
Sbjct  63   LPPTSRLDDAVLYVDVVHANAAQGVKPLVGSARLPLRDVLDDAGVGGKASRSLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RP G++ +++AV++   Y
Sbjct  123  RPHGRLDVRVAVKEPSRY  140



>ref|XP_010519178.1| PREDICTED: uncharacterized protein LOC104798699 [Tarenaya hassleriana]
Length=274

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 89/134 (66%), Gaps = 9/134 (7%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +V+VT+ SAK +KNVNWRHG   PY ++W+    + +T+ D+ G T P+WNE+ V+P  L
Sbjct  6    EVEVTIASAKDIKNVNWRHGRNMPYAVVWVQQSNKFSTRVDEEGDTCPLWNEKLVIP--L  63

Query  241  PPQ------ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPS  399
            PP+      +++L V+I H+ P E  K L+G+ R+ L+D+V DSG D    K  +L+RPS
Sbjct  64   PPEKPVDDDDNVLRVDIVHADPEEGTKSLIGSARLRLRDVVNDSGVDFPTAKTLKLKRPS  123

Query  400  GRPQGKIRLKIAVR  441
            GRP GK+ + + VR
Sbjct  124  GRPHGKLDVTVTVR  137



>gb|ACG26368.1| SRC2 [Zea mays]
Length=332

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY ++WID   + +T+ D      P W+E+ +VP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLKPYAVVWIDSGSKCSTRVDLDNGESPAWDEKLLVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L V++ H+  ++  KPLVG+ R+PL+D++ D+G   +  ++ +L+RPSG
Sbjct  63   LPPTSRLDDAVLYVDVVHANAAQGVKPLVGSARLPLRDVLDDAGVGGKASRSLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RP G++ +++AV++   Y
Sbjct  123  RPHGRLDVRVAVKEPSRY  140



>ref|XP_002462013.1| hypothetical protein SORBIDRAFT_02g012580 [Sorghum bicolor]
 gb|EER98534.1| hypothetical protein SORBIDRAFT_02g012580 [Sorghum bicolor]
Length=332

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 95/138 (69%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY ++WID   + +T+ D      P W+E+ +VP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLKPYAVVWIDSGAKTSTRVDLDNGENPAWDEKLLVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L +++ H+  +E  KPLVG+ R+PL+D++ D+G   +  +  +L+RPSG
Sbjct  63   LPPTSRLDDAVLYIDVVHANAAEGVKPLVGSARLPLRDVLDDAGVGGKASRNLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RP G++ +++AV++   Y
Sbjct  123  RPHGRLDVRVAVKEPSRY  140



>ref|XP_010550541.1| PREDICTED: uncharacterized protein LOC104821382 [Tarenaya hassleriana]
Length=269

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 90/135 (67%), Gaps = 9/135 (7%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +V+V + SAK +KNVNWRHG  KPY ++W+DP  + +T+ D+ G T P WNE   +P  L
Sbjct  6    EVEVAISSAKDIKNVNWRHGPNKPYAVVWVDPRYKCSTRVDEEGDTSPHWNETLAIP--L  63

Query  241  PPQ------ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST-QLKAFQLRRPS  399
            PP+      +++L ++I H+   E  KPL+G+ R+ L+D++ +SG     +K+ +L+RPS
Sbjct  64   PPEKPVDDDDNVLCIDIVHAGREEDTKPLIGSARLSLRDVLEESGVGVPTVKSLKLKRPS  123

Query  400  GRPQGKIRLKIAVRK  444
            GRP GK+ + + VR+
Sbjct  124  GRPHGKLEVTVTVRE  138



>ref|XP_008234191.1| PREDICTED: WW domain-containing protein C11B10.08 isoform X1 
[Prunus mume]
 ref|XP_008234192.1| PREDICTED: WW domain-containing protein C11B10.08 isoform X2 
[Prunus mume]
 ref|XP_008234193.1| PREDICTED: WW domain-containing protein C11B10.08 isoform X3 
[Prunus mume]
Length=289

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  ++V V + SA+ LKNVNWR+G +KPY ++W+DP+ + +T+ D+ G T P W+E   +
Sbjct  2    ASGHEVQVKLSSARDLKNVNWRNGLVKPYAVVWVDPNNKFSTRVDEEGDTSPYWDETLTI  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSG  402
            PL  P   ++ L +++ H+      KPL+G+ R+ L+++V D G D    +  QL+RPSG
Sbjct  62   PLPGPVDGDTTLYIDVVHAGSDPATKPLIGSARLKLREVVDDVGFDERASRTLQLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RPQGK+ +K+ +R+
Sbjct  122  RPQGKVDVKVTIRE  135



>tpg|DAA60682.1| TPA: hypothetical protein ZEAMMB73_781558 [Zea mays]
Length=398

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 11/148 (7%)
 Frame = +1

Query  40   RPPAKS----YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPV  207
            RPPA +    Y+V+VTV SA+ LKNVNWR+G+LKPY ++WID   + +T+ D      P 
Sbjct  69   RPPATAMGSRYEVEVTVGSARDLKNVNWRNGELKPYAVVWIDSGAKCSTRVDLDNGENPT  128

Query  208  WNERFVVPLTLPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-  372
            W+E+ +VP  LPP     +++L +++ H+  +E  KPLVG+ R+PL+D++ D+G   +  
Sbjct  129  WDEKLLVP--LPPTSRLDDAVLYIDVVHANAAEGVKPLVGSARLPLRDVLDDAGIGGKAS  186

Query  373  KAFQLRRPSGRPQGKIRLKIAVRKIQEY  456
            +  +L+RPSGRP G + +++AV++   Y
Sbjct  187  RNLRLKRPSGRPHGHLDVRVAVKEPSRY  214



>gb|KJB34147.1| hypothetical protein B456_006G049800 [Gossypium raimondii]
Length=275

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A   +++VT+ SAK LKNVNWRH  ++PYV+LW+DP  + +TK D+ G T P+W+E  V+
Sbjct  2    ASPREIEVTLSSAKDLKNVNWRHSPIRPYVVLWVDPKNKCSTKVDEEGDTCPIWDETLVI  61

Query  229  PLTLPP--QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPS  399
            PL   P   +++L +++ H+   E  KPL+G+ +I L+ ++  +G + +  K  +L+RPS
Sbjct  62   PLPAGPVDDDTILFIDVVHAGSEEHTKPLIGSGKIKLRKVLDKAGFEVSHEKTLKLKRPS  121

Query  400  GRPQGKIRLKIAVRK  444
            GRPQG + +++ +R+
Sbjct  122  GRPQGNVDVRVLIRE  136



>gb|KCW90833.1| hypothetical protein EUGRSUZ_A02890 [Eucalyptus grandis]
Length=214

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y ++VTVVSA+ LKNVN RHG   PY ++W+DP+ + +T+ DD G T P+WN   V+PL 
Sbjct  5    YVLEVTVVSAQGLKNVNRRHGPTLPYAVVWVDPNNKRSTRVDDEGHTSPIWNHSLVIPLP  64

Query  238  LPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK-AFQLRRPSGRPQ  411
            L P +++ L++ + H+   E  +PL+G   I L+D++ ++G    LK + QL RPSGRPQ
Sbjct  65   LVPIEDATLSIHVVHAGSEEDTEPLIGWAWISLRDVLDEAGFGNTLKRSLQLMRPSGRPQ  124

Query  412  GKIRLKIAVRK  444
            G++ +++ +R+
Sbjct  125  GEVVVEVCMRE  135



>ref|XP_010440511.1| PREDICTED: uncharacterized protein LOC104723800 [Camelina sativa]
Length=268

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 89/133 (67%), Gaps = 7/133 (5%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +VD+T+ SAK++KNVNWR+G  KPY ++W+DP  + +T+ D+ G T P WNER V+P  L
Sbjct  7    EVDLTISSAKNIKNVNWRNGPNKPYAVVWVDPRNKCSTRVDEDGDTSPFWNERLVIP--L  64

Query  241  PPQESL----LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGR  405
            PP  ++    L ++I H+   E  KPL+G+ ++ L+D+  + G      K  +L+RPSGR
Sbjct  65   PPDNNVDDGKLCIDIVHAGQEEDTKPLIGSAKLSLRDVPEEVGFGVPFVKTLKLKRPSGR  124

Query  406  PQGKIRLKIAVRK  444
            PQGK+ + + V++
Sbjct  125  PQGKLDVTVTVQE  137



>ref|NP_001145939.1| uncharacterized protein LOC100279462 [Zea mays]
 gb|ACL52886.1| unknown [Zea mays]
Length=324

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 94/138 (68%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+G+LKPY ++WID   + +T+ D      P W+E+ +VP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGELKPYAVVWIDSGAKCSTRVDLDNGENPTWDEKLLVP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L +++ H+  +E  KPLVG+ R+PL+D++ D+G   +  +  +L+RPSG
Sbjct  63   LPPTSRLDDAVLYIDVVHANAAEGVKPLVGSARLPLRDVLDDAGIGGKASRNLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RP G + +++AV++   Y
Sbjct  123  RPHGHLDVRVAVKEPSRY  140



>ref|XP_003634095.1| PREDICTED: uncharacterized protein LOC100852496 [Vitis vinifera]
 emb|CAN62171.1| hypothetical protein VITISV_014432 [Vitis vinifera]
Length=268

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  +++ + + SAK LKNVNWRHG LKPY ++W++P+ + +TK D  G T P WNE   +
Sbjct  2    APRFELKLKISSAKDLKNVNWRHGSLKPYAVVWVEPNAKCSTKVDHDGDTFPSWNETLHI  61

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+     +S L ++I H  S   +  KP+VG+ R+ L+D+V D G   +  +  +LRRPS
Sbjct  62   PVPSSIDDSALYLDIVHVKSDDEDDTKPMVGSARLFLRDVVDDVGFGVEAFRTLELRRPS  121

Query  400  GRPQGKIRLKIAVRKIQ  450
            GRPQGK+ ++++VR ++
Sbjct  122  GRPQGKVDVEVSVRDLR  138



>ref|XP_007218770.1| hypothetical protein PRUPE_ppa009523mg [Prunus persica]
 gb|EMJ19969.1| hypothetical protein PRUPE_ppa009523mg [Prunus persica]
Length=288

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  ++V V + SA+ LKNVNWR+G +KPY ++W+DP  + +T+ D+ G T P W+E   +
Sbjct  2    ASGHEVQVKLSSARDLKNVNWRNGPVKPYAVVWVDPKNKCSTRVDEEGDTSPYWDETLTI  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSG  402
            PL  P   ++ L +++ H+      KPL+G+ R+ L++++ D G D    +  QL+RPSG
Sbjct  62   PLPGPVDGDTTLYIDVVHAGSDPDTKPLIGSARLKLREVIDDVGFDERASRTLQLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RPQGK+ +K+ +R+
Sbjct  122  RPQGKVDVKVTIRE  135



>ref|XP_004956261.1| PREDICTED: tropomyosin-1, isoforms 33/34-like [Setaria italica]
Length=326

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 95/138 (69%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY ++W+D   + +T+ D      P W+E+ +VP  
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLKPYAVVWVDSGAKCSTRVDLDNGESPSWDEKLLVP--  62

Query  238  LPPQ----ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            LPP     +++L +++ H+  +E  KPLVG+ R+PL+D++ D+G   +  +  +L+RPSG
Sbjct  63   LPPSSRLDDAVLYLDVVHANAAEGVKPLVGSARLPLRDVLDDAGIGGKASRNLRLKRPSG  122

Query  403  RPQGKIRLKIAVRKIQEY  456
            RP G++ +++A+++   Y
Sbjct  123  RPHGRLDVRVAIKEPARY  140



>ref|XP_010671657.1| PREDICTED: uncharacterized protein LOC104888396 [Beta vulgaris 
subsp. vulgaris]
Length=283

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 2/135 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V++T+ SAK LKN+NWR G LKPY I +I+PDR++ T+ DD G T P W++  +V
Sbjct  2    ASRYEVEITLSSAKDLKNINWRSGPLKPYAIAYINPDRKVTTRVDDEGDTCPQWDQSLMV  61

Query  229  PLTLPPQESLLAVEIFH-SVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGR  405
            PL      + + +EI H +   E  KPL+GT ++ L D+  + G     ++ +L+RPSGR
Sbjct  62   PLDGSINNATITIEIVHRASEDEDIKPLIGTAKLSLCDIGENEGARVS-RSLKLKRPSGR  120

Query  406  PQGKIRLKIAVRKIQ  450
            P GK+ +++ +R  Q
Sbjct  121  PHGKLEVEVTIRAPQ  135



>emb|CAN78886.1| hypothetical protein VITISV_002549 [Vitis vinifera]
Length=268

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  +++ + + SAK LKNVNWRHG LKPY ++W++P+ + +TK D  G T P WNE   +
Sbjct  2    APRFELKLKISSAKDLKNVNWRHGSLKPYAVVWVEPNAKCSTKVDHDGDTFPSWNETLHI  61

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+     +S L ++I H  S   +  KP+VG+ R+ L+D+V D G   +  +  +LRRPS
Sbjct  62   PVPSSIDDSALYLDIVHVKSDDEDDTKPMVGSARLFLRDVVDDVGFGVEAFRTLELRRPS  121

Query  400  GRPQGKIRLKIAVRKIQ  450
            GRPQGK+ ++++V+ ++
Sbjct  122  GRPQGKVDVEVSVKDLR  138



>ref|XP_010096867.1| hypothetical protein L484_003038 [Morus notabilis]
 gb|EXB66282.1| hypothetical protein L484_003038 [Morus notabilis]
Length=285

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +V+V + SAK LKNVNWRHG ++PY ++W+DP+ + +T+ D+SG T P W+E   +PL  
Sbjct  6    EVEVKLSSAKDLKNVNWRHGPVRPYAVVWVDPNIKCSTRVDESGDTNPNWDETLTIPLPT  65

Query  241  PPQES-LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSGRPQG  414
            P  +S  L ++I H+      K L+G+ R+ L+++V D G      +  Q++RPSGRPQG
Sbjct  66   PIDDSTTLYIDIVHAGSEPDTKRLIGSARLKLREVVDDVGYGERATRTLQMKRPSGRPQG  125

Query  415  KIRLKIAVRK  444
            K+ +K++VR+
Sbjct  126  KVEVKVSVRE  135



>ref|XP_008379961.1| PREDICTED: WW domain-containing protein C11B10.08 [Malus domestica]
Length=292

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  ++V + + SA+ LKNVNWR+G LKPY ++W+DP  + ++  D+ G   P W+E   +
Sbjct  2    ASGHEVQLKLTSARDLKNVNWRNGALKPYAVVWVDPKNKCSSHVDEEGDASPYWDETLTI  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSG  402
            PL  P   ++ L ++I H+      KPL+G+ R+ L+D++ D G D    +  QL+RPSG
Sbjct  62   PLPGPVDGDTTLNIDIVHAGSDPDTKPLIGSARLKLRDVIDDVGFDEPASRTLQLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RPQGK+ +K+ +R+
Sbjct  122  RPQGKVDVKVTIRE  135



>gb|EYU19570.1| hypothetical protein MIMGU_mgv1a018510mg [Erythranthe guttata]
Length=279

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 95/140 (68%), Gaps = 8/140 (6%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWR-HGDLKPYVILWIDPDRRLATKSDD----SGSTKPVWN  213
            A  Y+V+VT+ SAK LKNVNWR +G LKPY ++WID +R+ +T++D+     G   P W+
Sbjct  2    ASRYEVEVTIASAKDLKNVNWRSNGKLKPYAVVWIDQNRKCSTRADEGGDGDGGVSPSWD  61

Query  214  ERFVVPLTLPPQESLLAVEIFHSVPS--ETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQ  384
            E+ ++P   P  +S L ++I HS  +  +  KP+VG+ ++ L+D+V D G  ST  +   
Sbjct  62   EKLLLPFNSPIDDSTLYIDIVHSAAAADDCTKPIVGSAKLSLRDVVDDVGMGSTADRKLD  121

Query  385  LRRPSGRPQGKIRLKIAVRK  444
            L+RPSGRPQGK+ ++++VR+
Sbjct  122  LKRPSGRPQGKLVVRLSVRE  141



>ref|NP_001141178.1| hypothetical protein [Zea mays]
 gb|ACF85639.1| unknown [Zea mays]
 tpg|DAA48567.1| TPA: hypothetical protein ZEAMMB73_716030 [Zea mays]
Length=282

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 94/140 (67%), Gaps = 13/140 (9%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA +LKNVNWR+GDL+PY +LW+D   + +T+ D      PVW+E+ VVP  
Sbjct  5    YEVEVTVGSASNLKNVNWRNGDLRPYAVLWVDDGPKCSTRVDPDNGEDPVWDEKVVVP--  62

Query  238  LPPQ------ESLLAVEIFHSVP--SETPKPLVGTLRIPLKDLVVDSGDSTQL---KAFQ  384
            +PP       +++L +++ H+    ++  KPLVG+ R+PL+D++ D+G        +  +
Sbjct  63   VPPASAARLGDAVLHIDVVHAAGDDADAVKPLVGSARLPLRDVLDDAGGVGGARVSRTLR  122

Query  385  LRRPSGRPQGKIRLKIAVRK  444
            L+RPSGRPQG++  ++AVR+
Sbjct  123  LKRPSGRPQGRLEARVAVRE  142



>ref|XP_009368751.1| PREDICTED: WW domain-containing protein C11B10.08 [Pyrus x bretschneideri]
Length=287

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A   +V V + SA  LKNVNWR+G +KPY ++W+DP+R+ +++ D+ G T P W+E   +
Sbjct  2    ASGNEVQVKLTSAHDLKNVNWRNGGVKPYAVVWVDPNRKCSSRVDEEGDTSPYWDETLTI  61

Query  229  PLTLP-PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSG  402
            PL  P   ++ L ++I H+      KPL+G+ R+ L++++ D G D    +   L+RPSG
Sbjct  62   PLPGPVDGDTTLYIDIVHAGSDRDTKPLIGSARLKLREVLDDVGFDERASRTLHLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ +K+ +RK
Sbjct  122  RPHGKVDVKVTIRK  135



>ref|XP_002872084.1| hypothetical protein ARALYDRAFT_910412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48343.1| hypothetical protein ARALYDRAFT_910412 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 89/136 (65%), Gaps = 6/136 (4%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  +V+VT+ SAK +KNVNWR+G  KPY ++W+DP  + +T+ ++ G T P WNE FV+
Sbjct  3    SRGREVEVTISSAKDIKNVNWRNGPNKPYAVVWVDPTYKSSTRVEEDGDTCPTWNETFVI  62

Query  229  PLTLPP---QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRP  396
            P  LPP    +  + ++I H+   +  KPL+G+  + L+D++ D G     +K  +L+RP
Sbjct  63   P--LPPANDDDDKVYIDIVHAGGEKNTKPLIGSAHLSLRDVIDDVGFGVPFMKTLKLKRP  120

Query  397  SGRPQGKIRLKIAVRK  444
            SGRP GK+ L + VR+
Sbjct  121  SGRPHGKLELTVTVRE  136



>ref|XP_007152204.1| hypothetical protein PHAVU_004G110200g [Phaseolus vulgaris]
 gb|ESW24198.1| hypothetical protein PHAVU_004G110200g [Phaseolus vulgaris]
Length=247

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 87/139 (63%), Gaps = 2/139 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+++V + SA+ LKNVNWRHG  +PY ++W+D   + +T  D+ G T+  WN+  V+
Sbjct  2    ASHYELEVNLASARGLKNVNWRHGANRPYAVVWVDAKNKCSTTVDEDGDTEATWNQTLVI  61

Query  229  PLTLPPQESL-LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            PL   P E L L V+  H+   E  +PL+G+ R+ + +++ D G   ++ +   L+RPSG
Sbjct  62   PLPPEPLEDLSLHVDAVHAGSEEDTEPLIGSARLKVVEVLEDVGVGARVSRTLALKRPSG  121

Query  403  RPQGKIRLKIAVRKIQEYQ  459
            RPQGK+ + + +R+   Y+
Sbjct  122  RPQGKVDVNVVIRETGGYR  140



>ref|XP_002275480.1| PREDICTED: uncharacterized protein LOC100242355 [Vitis vinifera]
Length=268

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  +++ + + SAK LKNVNW HG LKPY ++W++P+ + +TK D  G T P WNE   +
Sbjct  2    APRFELKLKISSAKDLKNVNWCHGSLKPYAVVWVEPNAKCSTKVDHDGDTFPSWNETLHI  61

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+     +S L ++I H  S   +  KP+VG+ R+ L+D+V D G   +  +  +LRRPS
Sbjct  62   PVPSSIDDSALYLDIVHVKSDDEDDTKPMVGSARLFLRDVVDDVGFGVEAFRTLELRRPS  121

Query  400  GRPQGKIRLKIAVRKIQ  450
            GRPQGK+ ++++VR ++
Sbjct  122  GRPQGKVDVEVSVRDLR  138



>emb|CAN69351.1| hypothetical protein VITISV_017753 [Vitis vinifera]
Length=268

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  +++ + + SAK LKNVNW HG LKPY ++W++P+ + +TK D  G T P WNE   +
Sbjct  2    APRFELKLKISSAKDLKNVNWCHGSLKPYAVVWVEPNAKCSTKVDHDGDTFPSWNETLHI  61

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+     +S L ++I H  S   +  KP+VG+ R+ L+D+V D G   +  +  +LRRPS
Sbjct  62   PVPSSIDDSALYLDIVHVKSDDEDDTKPMVGSARLFLRDVVDDVGFGVEAFRTLELRRPS  121

Query  400  GRPQGKIRLKIAVRKIQ  450
            GRPQGK+ ++++VR ++
Sbjct  122  GRPQGKVDVEVSVRDLR  138



>emb|CDX87149.1| BnaC09g04640D [Brassica napus]
Length=214

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  +V+VT+ SAK +KNVNWR+G  KPY ++WIDP  + +T+ D+   T P WN+ FV+
Sbjct  3    SRGREVEVTISSAKDIKNVNWRNGPNKPYAVVWIDPKYKFSTRVDEEDDTCPSWNQTFVI  62

Query  229  PLTLPP------QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQL  387
            P  LPP      ++  + +++ H+   E  KPL+G+  + L+D++ D+G    + K  +L
Sbjct  63   P--LPPGNDDDYEDDKVYIDVVHAGGEENTKPLIGSANLSLRDVIDDAGFGVPVEKTLKL  120

Query  388  RRPSGRPQGKIRLKIAVRK  444
            +RPSGRP GK+ + + VR+
Sbjct  121  KRPSGRPHGKLDVTVTVRE  139



>ref|XP_010421203.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
[Camelina sativa]
Length=275

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 7/135 (5%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  +V+VT+ SA+  KNVNWR+G  KPY ++WIDP  + +T+ D+ G T P WNE FV+
Sbjct  3    SRGQEVEVTISSARDTKNVNWRNGPNKPYAVVWIDPKYKSSTRVDEDGDTCPTWNETFVI  62

Query  229  PLTLPPQE---SLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPS  399
            P  LPP E     + ++I H+   E  KPL+G+  + L+D++    D   +K  +L+RPS
Sbjct  63   P--LPPHEDDYDKVYIDIVHAGREENTKPLIGSAHLSLRDVI--GLDVPVVKTLELKRPS  118

Query  400  GRPQGKIRLKIAVRK  444
            GRP GK+ + + VR+
Sbjct  119  GRPHGKLDVTVTVRE  133



>ref|XP_006394656.1| hypothetical protein EUTSA_v10004867mg [Eutrema salsugineum]
 gb|ESQ31942.1| hypothetical protein EUTSA_v10004867mg [Eutrema salsugineum]
Length=229

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 4/136 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  +V+V + SAK +KNVNWR+G  KPY ++W+DP  + +T+ D+ G T P WNE FV+
Sbjct  3    SRGREVEVAISSAKDIKNVNWRNGPNKPYAVVWVDPKYKSSTRVDEDGDTCPSWNETFVI  62

Query  229  PL---TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRP  396
            PL    L   ++ + + I H+   E  KPL+G+  + L+D++ D G     +K   L+RP
Sbjct  63   PLPLDNLYDDDNKVYINIVHAGREENTKPLIGSAYLSLRDVIDDVGFGVANVKTINLKRP  122

Query  397  SGRPQGKIRLKIAVRK  444
            SGRP G + + +AVR+
Sbjct  123  SGRPHGILDVTVAVRE  138



>gb|ACU21016.1| unknown [Glycine max]
Length=245

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V++ + SA+ LKNVNWRHG  +PYV++W+DP  +L+T+ D+SG T   W++   +PL 
Sbjct  5    YEVELKLSSARALKNVNWRHGPNRPYVVVWVDPSNKLSTRVDESGDTDANWDQTLTIPLP  64

Query  238  LPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRPQ  411
              P ++  L +++ H+   E  KPL+G+ R+ L D++ D G   ++ +   L+RPSGRP 
Sbjct  65   PKPLEDQTLYIDVVHAGSEEDTKPLIGSARLKLVDILDDVGIGERVSRTLSLKRPSGRPH  124

Query  412  GKIRLKIAVRK  444
            GK+ + + +R+
Sbjct  125  GKVEVSVTIRE  135



>ref|NP_197783.2| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAV85706.1| At5g23950 [Arabidopsis thaliana]
 gb|AED93237.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=219

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 86/132 (65%), Gaps = 6/132 (5%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +V+VT+ SAK +KNVNWR+G  KPY ++WIDP  + +T+ D+ G+T   WNE FV+   L
Sbjct  7    EVEVTISSAKDIKNVNWRNGPNKPYAVVWIDPKFKSSTRVDEDGNTCTTWNETFVI--AL  64

Query  241  PP---QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPSGRP  408
            PP    +  + + I H+   E  KPL+G+  + L+D++ D G     +K  +L+RPSGRP
Sbjct  65   PPANDDDDKVYINIVHAGREENTKPLIGSAHLSLRDVIDDVGFGVPFMKTLKLKRPSGRP  124

Query  409  QGKIRLKIAVRK  444
            QGK+ + + VR+
Sbjct  125  QGKLDVTVTVRE  136



>dbj|BAB10068.1| unnamed protein product [Arabidopsis thaliana]
Length=235

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 86/132 (65%), Gaps = 6/132 (5%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +V+VT+ SAK +KNVNWR+G  KPY ++WIDP  + +T+ D+ G+T   WNE FV+   L
Sbjct  23   EVEVTISSAKDIKNVNWRNGPNKPYAVVWIDPKFKSSTRVDEDGNTCTTWNETFVI--AL  80

Query  241  PP---QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPSGRP  408
            PP    +  + + I H+   E  KPL+G+  + L+D++ D G     +K  +L+RPSGRP
Sbjct  81   PPANDDDDKVYINIVHAGREENTKPLIGSAHLSLRDVIDDVGFGVPFMKTLKLKRPSGRP  140

Query  409  QGKIRLKIAVRK  444
            QGK+ + + VR+
Sbjct  141  QGKLDVTVTVRE  152



>ref|XP_010454681.1| PREDICTED: uncharacterized protein LOC104736407 [Camelina sativa]
Length=267

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 87/135 (64%), Gaps = 7/135 (5%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  +V+VT++SA+  KNVNWR+G  KPY ++W+DP  + +T+ D+ G T P WNE FV+
Sbjct  3    SRGQEVEVTILSARDTKNVNWRNGPNKPYAVVWVDPKYKSSTRVDEDGDTCPTWNETFVI  62

Query  229  PLTLPPQE---SLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPS  399
            P  LPP E     + ++I H+   E  KPL+G+  + L D++    D   +K  +L+RPS
Sbjct  63   P--LPPHEDDYDKVYIDIVHAGREENTKPLIGSAHLSLHDVI--GLDVPVVKTLELKRPS  118

Query  400  GRPQGKIRLKIAVRK  444
            GRP GK+ + + VR+
Sbjct  119  GRPHGKLDVTVTVRE  133



>gb|KFK27692.1| hypothetical protein AALP_AA8G416000 [Arabis alpina]
Length=271

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +V++T+ SAK +KNVNWR+G  KPY ++WIDP  + +T+ DD G T P WNE  V+PL  
Sbjct  7    EVEITITSAKDIKNVNWRNGPNKPYAVVWIDPRYKSSTRVDDDGDTCPTWNETLVIPLPP  66

Query  241  PPQESL-----LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPSG  402
            P   +      + ++I H+   E  KPL+G+ ++ L+D++ ++G     +K  +L+RPSG
Sbjct  67   PDNNNDEDDNKIYIDIVHAGREEDTKPLIGSAKLSLRDVIEEAGLGVPVVKTLKLKRPSG  126

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ + + VR+
Sbjct  127  RPHGKLEVTVTVRE  140



>emb|CDY16874.1| BnaA09g05080D [Brassica napus]
Length=219

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  +V+VT+ SAK++KNVNWR+G  KPY ++WIDP  + +T+ D+   T P WN+ FV+
Sbjct  3    SRGREVEVTISSAKNIKNVNWRNGPNKPYAVVWIDPKYKFSTRVDEEDDTCPSWNQTFVI  62

Query  229  PLTLPP-----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLR  390
            P  LPP      +  + +++ H+   E  KPL+G+  + L+D++ D G    + K  +L+
Sbjct  63   P--LPPGNDDYDDDKVYIDVVHAGGEENTKPLIGSAHLSLRDVIDDVGFGVPVEKTLKLK  120

Query  391  RPSGRPQGKIRLKIAVRK  444
            RPSGRP GK+ + + VR+
Sbjct  121  RPSGRPHGKLDVTVTVRE  138



>ref|XP_009141839.1| PREDICTED: uncharacterized protein LOC103865744 [Brassica rapa]
Length=259

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            ++  +V+VT+ SAK++KNVNWR+G  KPY ++WIDP  + +T+ D+   T P WN+ FV+
Sbjct  3    SRGREVEVTISSAKNIKNVNWRNGPNKPYAVVWIDPKYKFSTRVDEEDDTCPSWNQTFVI  62

Query  229  PLTLPP-----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLR  390
            P  LPP      +  + +++ H+   E  KPL+G+  + L+D++ D G    + K  +L+
Sbjct  63   P--LPPGNDDYDDDKVFIDVVHAGGEENTKPLIGSAHLSLRDVIDDVGFGVPVEKTLKLK  120

Query  391  RPSGRPQGKIRLKIAVRK  444
            RPSGRP GK+ + + VR+
Sbjct  121  RPSGRPHGKLDVTVTVRE  138



>ref|XP_003571266.1| PREDICTED: uncharacterized protein LOC100829104 [Brachypodium 
distachyon]
Length=254

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 95/137 (69%), Gaps = 8/137 (6%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWR-HGDLKPYVILWIDPDR--RLATKSDDSGSTKPVWNERFVV  228
            Y+V+VTV SA+ LKNVNWR  GDLKPY +LW+D D   + +T+ D   + +PVW+E+  +
Sbjct  5    YEVEVTVGSARELKNVNWRDGGDLKPYAVLWLDSDSGAKCSTRVDLDNADRPVWDEKLTL  64

Query  229  PLTLPPQ--ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDS---GDSTQLKAFQLRR  393
            PL+   +  +++L +++ H+ P+ +   L+G+ R+PL+D++ ++   G     ++ +L R
Sbjct  65   PLSSSGRLDDAVLHIDVVHAAPAGSTPLLIGSARLPLRDVLREAGGIGGGRVSRSLRLHR  124

Query  394  PSGRPQGKIRLKIAVRK  444
            PSGRPQG++ +++AVR+
Sbjct  125  PSGRPQGRLDVRVAVRQ  141



>ref|XP_002271409.1| PREDICTED: BAHD acyltransferase DCR [Vitis vinifera]
Length=593

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SAK LKNVN RHG LKPYV++W+DP  +L+TK D+ G T P WNE  ++
Sbjct  2    ASRYELELIISSAKDLKNVNRRHGSLKPYVVVWVDPAAKLSTKVDNEGDTSPGWNETLLI  61

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+    ++S L +++ H  +   +  KP+VG+ R+ L  +V + G   Q ++  +L RPS
Sbjct  62   PVPSRIEDSTLYLDVVHFKADDEDDTKPVVGSARLFLPHVVDEVGFGAQAIRTLELHRPS  121

Query  400  GRPQGKIRLKIAVR  441
            G PQGK+ +K++VR
Sbjct  122  GHPQGKVEVKVSVR  135



>ref|XP_010493524.1| PREDICTED: uncharacterized protein LOC104770764 [Camelina sativa]
Length=295

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 84/131 (64%), Gaps = 7/131 (5%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            + +VT+ SA+  KNVNWR+G  KPY ++WIDP  + +T+ D+ G T P WNE FV+P  L
Sbjct  23   EAEVTISSARDTKNVNWRNGPNKPYAVVWIDPKYKSSTRVDEDGDTCPTWNETFVIP--L  80

Query  241  PPQE---SLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQ  411
            PP E     + ++I H+   E  KPL+G+  + L+D++    D   +K  +L+RPSGRP 
Sbjct  81   PPHEDDCDKVYIDIVHAGREENTKPLIGSAHLSLRDVI--GLDVPVVKTLELKRPSGRPH  138

Query  412  GKIRLKIAVRK  444
            GK+ + + VR+
Sbjct  139  GKLDVTVTVRE  149



>emb|CBI22681.3| unnamed protein product [Vitis vinifera]
Length=715

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SAK LKNVN RHG LKPYV++W+DP  +L+TK D+ G T P WNE  ++
Sbjct  30   ASRYELELIISSAKDLKNVNRRHGSLKPYVVVWVDPAAKLSTKVDNEGDTSPGWNETLLI  89

Query  229  PLTLPPQESLLAVEIFH--SVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPS  399
            P+    ++S L +++ H  +   +  KP+VG+ R+ L  +V + G   Q ++  +L RPS
Sbjct  90   PVPSRIEDSTLYLDVVHFKADDEDDTKPVVGSARLFLPHVVDEVGFGAQAIRTLELHRPS  149

Query  400  GRPQGKIRLKIAVR  441
            G PQGK+ +K++VR
Sbjct  150  GHPQGKVEVKVSVR  163



>gb|ACJ84898.1| unknown [Medicago truncatula]
 gb|AFK45218.1| unknown [Medicago truncatula]
 gb|KEH26182.1| C2 domain protein [Medicago truncatula]
Length=301

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+ +V + SA +LKNVNWR+G  KPY ++WIDP  + +TK D++G T+  W++  ++
Sbjct  2    ASRYEAEVKLSSAYNLKNVNWRNGSNKPYGVVWIDPKNKFSTKVDENGDTEANWDQTLII  61

Query  229  PLTLPPQESL-LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            PL   P E L L ++I H+      KPL+G+ R+ L +++ D G   +  ++  L+RPSG
Sbjct  62   PLPPQPIEDLTLYIDIVHAGSEPDTKPLIGSARLKLVEVLDDVGIGERASRSLTLKRPSG  121

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ +K+ +R+
Sbjct  122  RPHGKVDVKVIIRE  135



>ref|XP_007152206.1| hypothetical protein PHAVU_004G110400g [Phaseolus vulgaris]
 gb|ESW24200.1| hypothetical protein PHAVU_004G110400g [Phaseolus vulgaris]
Length=308

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V++ + SA+ LKNVNWRHG  +PYV++W+D   +L+T  D +G T   W++  VVPL 
Sbjct  5    YEVELKLSSARGLKNVNWRHGANRPYVVVWVDSSNKLSTHVDQNGDTDANWDQTLVVPLP  64

Query  238  LPP-QESLLAVEIFHSVPSET-PKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRP  408
              P ++  L +++ H+V  E   KPL+G+ R+ L +++ D G   ++ +   L+RPSGRP
Sbjct  65   AKPLEDQTLHIDVVHAVSEEEDTKPLIGSARLKLSEILDDGGMGERVGRTLTLKRPSGRP  124

Query  409  QGKIRLKIAVRK  444
             GK+ + + +R+
Sbjct  125  HGKVEVSVTIRE  136



>gb|AGV54342.1| hypothetical protein [Phaseolus vulgaris]
Length=272

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V++ + SA+ LKNVNWRHG  +PYV++W+D   +L+T  D +G T   W++  VVPL 
Sbjct  5    YEVELKLSSARGLKNVNWRHGANRPYVVVWVDSSNKLSTHVDQNGDTDANWDQTLVVPLP  64

Query  238  LPP-QESLLAVEIFHSVPSET-PKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSGRP  408
              P ++  L +++ H+V  E   KPL+G+ R+ L +++ D G   ++ +   L+RPSGRP
Sbjct  65   AKPLEDQTLHIDVVHAVSEEEDTKPLIGSARLKLSEILDDGGMGERVGRTLTLKRPSGRP  124

Query  409  QGKIRLKIAVRK  444
             GK+ + + +R+
Sbjct  125  HGKVEVSVTIRE  136



>gb|KEH40144.1| C2 domain protein [Medicago truncatula]
Length=342

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 89/139 (64%), Gaps = 11/139 (8%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+V+V ++SAK+LKNVNWR+G   PY ++W+DP ++ +T  D SG T+P WNE+ + 
Sbjct  2    ASPYEVEVKLLSAKNLKNVNWRYGPNLPYAVVWVDPAQKRSTNVDKSGDTQPNWNEKLIT  61

Query  229  PLTLPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVD--SGDSTQLKAFQLR  390
              T+PP    +   + +++ H   +  P  ++G+ ++PL  + +D  SG S  LK   L+
Sbjct  62   --TMPPSTTIKNCFVFIDVLHLESNNKPPLIIGSSQLPLDGIKIDDLSGVSRTLK---LK  116

Query  391  RPSGRPQGKIRLKIAVRKI  447
            RPSGRPQG + +K+ ++ +
Sbjct  117  RPSGRPQGTVDIKVIIKNL  135



>ref|XP_004512835.1| PREDICTED: probable peroxisomal membrane protein PEX13-like [Cicer 
arietinum]
Length=295

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 82/124 (66%), Gaps = 2/124 (2%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y+ +V + SA+ LKNVNWR+G  +PY ++WIDP  + +TK D++G T+  W++  ++
Sbjct  2    ATRYEAEVKLSSARGLKNVNWRNGSNRPYAVVWIDPKNKFSTKVDENGDTEAEWDQTLII  61

Query  229  PLTLPPQESL-LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG  402
            PL   P E+L L ++I H+   +  KPL+G+ R+ L +++ D G   ++ ++  LRRPSG
Sbjct  62   PLPPEPIENLTLYIDIVHAGSEQDTKPLIGSARLQLVEILKDVGIGERVSRSLTLRRPSG  121

Query  403  RPQG  414
            RP G
Sbjct  122  RPHG  125



>gb|KCW46456.1| hypothetical protein EUGRSUZ_K00286, partial [Eucalyptus grandis]
Length=295

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 94/137 (69%), Gaps = 8/137 (6%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y V+VT+++AK LKNVNWRHG L+PY ++W DP+++ +T++D  G + PVW++  ++P  
Sbjct  6    YQVEVTLIAAKDLKNVNWRHGPLRPYAVVWADPNQKCSTRADAEGESFPVWDQTLLIP--  63

Query  238  LPPQESL----LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG--DSTQLKAFQLRRPS  399
            LPP  ++    L V++ H+   +  KPL+G+ R+ L+D++ D       + ++  L+RPS
Sbjct  64   LPPGTAVDDVTLHVDVVHAGTEDGTKPLIGSARLRLRDVLDDDDGYGGAKKRSLHLKRPS  123

Query  400  GRPQGKIRLKIAVRKIQ  450
            GRP GK+ +K+AV++ +
Sbjct  124  GRPHGKVDVKVAVKETR  140



>ref|XP_010035164.1| PREDICTED: uncharacterized protein DDB_G0290685-like isoform 
X2 [Eucalyptus grandis]
Length=514

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 88/136 (65%), Gaps = 8/136 (6%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y V+VT++ AK L+NV+ RHG L+PY ++W DP+++  T+ D  G + PVW++   +P+ 
Sbjct  6    YQVEVTLIGAKDLENVDSRHGPLRPYAVVWADPNQKRPTRVDPEGDSFPVWDQ--TLPIP  63

Query  238  LPPQES----LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPS  399
            LPP  +    +L V I H+   +  +PL+G+ ++ L+D++ D       K  + QL+RPS
Sbjct  64   LPPGAAVDDVMLHVHIVHASSEDGTRPLIGSAQLRLRDVLDDDNGYGGAKRWSLQLKRPS  123

Query  400  GRPQGKIRLKIAVRKI  447
            GRP GK+ +K+AVR+ 
Sbjct  124  GRPHGKVDIKVAVRET  139



>ref|XP_010035163.1| PREDICTED: uncharacterized protein DDB_G0290685-like isoform 
X1 [Eucalyptus grandis]
Length=589

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 89/137 (65%), Gaps = 8/137 (6%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y V+VT++ AK L+NV+ RHG L+PY ++W DP+++  T+ D  G + PVW++   +P+ 
Sbjct  6    YQVEVTLIGAKDLENVDSRHGPLRPYAVVWADPNQKRPTRVDPEGDSFPVWDQ--TLPIP  63

Query  238  LPPQES----LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPS  399
            LPP  +    +L V I H+   +  +PL+G+ ++ L+D++ D       K  + QL+RPS
Sbjct  64   LPPGAAVDDVMLHVHIVHASSEDGTRPLIGSAQLRLRDVLDDDNGYGGAKRWSLQLKRPS  123

Query  400  GRPQGKIRLKIAVRKIQ  450
            GRP GK+ +K+AVR+ +
Sbjct  124  GRPHGKVDIKVAVRETR  140



>ref|XP_006288435.1| hypothetical protein CARUB_v10001693mg [Capsella rubella]
 gb|EOA21333.1| hypothetical protein CARUB_v10001693mg [Capsella rubella]
Length=273

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 84/134 (63%), Gaps = 10/134 (7%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            +V+VT+ SAK  KNVNWR+G  KPY ++W+ P  + +T+ D+ G T P WNE FV+P  L
Sbjct  7    EVEVTISSAKDTKNVNWRNGPNKPYAVVWVVPKYKSSTRVDEDGDTCPTWNETFVIP--L  64

Query  241  PPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
            PP  +       + ++I H+   E  KPL+G+  + L+D++    D   +K  +L+RPSG
Sbjct  65   PPDNNNGEDYDKVYIDIVHAGREEDTKPLIGSAHLSLRDVI--GLDVPFVKTLELKRPSG  122

Query  403  RPQGKIRLKIAVRK  444
            RP GK+ + + VR+
Sbjct  123  RPHGKLDVTVTVRE  136



>ref|XP_010035165.1| PREDICTED: uncharacterized protein LOC104424437 [Eucalyptus grandis]
Length=414

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 94/137 (69%), Gaps = 8/137 (6%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y V+VT+++AK LKNVNWRHG L+PY ++W DP+++ +T++D  G + PVW++  ++P  
Sbjct  120  YQVEVTLIAAKDLKNVNWRHGPLRPYAVVWADPNQKCSTRADAEGESFPVWDQTLLIP--  177

Query  238  LPPQESL----LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG--DSTQLKAFQLRRPS  399
            LPP  ++    L V++ H+   +  KPL+G+ R+ L+D++ D       + ++  L+RPS
Sbjct  178  LPPGTAVDDVTLHVDVVHAGTEDGTKPLIGSARLRLRDVLDDDDGYGGAKKRSLHLKRPS  237

Query  400  GRPQGKIRLKIAVRKIQ  450
            GRP GK+ +K+AV++ +
Sbjct  238  GRPHGKVDVKVAVKETR  254



>ref|XP_003548167.1| PREDICTED: uncharacterized protein LOC100790144 [Glycine max]
Length=239

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 78/131 (60%), Gaps = 2/131 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+V  +SA+ LKNVNWRHG   PYV++W D    L+T  D++G+T   WNE   +PL 
Sbjct  5    YEVEVKPLSARALKNVNWRHGPNLPYVVVWADRSYLLSTSVDENGNTDANWNETLTIPLP  64

Query  238  LPPQESL-LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKA-FQLRRPSGRPQ  411
              P E   L + + H+   E  K L+G   + L D+V D G   +++    L+RPSGRPQ
Sbjct  65   AKPLEDQNLFIHVVHAGSGEDTKSLIGKAWLRLVDIVNDFGIGERVRCTLSLKRPSGRPQ  124

Query  412  GKIRLKIAVRK  444
            GK  + + +R+
Sbjct  125  GKAEVSVTIRE  135



>ref|XP_010042015.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Eucalyptus 
grandis]
Length=358

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 10/93 (11%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPY--VILWIDPDRRLATKSDDSGSTKPVWNERFVVPL  234
            D+++TVVSAKHLKNVNWR+GDLKPY  V L  DP  RL+T+ DDSGST+PVWNE   +PL
Sbjct  8    DLEITVVSAKHLKNVNWRNGDLKPYAAVCLDHDPHLRLSTRPDDSGSTRPVWNETLTIPL  67

Query  235  TLPPQ--------ESLLAVEIFHSVPSETPKPL  309
            + P          ++ LAV++FHS PSETPKP 
Sbjct  68   SAPAAAAASSSPGDATLAVQVFHSRPSETPKPF  100



>gb|ACU21139.1| unknown [Glycine max]
Length=239

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 78/131 (60%), Gaps = 2/131 (2%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+ +V  +SA+ LKNVNWRHG   PYV++W D    L+T  D++G+T   WNE   +PL 
Sbjct  5    YEAEVKPLSARALKNVNWRHGPNLPYVVVWADRSYLLSTSVDENGNTDANWNETLTIPLP  64

Query  238  LPP-QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKA-FQLRRPSGRPQ  411
              P ++  L + + H+   E  K L+G   + L D+V D G   +++    L+RPSGRPQ
Sbjct  65   AKPLEDQNLFIHVVHAGSGEDTKSLIGKAWLRLVDIVNDFGIGERVRCTLSLKRPSGRPQ  124

Query  412  GKIRLKIAVRK  444
            GK  + + +R+
Sbjct  125  GKAEVSVTIRE  135



>gb|EAZ08028.1| hypothetical protein OsI_30293 [Oryza sativa Indica Group]
Length=137

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 77/115 (67%), Gaps = 6/115 (5%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA+ LKNVNWR+GDLKPY +LW+D   + +T+ D   +  P W+++  +P  
Sbjct  5    YEVEVTVSSARDLKNVNWRNGDLKPYAVLWVDDGAKCSTRVDLDNADNPNWDDKLTLP--  62

Query  238  LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLR  390
            LPP     ++LL +++ H+  +E  KPLVG+ R+PL+D++ D+G S     + +R
Sbjct  63   LPPSSRLDDALLYLDVVHANAAEGVKPLVGSARLPLRDVLDDAGCSEFKSKYIVR  117



>ref|XP_003549032.1| PREDICTED: uncharacterized protein LOC100805876 [Glycine max]
Length=256

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A  Y++++ + SA+ LKNVNWRHG  +PY ++W+DP  + +T+ D+ G T+  W++  ++
Sbjct  2    ASRYELELKLASARGLKNVNWRHGPNRPYAVVWVDPRNKCSTRVDEDGDTEATWDQTLLI  61

Query  229  PLTLPPQESL-LAVEIFHSVPSETPKPLVGTLRIPLKDLV--VDSGDSTQLKAFQLRRPS  399
            PL   P E+L L V+  H+   E  +PL+G  ++ L D++  V  G+S   +   L+RPS
Sbjct  62   PLPPEPLENLTLYVDAVHAGSEEDTEPLIGAAQLKLVDILDEVGVGESVN-RTLSLKRPS  120

Query  400  GRPQGKIRLKIAVRKI  447
            GRPQGK+ + + +R+ 
Sbjct  121  GRPQGKVDVNVVIREF  136



>ref|XP_006827559.1| hypothetical protein AMTR_s00009p00221820 [Amborella trichopoda]
 gb|ERM94975.1| hypothetical protein AMTR_s00009p00221820 [Amborella trichopoda]
Length=231

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 80/129 (62%), Gaps = 11/129 (9%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
             +++VTVVSAK L NVNWRHGD+KPYV  W+DP+ + +T+             +  +PL 
Sbjct  1    MELEVTVVSAKDLHNVNWRHGDIKPYVAAWVDPNLKSSTRV----------GYKLTLPLR  50

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRRPSGRPQG  414
              P++S L + + H       K L+G+  +PL++++ D+G D    K  +L+R SGR QG
Sbjct  51   DRPEDSTLRINVVHGSGEAETKQLIGSATLPLREVIEDAGFDHRFSKTLKLKRLSGRLQG  110

Query  415  KIRLKIAVR  441
            +I+++IA++
Sbjct  111  EIQVEIAIQ  119



>ref|XP_002444571.1| hypothetical protein SORBIDRAFT_07g023860 [Sorghum bicolor]
 gb|EES14066.1| hypothetical protein SORBIDRAFT_07g023860 [Sorghum bicolor]
Length=138

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 75/136 (55%), Gaps = 17/136 (13%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VTV SA +LKNVNWR+GDL+PY +LW+D   + +T+ D      PVW++R VVP+ 
Sbjct  5    YEVEVTVGSASNLKNVNWRNGDLRPYAVLWVDDGPKCSTRVDPDNGEDPVWDDRVVVPVP  64

Query  238  LPPQESLLAVEIFHSVPSETP---------KPLVGTLRIPLKDLVVDSGDSTQL------  372
             P   + L   + H                KPLVG+ R+PL+  V+D      +      
Sbjct  65   -PASAARLGDAVLHVDVVHAADADADADEVKPLVGSARLPLR-YVLDYAGGVGVGGPKVS  122

Query  373  KAFQLRRPSGRPQGKI  420
            +   L RPSGRP G++
Sbjct  123  RTLTLTRPSGRPLGQV  138



>gb|AGW45459.1| SRC2, partial [Reaumuria trigyna]
Length=81

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 6/78 (8%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y+V+VT+ SAK +KNVNWR+G  +PY ++W+DPDR+L+T+ D+ G T P W++R V P  
Sbjct  4    YEVEVTIRSAKDIKNVNWRYGPNRPYAVVWVDPDRKLSTQVDEEGDTSPKWDQRLVTP--  61

Query  238  LPP----QESLLAVEIFH  279
            LPP    ++S L ++I H
Sbjct  62   LPPNASIEDSTLYIDIVH  79



>gb|EMT02310.1| hypothetical protein F775_23210 [Aegilops tauschii]
Length=151

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 60/90 (67%), Gaps = 3/90 (3%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPL-  234
            Y+V+VTV SA+ LKNVNWR+GDL+PY +LW+D   + +++ D      PVW+E+  VPL 
Sbjct  5    YEVEVTVGSARDLKNVNWRNGDLQPYAVLWVDDGPKCSSRVDLDNGESPVWDEKLTVPLP  64

Query  235  --TLPPQESLLAVEIFHSVPSETPKPLVGT  318
              T   ++++L +++ H+      KPLVG+
Sbjct  65   PSTARLEDAVLRIDVVHANAGGGTKPLVGS  94



>ref|XP_001782642.1| predicted protein [Physcomitrella patens]
 gb|EDQ52545.1| predicted protein [Physcomitrella patens]
Length=274

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 72/139 (52%), Gaps = 14/139 (10%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL  240
            ++++T++SA+ LKNV    G + PY + WI P+ +++T     G  KP WN   V+ LT 
Sbjct  5    EIELTILSAQDLKNVKLSGGAMTPYAVAWIHPNYKVSTPEHGQGGVKPCWNS--VLRLTC  62

Query  241  PP---QESLLAVEIFHSVPSETPKPLVGTLRIPLKDL-------VVDSGDSTQLKAFQLR  390
                 Q S + +EI+H         LVGT+ + L D          +     +  ++Q+R
Sbjct  63   DENSFQNSRITIEIYHH--GSFSNKLVGTVTVSLSDFNSQRQASGSEGSSEKRFGSYQVR  120

Query  391  RPSGRPQGKIRLKIAVRKI  447
            RPSG+ QG + L + V K+
Sbjct  121  RPSGKYQGVLNLSVKVGKL  139



>gb|KJB26599.1| hypothetical protein B456_004G249500 [Gossypium raimondii]
Length=358

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 85/145 (59%), Gaps = 16/145 (11%)
 Frame = +1

Query  37   ARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE  216
            A P  +S  +++ +VSA+ L  V+    ++K Y ++W+ PD +L+T  D  G T P+WN+
Sbjct  5    APPSTRSRVLEINLVSAEDLTPVS---KNMKTYAVVWVKPDEKLSTGVDQKGGTDPIWND  61

Query  217  RFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL-----VVD--SGDST  366
            RF   +    L  +++ +AVEI+ +  +     LVG++ + + D+     V D  S DS 
Sbjct  62   RFTFKVDQKFLNSEDATIAVEIYAA--AWVKDALVGSVNVLINDIFHLRSVADAKSNDSA  119

Query  367  QLK-AFQLRRPSGRPQGKIRLKIAV  438
            +     Q+RRPSGRPQG +++++A+
Sbjct  120  RRTVTLQIRRPSGRPQGILKMEVAL  144



>ref|XP_006444911.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
 ref|XP_006491213.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58151.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
Length=254

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF---VVPL  234
            +++ ++SA+ LK+ + +   ++ Y ++WID   +L T+ D +G+  P+WNE+F   V P 
Sbjct  6    LEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVTPE  65

Query  235  TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST-QLKAFQLRRPSGRPQ  411
             L  + S ++VEI+ S        L+GT+R  + ++ +     T    AFQ+RRPSGR Q
Sbjct  66   FLSSETSAISVEIYAS--GYLRDYLIGTVRFLVSNISLSVATKTPSFTAFQIRRPSGRFQ  123

Query  412  G  414
            G
Sbjct  124  G  124



>gb|KDO86360.1| hypothetical protein CISIN_1g047341mg [Citrus sinensis]
Length=254

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF---VVPL  234
            +++ ++SA+ LK+ + +   ++ Y ++WID   +L T+ D +G+  P+WNE+F   V P 
Sbjct  6    LEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVTPE  65

Query  235  TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST-QLKAFQLRRPSGRPQ  411
             L  + S ++VEI+ S        L+GT+R  + ++ +     T    AFQ+RRPSGR Q
Sbjct  66   FLSSETSAISVEIYAS--GYLRDYLIGTVRFLVSNISLSVATKTPSFTAFQIRRPSGRFQ  123

Query  412  G  414
            G
Sbjct  124  G  124



>emb|CDP04279.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 74/135 (55%), Gaps = 9/135 (7%)
 Frame = +1

Query  46   PAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFV  225
            P   Y ++++++SA+ L  ++     ++ Y + WI P R+L T  D    T P+WNERF 
Sbjct  23   PPDFYVLNISLISAQDLAPIS---KSMRTYAVTWIHPSRKLTTSVDQQRHTNPLWNERFA  79

Query  226  VPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSG-DSTQLKAFQLRR  393
              +    L   ++ + VEI+    S     LVGT+R+ + DL+     + T+  A Q+RR
Sbjct  80   FRVDSEFLSSDQAAITVEIY--TVSWFRDLLVGTVRVLISDLITPCARNHTRYLALQIRR  137

Query  394  PSGRPQGKIRLKIAV  438
            PSG PQG + + +A+
Sbjct  138  PSGNPQGMLNMGVAL  152



>ref|XP_011077131.1| PREDICTED: uncharacterized protein LOC105161211 [Sesamum indicum]
Length=377

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 77/135 (57%), Gaps = 16/135 (12%)
 Frame = +1

Query  67   DVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF---VVPLT  237
            DV+++SA+ L  V      ++ Y + WI+P+R+L T++D  G T P WNE+F   V   +
Sbjct  35   DVSLISAQDLSPV---CKSMRTYAVAWINPNRKLTTRTDQQGHTHPTWNEKFSFRVDTKS  91

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-DSG-------DSTQLKAFQLRR  393
            L  + S + VEI+    S     LVGT+R+ + DL+   SG        ST+  A Q+RR
Sbjct  92   LISENSAMTVEIY--TVSWFRDVLVGTVRVLISDLLAPPSGIPLQNLPRSTRFIALQVRR  149

Query  394  PSGRPQGKIRLKIAV  438
            PSG PQG + + +++
Sbjct  150  PSGAPQGILNMGVSL  164



>ref|XP_003590980.1| hypothetical protein MTR_1g080360 [Medicago truncatula]
 gb|AES61231.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=375

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 77/129 (60%), Gaps = 9/129 (7%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L  V+     +K Y + W++P+R+L T++D  G   P WNE+FV  +   
Sbjct  11   LEINVISAQDLAPVS---KSIKAYAVAWLNPERKLTTQADPHGHNNPTWNEKFVFRVDDD  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDS-TQLKAFQLRRPSGRPQ  411
             L  +ES++ +EI+ S  +     L+GT+ + L +L+  +  S  +  A Q+RRPSGRPQ
Sbjct  68   FLLSEESVIMIEIYAS--AWLRDVLIGTVAVHLNNLLPRNRKSKIRFVALQVRRPSGRPQ  125

Query  412  GKIRLKIAV  438
            G + + + V
Sbjct  126  GILNIGVNV  134



>gb|KDP23730.1| hypothetical protein JCGZ_23563 [Jatropha curcas]
Length=375

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 79/130 (61%), Gaps = 10/130 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L  V+     ++ Y ++W+ P+R+L T+ D +G T P WNE+FV  +   
Sbjct  11   LEINVISAQDLATVS---KSMRTYAVVWVHPERKLTTRIDQNGHTNPQWNEKFVFRVDDA  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRP  408
             L  + S + +EI+ +      +  +G++R+ + +L   + ++++++  A Q+RRPSGRP
Sbjct  68   FLDSETSAIMIEIYAAAWLRDVQ--IGSVRVLVSNLFPSNNNNSKMRFVALQIRRPSGRP  125

Query  409  QGKIRLKIAV  438
            QG + + + +
Sbjct  126  QGILNMGVQL  135



>gb|KDO53064.1| hypothetical protein CISIN_1g035970mg, partial [Citrus sinensis]
Length=377

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 12/132 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++++VS   L  V+     +K Y + W+DP+R+L T+ D +G   P WNE+FV  +   
Sbjct  8    LEISIVSGHDLALVS---KSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFRVDDR  64

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV----DSGDSTQLKAFQLRRPSG  402
             L  + S + +EI+    +     L+G++R+ +  L      +S  ST+  A Q+RRPSG
Sbjct  65   FLTDETSAIMIEIY--AAAWLKDALIGSVRVLISHLFGTLTHNSSSSTRYVALQVRRPSG  122

Query  403  RPQGKIRLKIAV  438
            RPQG + L I +
Sbjct  123  RPQGILNLGITL  134



>ref|XP_006437469.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
 ref|XP_006484674.1| PREDICTED: haze protective factor 1-like [Citrus sinensis]
 gb|ESR50709.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
Length=393

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 12/132 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++++VS   L  V+     +K Y + W+DP+R+L T+ D +G   P WNE+FV  +   
Sbjct  8    LEISIVSGHDLALVS---KSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFRVDDR  64

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV----DSGDSTQLKAFQLRRPSG  402
             L  + S + +EI+    +     L+G++R+ +  L      +S  ST+  A Q+RRPSG
Sbjct  65   FLTDETSAIMIEIY--AAAWLKDALIGSVRVLISHLFGTLTHNSSSSTRYVALQVRRPSG  122

Query  403  RPQGKIRLKIAV  438
            RPQG + L I +
Sbjct  123  RPQGILNLGITL  134



>ref|XP_004239688.1| PREDICTED: putative uncharacterized protein DDB_G0267840 [Solanum 
lycopersicum]
Length=415

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 75/134 (56%), Gaps = 14/134 (10%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++T++SA+ L  ++     L+ Y + WI+P+R+ +TK D+ G   P WN++F   +   
Sbjct  34   LEITLISAQDLAPIS---KSLRTYALTWINPNRKRSTKIDNEGHNNPTWNDKFSFKVNEE  90

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV------VDSGDSTQLKAFQLRRP  396
             L  + S + VEI+    S     LVGT+ + L +L+       +S +  +  A Q+RRP
Sbjct  91   FLYSENSAVHVEIY--TVSWFRDVLVGTINVQLNNLINPYVNFQNSSNGKRFVALQIRRP  148

Query  397  SGRPQGKIRLKIAV  438
            SG PQG + + +A+
Sbjct  149  SGNPQGILNMGVAI  162



>ref|XP_007030351.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY10853.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=370

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = +1

Query  37   ARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE  216
            A PP  S  +++ ++SA+ L  V+    ++K Y + W+ PD +LAT  D +G T P WNE
Sbjct  2    APPPTHSRILEINLISAEDLAPVS---KNMKTYAVAWVQPDHKLATGIDQTGRTDPSWNE  58

Query  217  RFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL-----VVDSG---DS  363
            +F+  L    L  +++ + VEI+ +  +     L+G + + +KD+     + D+     +
Sbjct  59   KFMFRLDDKFLNSEDAAIVVEIYAA--AWVKDVLIGYVNVLIKDIFHLRSIADAKINYSA  116

Query  364  TQLKAFQLRRPSGRPQGKIRLKI  432
            T+    Q+RRPSGRPQG + +++
Sbjct  117  TRTVTLQIRRPSGRPQGILNMEV  139



>ref|XP_006345991.1| PREDICTED: uncharacterized protein LOC102591105, partial [Solanum 
tuberosum]
Length=373

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 77/138 (56%), Gaps = 14/138 (10%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
             S+ +++T++SA+ L  V+     L+ Y + WI+P+R+ +TK D+ G   P WN++F   
Sbjct  29   NSHILEITLISAQDLAPVS---KSLRTYALTWINPNRKRSTKVDNDGHNNPTWNDKFSFK  85

Query  232  LT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV------VDSGDSTQLKAFQ  384
            +    L  + S + VEI+    S     LVGT+ + L +L+       +S +  +  A Q
Sbjct  86   VNEEFLYSENSAVHVEIY--TVSWFRDVLVGTINVQLNNLINPCVNFQNSLNGKRFVALQ  143

Query  385  LRRPSGRPQGKIRLKIAV  438
            +RRPSG PQG + + +A+
Sbjct  144  IRRPSGNPQGILNMGVAI  161



>ref|XP_002965668.1| hypothetical protein SELMODRAFT_407234 [Selaginella moellendorffii]
 gb|EFJ33088.1| hypothetical protein SELMODRAFT_407234 [Selaginella moellendorffii]
Length=373

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLP  243
            ++VT++SA+ L++     G + PY + WIDP+ +  T    +  + P W+ +  +P    
Sbjct  27   LEVTIISAQGLRDTCI-FGRMSPYALAWIDPEVKYCTHVAHNAGSNPAWDHKMYIPRPGS  85

Query  244  PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIR  423
             +   L V+IF S  S T  P+VG+ +IPL D V+D G   Q  A QL+RPSGR  G + 
Sbjct  86   LRGVELCVQIF-SRGSGTNDPIVGSTKIPLGD-VIDGG--LQYMACQLQRPSGRIHGLLN  141

Query  424  LKI  432
            + +
Sbjct  142  ISV  144



>gb|KJB44809.1| hypothetical protein B456_007G274200 [Gossypium raimondii]
Length=369

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 77/143 (54%), Gaps = 18/143 (13%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A S  ++VT++SA+ L  V   +  +K Y I+W+ PDR+LAT  D +G T P WN++F  
Sbjct  2    AHSRILEVTLLSAEDLLEV---YKTMKTYAIVWVQPDRKLATGIDQTGGTHPAWNDKFSF  58

Query  229  ----PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---------VDSGDSTQ  369
                      +++ + VEI+    +     LVG + + + D+          +++  + +
Sbjct  59   RVDDKFLSSEEDAKIFVEIY--AAAWVKDALVGCVNVNINDIFHLRSVTDSKINNNSTAR  116

Query  370  LKAFQLRRPSGRPQGKIRLKIAV  438
                Q+RRPSGRPQG + +++++
Sbjct  117  TVTLQVRRPSGRPQGILNMEVSL  139



>gb|KHN31488.1| hypothetical protein glysoja_035595, partial [Glycine soja]
Length=241

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L  V+     ++ Y + W+ P+R+LAT+ D  G T P WNE+FV  +   
Sbjct  2    LEINVISAQDLAQVS---KSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDDS  58

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-VDSGDSTQLKAFQLRRPSGRPQ  411
             L    S++ +EI+    +     L+GT+ + L +L+  +     +  A Q+RRPSGRPQ
Sbjct  59   FLNSDNSVIMIEIYSH--AWLRHVLIGTVAVQLTNLLPPNRKPKLRFVALQIRRPSGRPQ  116

Query  412  GKIRLKI  432
            G + + +
Sbjct  117  GILNIGV  123



>ref|XP_009792812.1| PREDICTED: uncharacterized protein LOC104239795 [Nicotiana sylvestris]
Length=404

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 78/139 (56%), Gaps = 12/139 (9%)
 Frame = +1

Query  43   PPAKSYD----VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVW  210
            PP+ S +    +++T++SA+ L  V      L+ Y + W++P+R+  T+ D+ G + P W
Sbjct  31   PPSASNNTNHILEITLISAQDLSPV---CKSLRTYALTWVNPNRKRTTRVDNQGHSNPTW  87

Query  211  NERFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF  381
            N++F   +    L  + S + VEI+    S     LVGT+++ L +L+     S +  A 
Sbjct  88   NDKFSFRVDDEFLNSESSAVHVEIY--TVSWFRDILVGTVKVLLNNLINPFDRSKKFVAL  145

Query  382  QLRRPSGRPQGKIRLKIAV  438
            Q+RRPSG PQG + L +A+
Sbjct  146  QIRRPSGNPQGILNLGVAL  164



>ref|XP_002976843.1| hypothetical protein SELMODRAFT_443351 [Selaginella moellendorffii]
 gb|EFJ21953.1| hypothetical protein SELMODRAFT_443351 [Selaginella moellendorffii]
Length=301

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 12/137 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP---L  234
            V++ ++SA+ LK ++   G    Y ++WI P ++  T  D  G+  PVWN++ V+     
Sbjct  6    VEINIISAEGLK-LSPSFGKPHTYAVVWIHPSKKFYTHVDQEGAKNPVWNQKLVISADTY  64

Query  235  TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL------VVDSGDSTQLKAFQLRRP  396
            +L        +EIFH       KP +GT+ +P K+L        ++    Q  AF++RRP
Sbjct  65   SLEQGSGKFTIEIFHRGHIHD-KP-IGTVEVPFKELPHEARFNRETPSEIQYMAFEIRRP  122

Query  397  SGRPQGKIRLKIAVRKI  447
            SGR +G + L I +R++
Sbjct  123  SGRMKGVLNLSIRLREV  139



>ref|XP_006842598.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
 gb|ERN04273.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
Length=355

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 74/134 (55%), Gaps = 12/134 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ ++SA+ +         + PY + W+  D +L+T++D  G T+P WN++F+  +T  
Sbjct  23   LELNIISAQDIHPATQ---AMHPYAVAWVHRDHKLSTRTDPQGHTEPTWNDKFIFRVTET  79

Query  238  -LPPQESLLAVEIFHSVPSET-PKPLVGTLRIPLKDLVVDSGDS-----TQLKAFQLRRP  396
             L    + + ++IF   P    P PL+GT+R+ + +L+     +      +  A Q+RRP
Sbjct  80   FLRSDTAAVTIQIFTHRPCCVFPDPLIGTVRVLVGNLLSAQSHAPGYSGMRFTALQVRRP  139

Query  397  SGRPQGKIRLKIAV  438
            SGRPQG + L I +
Sbjct  140  SGRPQGILNLGITL  153



>ref|XP_009625035.1| PREDICTED: uncharacterized protein LOC104115988 [Nicotiana tomentosiformis]
Length=406

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 73/128 (57%), Gaps = 8/128 (6%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++T++SA+ L  V      L+ Y + W++P+R+  T+ D+ G + P WN++F   +   
Sbjct  44   LEITLISAQDLSPV---CKSLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDE  100

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG  414
             L  + S + VEI+    S     LVGT+++ L +L+     S +  A Q+RRPSG PQG
Sbjct  101  FLNSESSAVHVEIY--TVSWFRDILVGTVKVLLNNLINPYDRSKKFVALQIRRPSGNPQG  158

Query  415  KIRLKIAV  438
             + L +A+
Sbjct  159  ILNLGVAL  166



>gb|KEH24577.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=389

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 76/134 (57%), Gaps = 14/134 (10%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ ++SA+ L  V      +K Y + W+ P+R+LAT+ D  G T P WNE+FV  +   
Sbjct  13   LEINIISAQDLSGV---AKSVKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVDNE  69

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL---VVDSGD---STQLKAFQLRRP  396
             L  + S++ +EI++S  +     L+GT+ + + +L   V  SG+     +    Q+RRP
Sbjct  70   FLNSESSVIMIEIYNS--AWLRDILIGTVVVLVNNLLPTVTLSGNRKPKLRFVGLQIRRP  127

Query  397  SGRPQGKIRLKIAV  438
            SGRPQG + + + +
Sbjct  128  SGRPQGILNIGVTL  141



>ref|XP_010674263.1| PREDICTED: uncharacterized protein LOC104890461 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 76/129 (59%), Gaps = 11/129 (9%)
 Frame = +1

Query  70   VTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT---L  240
            + ++SA+ L  V+     +  YV+ W++P+R+L T+ D  G+  P WN++FV  +T   L
Sbjct  10   INIISARDLAPVS---KSMNTYVVGWVNPNRKLTTRVDHKGNNCPEWNDKFVFRVTPKFL  66

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGDSTQLKAFQLRRPSGRPQ  411
                S++ +EI+    +     L+G++R+ + +L+     +G + +  A Q+RRPSGRPQ
Sbjct  67   NSDSSIVDIEIYSQ--AWLRDALIGSVRVSIANLIPTGYQNGSTRRSVALQIRRPSGRPQ  124

Query  412  GKIRLKIAV  438
            G + + ++V
Sbjct  125  GILNVVVSV  133



>ref|XP_006358324.1| PREDICTED: uncharacterized protein LOC102592049 [Solanum tuberosum]
Length=353

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 13/133 (10%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++T++SA+ L  V      L+ Y + W++P+R+  T+ D+ G   P WN++F   +   
Sbjct  38   LEITLISAQDLSPV---CKSLRTYALTWVNPNRKRTTRVDNHGHNNPNWNDKFSFRVDDE  94

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-----VDSGDSTQLKAFQLRRPS  399
             L    S + VEI+    S     LVGT+++ L +LV       S  S +  A Q+RRPS
Sbjct  95   FLSSDSSAIHVEIY--TVSWFRDILVGTVKVILNNLVNPFENTSSNQSKKFVALQIRRPS  152

Query  400  GRPQGKIRLKIAV  438
            G PQG + + +AV
Sbjct  153  GNPQGILNMGVAV  165



>ref|XP_010038446.1| PREDICTED: uncharacterized protein LOC104426980 [Eucalyptus grandis]
Length=228

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 75/133 (56%), Gaps = 4/133 (3%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPL--T  237
            V+  ++SA  L+N+N   G L P+  +W+       T +D  G + P WN   ++PL   
Sbjct  8    VETKLISADGLENLNQGGGRLLPFAAVWLHYSCIGFTPADPFGGSSPFWNHTVLLPLPSG  67

Query  238  LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVD--SGDSTQLKAFQLRRPSGRPQ  411
            +P ++++L V + H+   +    L+G  ++ L+D++ +  SG+       QL +PS RPQ
Sbjct  68   MPIEDAMLQVLVLHAGSEDGTGLLIGWAQLRLRDVLEEDVSGERAYRWTLQLWQPSSRPQ  127

Query  412  GKIRLKIAVRKIQ  450
            G + +++AVR+++
Sbjct  128  GMVDIELAVREMR  140



>ref|XP_010667096.1| PREDICTED: uncharacterized protein LOC104884184 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 68/133 (51%), Gaps = 11/133 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ ++S + +  V+     +K Y + W+ PDR+L T+ D +G T P WN++FV  +   
Sbjct  7    LEINIISGQDIHKVSR---SMKTYAVAWVHPDRKLTTRVDSNGGTNPTWNDKFVFRVDNR  63

Query  238  -LPPQESLLAVEI-----FHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPS  399
             L    S + +EI     F  V   T + LVG L  P       +    +  A Q+RRPS
Sbjct  64   FLQSDTSAIMIEIYALHWFRDVHVGTVRVLVGNLIPPQTRSFNQNHIGMRFVALQVRRPS  123

Query  400  GRPQGKIRLKIAV  438
            GRPQG + + + V
Sbjct  124  GRPQGILNVGVTV  136



>ref|XP_002971671.1| hypothetical protein SELMODRAFT_412188 [Selaginella moellendorffii]
 gb|EFJ27420.1| hypothetical protein SELMODRAFT_412188 [Selaginella moellendorffii]
Length=373

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLP  243
            ++VT++SA+ L++     G + PY + WIDP+ +  T    +  + P W+ +  +P    
Sbjct  27   LEVTIISAQGLRDTCI-FGRMSPYALAWIDPEVKYCTHVAHNAGSNPAWDHKMYIPRPGS  85

Query  244  PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIR  423
             +   L V+IF S  S T  P+VG+ +IPL D V D G   Q  A QL+RPSGR  G + 
Sbjct  86   LRGVELCVQIF-SRGSGTNDPIVGSTKIPLGD-VSDGG--LQYMACQLQRPSGRIHGLLN  141

Query  424  LKI  432
            + +
Sbjct  142  ISV  144



>ref|XP_011069440.1| PREDICTED: uncharacterized protein LOC105155266 [Sesamum indicum]
Length=404

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 79/137 (58%), Gaps = 15/137 (11%)
 Frame = +1

Query  58   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            Y ++++++SA+ L  ++     ++ Y + WI+P+++  T++D  G+  P+WN++FV  LT
Sbjct  33   YLLEISLISAQDLAPIS---KSMQTYAMAWINPNKKHTTRTDQQGNKNPMWNDKFVFRLT  89

Query  238  ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-------DSGDSTQLKAFQL  387
               L  + + + VEI+    S     LVG +R+ + DL+         +  +T+  A Q+
Sbjct  90   NELLHSETATVTVEIY--TVSWFRDVLVGMVRVLISDLITPLIRTLQTNTKNTRFVALQV  147

Query  388  RRPSGRPQGKIRLKIAV  438
            RRPSG PQG + + I++
Sbjct  148  RRPSGTPQGILNMGISL  164



>gb|AFK13837.1| C2 domain-containing protein SRC2 [Beta vulgaris subsp. vulgaris]
Length=331

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 75/129 (58%), Gaps = 11/129 (9%)
 Frame = +1

Query  70   VTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT---L  240
            + ++SA+ L  V+     +  YV+ W++P R+L T+ D  G+  P WN++FV  +T   L
Sbjct  10   INIISARDLAPVS---KSMNTYVVGWVNPYRKLTTRVDHKGNNCPEWNDKFVFRVTPKFL  66

Query  241  PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGDSTQLKAFQLRRPSGRPQ  411
                S++ +EI+    +     L+G++R+ + +L+     +G + +  A Q+RRPSGRPQ
Sbjct  67   NSDSSIVDIEIYSQ--AWLRDALIGSVRVSIANLIPTGYQNGSTRRSVALQIRRPSGRPQ  124

Query  412  GKIRLKIAV  438
            G + + ++V
Sbjct  125  GILNVVVSV  133



>ref|XP_004304780.1| PREDICTED: uncharacterized protein LOC101296310 [Fragaria vesca 
subsp. vesca]
Length=457

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 82/150 (55%), Gaps = 14/150 (9%)
 Frame = +1

Query  10   H*TVMATAGA--RPPAKSYD--VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATK  177
            H +V ATA A  +PP  S    +++ ++SA+ L   +     ++ + + W++P R+L T+
Sbjct  20   HSSVSATATAMPKPPHMSSFQLLEINLISAQDLTAAS---KSMRTFAVAWVNPKRKLTTR  76

Query  178  SDDSGSTKPVWNERFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV  348
             D +G T P WNE+FV  +    L    S + +EI+ S  +     LVGT  I + +L  
Sbjct  77   VDQNGHTNPTWNEKFVFRVGEDFLKDDTSKIMIEIYAS--AWLRDVLVGTAAIVVSNLQN  134

Query  349  DSGDSTQLKAFQLRRPSGRPQGKIRLKIAV  438
            +S    +  A QLRRPSGRPQG + + + +
Sbjct  135  NS--KMRFVAIQLRRPSGRPQGILNVGLGL  162



>ref|XP_003535375.1| PREDICTED: uncharacterized protein LOC100795448 [Glycine max]
Length=373

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 76/130 (58%), Gaps = 12/130 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ ++SA+ L  V+     +K Y + W++P+R+L T+ D +G   P WNE+FV  +   
Sbjct  11   LELNIISAQDLAPVS---KSIKAYAVAWLNPERKLTTQIDPNGQNNPTWNEKFVFRVDDD  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK----AFQLRRPSG  402
             L   ESL+ +EI+ S  +     L+GT+ +   +L+  S ++ + K    A Q+RRPSG
Sbjct  68   FLTSDESLIIIEIYAS--AWLRDILIGTVTVLASNLLPRSINTRKSKIRFVALQVRRPSG  125

Query  403  RPQGKIRLKI  432
            RPQG + + +
Sbjct  126  RPQGILNIGV  135



>ref|XP_009795461.1| PREDICTED: uncharacterized protein LOC104242159 [Nicotiana sylvestris]
Length=395

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 81/140 (58%), Gaps = 13/140 (9%)
 Frame = +1

Query  43   PPAKSYD--VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE  216
            P + +Y+  ++++++SA+ L  V+     L+ Y + WI+P+++ +T+ D+ G   P WN+
Sbjct  29   PSSSNYNHILEISLISAQDLAPVS---KSLRTYALAWINPNKKRSTRIDNEGHNNPTWND  85

Query  217  RFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGDSTQLKA  378
            +F   +    L  + S + VEI+    S     LVGT+ + L +L+   +++ +  +  A
Sbjct  86   KFSFKVNDEFLYSETSAVHVEIY--TVSWFRDVLVGTVHVLLNNLINPFINNSNGKRFVA  143

Query  379  FQLRRPSGRPQGKIRLKIAV  438
             Q+RRPSG PQG + + +++
Sbjct  144  LQIRRPSGNPQGILNMGVSL  163



>ref|XP_006577748.1| PREDICTED: uncharacterized protein LOC102667983 [Glycine max]
Length=373

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L  V+     ++ Y + W+ P+R+LAT+ D  G T P WNE+FV  +   
Sbjct  11   LEINVISAQDLAQVS---KSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDDS  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-VDSGDSTQLKAFQLRRPSGRPQ  411
             L    S++ +EI+    +     L+GT+ + L +L+  +     +  A Q+RRPSGRPQ
Sbjct  68   FLNSDNSVIMIEIYSH--AWLRHVLIGTVAVQLTNLLPPNRKPKLRFVALQIRRPSGRPQ  125

Query  412  GKIRLKI  432
            G + + +
Sbjct  126  GILNIGV  132



>ref|XP_010102203.1| hypothetical protein L484_024484 [Morus notabilis]
 gb|EXB93146.1| hypothetical protein L484_024484 [Morus notabilis]
Length=377

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 73/136 (54%), Gaps = 15/136 (11%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ ++SA+ L  V+     +K + + WID DR+L T++D +G   P WNE+F   +   
Sbjct  12   LELNLLSARDLATVS---KSMKTFAVAWIDQDRKLETRNDQTGQNNPAWNEKFAFRVDDD  68

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAF--------QLR  390
             L  + S + +EI  ++       LVGT+ + +  L   S  S Q ++F        Q+R
Sbjct  69   FLVSESSTITIEI-RALTRRGNVVLVGTVSVLVASLFPRSSTSFQKRSFSKMRFLTLQIR  127

Query  391  RPSGRPQGKIRLKIAV  438
            RP GRPQG + + +A+
Sbjct  128  RPCGRPQGVLDVGVAL  143



>ref|XP_011077059.1| PREDICTED: uncharacterized protein LOC105161156 [Sesamum indicum]
Length=397

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 76/133 (57%), Gaps = 14/133 (11%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ ++SA+ L +V+    +L+ Y   WI+P+R+L T+ D+ G   P WN++F+  +   
Sbjct  9    LELAIISAQDLASVSR---NLRTYATTWINPNRKLKTRVDNQGLNNPTWNDKFIFRVDDK  65

Query  238  -LPPQESLLAVEIF-HSVPSETPKPLVGTLRIPLKDL----VVDSGDSTQLKAFQLRRPS  399
             L    S + +EI+      +TP   VG++ + + +L    V   G S +  A Q+RRPS
Sbjct  66   FLNSATSSVMIEIYAQGWLRDTP---VGSVSVLISNLIPPSVRQEGSSRRFVALQIRRPS  122

Query  400  GRPQGKIRLKIAV  438
            GRPQG + + +++
Sbjct  123  GRPQGILNMGVSL  135



>ref|XP_003556915.1| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]
Length=449

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 17/137 (12%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L  V      ++ Y I WIDPDR+L+T+ D  G T P WN++FV  +   
Sbjct  11   LELNVISAQDLAPVGR---SMRTYAIAWIDPDRKLSTRVDSQGGTNPTWNDKFVFRVDED  67

Query  238  -LPPQESLLAVEI-----FHSVPSETPKPLVGTL----RIPLKDLVVDSGDSTQLKAFQL  387
             L  +ES++ ++I     F  +   + + L G L      P K+    +G   Q    Q+
Sbjct  68   FLYDEESVITIDIYALHWFRDIHVGSAQVLSGDLFPPPTQPQKNTYKSTG--MQFMGLQV  125

Query  388  RRPSGRPQGKIRLKIAV  438
            +RPSGRP+G + +  A+
Sbjct  126  QRPSGRPKGILNIGAAI  142



>ref|XP_007132356.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
 gb|ESW04350.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
Length=385

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 73/129 (57%), Gaps = 11/129 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            ++V ++SA+ L  V+     +K Y + W+DP+R+L T+ D  G   P WNE+FV  +   
Sbjct  11   LEVNIISAQDLAPVS---KSIKAYAVAWLDPERKLTTQIDPDGHNNPTWNEKFVFRIDED  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGDSTQLKAFQLRRPSGR  405
             L   +S++ +EI+ S  +     LVGT+ + L +L+   ++     +  A Q+RRPSG 
Sbjct  68   FLYADDSVVMIEIYAS--TWLRDILVGTVGVLLSNLLPRSINRTSKIRFIALQVRRPSGH  125

Query  406  PQGKIRLKI  432
            PQG + + +
Sbjct  126  PQGILNIGV  134



>ref|XP_002521996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40400.1| conserved hypothetical protein [Ricinus communis]
Length=380

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 75/131 (57%), Gaps = 11/131 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L  V+     ++ Y ++W+ P+R+L T+ D +G T P WNE+FV  +   
Sbjct  11   LEINVISAQDLAPVS---KSMRTYAVVWVHPERKLTTRVDQNGHTNPQWNEKFVFRVDDT  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGDSTQLKAFQLRRPSGR  405
             L  + S + +EI+ +      +  +G++R+ + +L     ++    +  A Q+RRPSGR
Sbjct  68   FLNSETSSIMIEIYAAAWLRDVQ--IGSVRVLISNLFPSPTNNNSKMRFVALQIRRPSGR  125

Query  406  PQGKIRLKIAV  438
            PQG + + + +
Sbjct  126  PQGILNMGVQL  136



>emb|CDX92066.1| BnaC03g33680D [Brassica napus]
Length=383

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 22/142 (15%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPL-  234
            +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D +  + P+WNE+FV  + 
Sbjct  11   LEINLISAQDLSLVS---KNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVN  67

Query  235  --TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV------------DSGDSTQL  372
              TL    S + +EI+ +  S+    LVGT+ + L DL                 ++ +L
Sbjct  68   DKTLQADVSAIVIEIYAAAWSK--DALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRL  125

Query  373  KAFQLRRPSGRPQGKIRLKIAV  438
               Q+RRPSGR QG +RL +A+
Sbjct  126  VTLQIRRPSGRLQGFLRLGVAL  147



>gb|KJB46046.1| hypothetical protein B456_007G345600 [Gossypium raimondii]
Length=291

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 73/131 (56%), Gaps = 7/131 (5%)
 Frame = +1

Query  43   PPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF  222
            PP  S  +++ ++SA+ L + +    ++K Y ++W+  + +  TK D SG T P WNE+F
Sbjct  5    PPTPSRLLEINLISAQDLFSAS---NNMKTYAVVWVQQENKCTTKVDQSGGTDPTWNEKF  61

Query  223  VVPLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG  402
            +    +   +++++VE++ +   +     +G + +PL D+       T+  A  + RPSG
Sbjct  62   M--FKVDKDDAVISVEVYAAAWDK--DATIGYVNVPLNDIFDSPSAVTRTLALPISRPSG  117

Query  403  RPQGKIRLKIA  435
            R QG + ++++
Sbjct  118  RSQGILNMEVS  128



>ref|XP_004152866.1| PREDICTED: uncharacterized protein LOC101218582 [Cucumis sativus]
 gb|KGN61292.1| hypothetical protein Csa_2G076000 [Cucumis sativus]
Length=360

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 75/130 (58%), Gaps = 10/130 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            ++++++SA  L +V+     ++ + + WI+PDR+L T+ D  G T P WNE+FV  +   
Sbjct  9    LELSLLSANDLASVS---KTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDDD  65

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRP  408
             L    S + +EI+ S  +     LVGT+   + +L+  S   + ++    Q+RRPSGRP
Sbjct  66   LLEDPTSTVTIEIYSS--ALLRDILVGTVTEVVSNLIPQSSSKSNMRFLTLQVRRPSGRP  123

Query  409  QGKIRLKIAV  438
            +G +++ + +
Sbjct  124  KGTVKVGVTL  133



>ref|XP_009134757.1| PREDICTED: uncharacterized protein LOC103859027 [Brassica rapa]
Length=397

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 22/142 (15%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPL-  234
            +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D +  + P+WNE+FV  + 
Sbjct  11   LEINLISAQDLSLVS---KNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVN  67

Query  235  --TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV------------DSGDSTQL  372
              TL    S + +EI+ +  S+    LVGT+ + L DL                 ++ +L
Sbjct  68   DKTLQADVSAIVIEIYAAAWSK--DALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRL  125

Query  373  KAFQLRRPSGRPQGKIRLKIAV  438
               Q+RRPSGR QG +RL +A+
Sbjct  126  VTLQIRRPSGRLQGFLRLGVAL  147



>ref|XP_008441789.1| PREDICTED: uncharacterized protein LOC103485843 [Cucumis melo]
Length=361

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 79/138 (57%), Gaps = 12/138 (9%)
 Frame = +1

Query  40   RPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNER  219
            RPP +   ++++++SA  L +V+     ++ + + WI+PDR+L T+ D  G T P WNE+
Sbjct  3    RPPFQV--LELSLLSANDLASVS---KTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEK  57

Query  220  FVVPL---TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQ  384
            FV  +    L    S + +EI+ S  +     LVGT+   + +L+  S   + ++    Q
Sbjct  58   FVFKVDDDLLEDPTSTVTIEIYSS--ALLRDILVGTVTEVVSNLIPQSSPKSNMRFLTLQ  115

Query  385  LRRPSGRPQGKIRLKIAV  438
            +RRPSGRP+G +++ + +
Sbjct  116  VRRPSGRPKGTVKVGVTL  133



>ref|XP_006842901.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
 gb|ERN04576.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
Length=404

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            ++V ++SA+ LK +   +  +  Y + W+DP ++L T+ D  G   P WN++F+  +   
Sbjct  19   LEVNLISAQDLKPIIHSNKTIHTYAVAWVDPRKKLRTRVDTLGRENPTWNDKFIFTVDQS  78

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG  414
             L  + S +++EIF+         L GT+R  + DL+   G      A Q+RRPSGR  G
Sbjct  79   FLSGESSAISIEIFY--VRYLRDVLAGTVRALVADLM--KGGGLSFAALQVRRPSGRFHG  134

Query  415  KIRLKIAV  438
             + L + V
Sbjct  135  VLNLGLIV  142



>emb|CDP04278.1| unnamed protein product [Coffea canephora]
Length=377

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 80/134 (60%), Gaps = 15/134 (11%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L  V+    +L+ Y + W++P+R+L T+ D  G T P WN++FV  +   
Sbjct  9    LELNVISAQDLAPVSQ---NLRTYAVAWMNPERKLRTRVDQQGKTNPTWNDKFVFRVDEK  65

Query  238  -LPPQESLLAVEIFH-SVPSETPKPLVGTLRIPLKDLV---VDSGDSTQLK--AFQLRRP  396
             L  + S + +E++      +TP   VG++R+ + +L+   V   +++Q +  A Q+RRP
Sbjct  66   FLDSETSSVMIEVYAIGWLRDTP---VGSVRVLISNLIPQNVRKTNNSQRRFVALQIRRP  122

Query  397  SGRPQGKIRLKIAV  438
            SGRPQG + + + +
Sbjct  123  SGRPQGILNMGVTL  136



>emb|CDX74193.1| BnaA03g28540D [Brassica napus]
Length=387

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 22/142 (15%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPL-  234
            +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D +  + P+WNE+FV  + 
Sbjct  11   LEINLISAQDLSLVS---KNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVN  67

Query  235  --TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV------------DSGDSTQL  372
              TL    S + +EI+ +  S+    LVGT+ + L DL                 ++ +L
Sbjct  68   DKTLQADVSAIVIEIYAAAWSK--DALVGTVNVLLSDLFAPWSGFGDGDEGGGGNNNMRL  125

Query  373  KAFQLRRPSGRPQGKIRLKIAV  438
               Q+RRPSGR QG +RL +A+
Sbjct  126  VTLQIRRPSGRLQGFLRLGVAL  147



>ref|XP_004155136.1| PREDICTED: uncharacterized protein LOC101227028 [Cucumis sativus]
Length=360

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 75/130 (58%), Gaps = 10/130 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            ++++++SA  L +V+     ++ + + WI+PDR+L T+ D  G T P WNE+FV  +   
Sbjct  9    LELSLLSANDLASVS---KTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDDD  65

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRP  408
             L    S + +EI+ S  +     L+GT+   + +L+  S   + ++    Q+RRPSGRP
Sbjct  66   LLEDPTSTVTIEIYSS--ALLRDILIGTVTEVVSNLIPQSSSKSNMRFLTLQVRRPSGRP  123

Query  409  QGKIRLKIAV  438
            +G +++ + +
Sbjct  124  KGTVKVGVTL  133



>ref|XP_004495587.1| PREDICTED: uncharacterized protein LOC101488962 [Cicer arietinum]
Length=363

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 71/129 (55%), Gaps = 11/129 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ ++SA+ L  V+     +K Y + W+DP R+L T+ D      P WNE+FV  +   
Sbjct  11   LEINIISAQDLSPVS---KSIKAYAVAWLDPQRKLTTQIDPHAHNNPTWNEKFVFRVDDD  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL---VVDSGDSTQLKAFQLRRPSGR  405
             L  ++S + +EI+ S  +     L+GT+ + L +L   + +     +  A Q+RRPSGR
Sbjct  68   FLQSEDSAIVIEIYSS--AWLRDILIGTVAVNLNNLLPRLYNRKSKIRFVALQVRRPSGR  125

Query  406  PQGKIRLKI  432
            PQG + + +
Sbjct  126  PQGILNIGV  134



>ref|XP_004494967.1| PREDICTED: uncharacterized protein LOC101508328 [Cicer arietinum]
Length=373

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 78/134 (58%), Gaps = 14/134 (10%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            ++++++SA+ L  V      +K Y + W+ P+R+LAT+ D  G T P WNE+FV  +   
Sbjct  13   LEISIISAQDLPPV---AKSIKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVDDE  69

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGD---STQLKAFQLRRP  396
             L  + S++ ++I++S  +     L+GT+ + + +L+     +G+     +  A Q+R+P
Sbjct  70   FLNSENSVIMIDIYNS--TWIRDVLIGTVGVLVGNLLPPGTRTGNRKPKLRFVALQIRKP  127

Query  397  SGRPQGKIRLKIAV  438
            SGRPQG + + + V
Sbjct  128  SGRPQGILNIGVTV  141



>ref|XP_007205372.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
 gb|EMJ06571.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
Length=375

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 76/138 (55%), Gaps = 12/138 (9%)
 Frame = +1

Query  40   RPP-AKSYDV-DVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWN  213
            RPP A S+ + ++ ++SA+ L   +     ++ + + W++P R+L T+ D +G T P WN
Sbjct  3    RPPLASSFQLLEINLISAQDLYPAS---KSMRTFAVAWVNPQRKLTTRVDQNGHTNPTWN  59

Query  214  ERFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQ  384
            E+FV  +    L    S + +EI+ S  +     L+GT  + + +L   S    +  A Q
Sbjct  60   EKFVFRVDDEFLKDDTSKIMIEIYAS--AWLRDVLIGTAAVVVNNLQNKS--KMRFMAIQ  115

Query  385  LRRPSGRPQGKIRLKIAV  438
            LRRPSGRPQG + + + +
Sbjct  116  LRRPSGRPQGILNIGLGL  133



>ref|XP_002319115.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
 gb|EEE95038.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
Length=383

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 75/130 (58%), Gaps = 10/130 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+S + L  V+     ++ Y I+W+ P R+L+TK D +G T P WNE+FV  +   
Sbjct  11   LEINVISGQDLAPVS---KSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDDT  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRP  408
             +  + S + +E++ +      +  +G++ + + +L     ++ +++  A Q+RRPSGRP
Sbjct  68   FINAENSSIMIEVYAAAWLRDVQ--IGSVNVLISNLFPSHNNNNKMRFVALQVRRPSGRP  125

Query  409  QGKIRLKIAV  438
            QG + L + +
Sbjct  126  QGILNLGVQL  135



>ref|XP_008218351.1| PREDICTED: uncharacterized protein LOC103318712 [Prunus mume]
Length=417

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 76/138 (55%), Gaps = 12/138 (9%)
 Frame = +1

Query  40   RPP-AKSYDV-DVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWN  213
            RPP A S+ + ++ ++SA+ L   +     ++ + + W++P R+L T+ D +G T P WN
Sbjct  3    RPPLASSFQLLEINLISAQDLYPAS---KSMRTFAVAWVNPKRKLTTRVDQNGHTNPTWN  59

Query  214  ERFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQ  384
            E+FV  +    L    S + +EI+ S  +     L+GT  + + +L   S    +  A Q
Sbjct  60   EKFVFRVDDEFLKDDTSKIMIEIYAS--AWLRDVLIGTAAVVVNNLQNKS--KMRFMAIQ  115

Query  385  LRRPSGRPQGKIRLKIAV  438
            LRRPSGRPQG + + + +
Sbjct  116  LRRPSGRPQGILNIGLGL  133



>ref|XP_002316231.2| hypothetical protein POPTR_0010s19990g, partial [Populus trichocarpa]
 gb|EEF02402.2| hypothetical protein POPTR_0010s19990g, partial [Populus trichocarpa]
Length=191

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  298  PKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIRLKIAVRK  444
            PKPLVGTLR+ LKDL  D  DST++++F+L RPSGRPQGKIR+K+ VR+
Sbjct  5    PKPLVGTLRVALKDLP-DPDDSTRIRSFELTRPSGRPQGKIRIKLGVRE  52



>ref|XP_011038591.1| PREDICTED: uncharacterized protein LOC105135426 [Populus euphratica]
Length=367

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 74/130 (57%), Gaps = 10/130 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV---PL  234
            +++ V+S + L  V+     ++ Y I+W+ P R+L+TK D +G T P WNE+FV     +
Sbjct  11   LEINVISGQDLAPVS---KSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDEI  67

Query  235  TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRP  408
             +  + S + +E++ +      +  +G++ + + +L     ++ ++   A Q+RRPSGRP
Sbjct  68   FINAENSSIMIEVYAAAWLRDVQ--IGSVNVLISNLFPSHNNNNKMHFVALQVRRPSGRP  125

Query  409  QGKIRLKIAV  438
            QG + L + +
Sbjct  126  QGILNLGVQL  135



>ref|XP_007051663.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOX95820.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=266

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 71/137 (52%), Gaps = 10/137 (7%)
 Frame = +1

Query  52   KSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
             +Y +++T++SA+ LK  + +   ++ Y + WID   +L T  D  G   P WN++F+  
Sbjct  3    NNYVLEITLISAQGLKEPSGKLRRMQTYALAWIDSSVKLRTCVDRVGGENPTWNDKFLFK  62

Query  232  LT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-----VDSGDSTQLKAFQL  387
            ++   L  + S ++VEIF          LVGT+R  + + +      ++  +    A Q+
Sbjct  63   VSSEFLSSETSGISVEIF--AVGVLRDSLVGTVRFLVSNFLPSGSAFNAAKTHSFNAVQI  120

Query  388  RRPSGRPQGKIRLKIAV  438
            RRPSGR QG + +   V
Sbjct  121  RRPSGRFQGVLNIGATV  137



>ref|XP_002970540.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
 gb|EFJ28670.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
Length=270

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 70/128 (55%), Gaps = 7/128 (5%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            ++VT +SA+ LK+V    G ++ YV+ W+DP R+ +T         P WNE+ ++ +   
Sbjct  8    LEVTPISAEDLKDVKLV-GKMQTYVVAWVDPSRKASTNLSQLPGKNPRWNEKLMLSVEDQ  66

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG  414
             L    + L +EI+H    E+   +VG   IPL+++         L +F++RRPSGR QG
Sbjct  67   LLQQPGAFLVLEIYHRGFLES--TIVGRANIPLQEISAKGSGDAPL-SFKVRRPSGRLQG  123

Query  415  KIRLKIAV  438
             I + + V
Sbjct  124  TIHVSVKV  131



>ref|XP_006297897.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
 gb|EOA30795.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
Length=382

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 75/142 (53%), Gaps = 22/142 (15%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D S    P+WNE+FV  + 
Sbjct  11   LEINLISAQDLAPVSR---NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVN  67

Query  238  ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV------------DSGDSTQL  372
               L    S + +EI+ +  ++    LVGT+ + L DL                 ++ +L
Sbjct  68   DKILDFDASAIVIEIYAAAWAK--DALVGTVNVLLSDLFAPWSGFGDGDDCGGRNNNMRL  125

Query  373  KAFQLRRPSGRPQGKIRLKIAV  438
               Q+RRPSGR QG +RL +A+
Sbjct  126  VTLQIRRPSGRLQGFLRLGVAL  147



>gb|EPS62035.1| hypothetical protein M569_12761, partial [Genlisea aurea]
Length=167

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 17/137 (12%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++ V+SA+ L+ V  +   ++ Y   W+ P R+L+T  D+ G+T P WN++FV  +   
Sbjct  11   LEINVISAQELEPVRKK---MQTYATAWVHPQRKLSTSVDNDGNTSPTWNDKFVFKVDED  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-----VDSGD----STQLKAFQL  387
             L    S +++EI           +VG++RI + +L+      D         Q  A Q+
Sbjct  68   FLRNDTSAVSIEIL--AEHWFTDIVVGSVRIIIGNLIPPHVWTDRRHHHRIGMQFIALQV  125

Query  388  RRPSGRPQGKIRLKIAV  438
            RRPSGRPQG + + +AV
Sbjct  126  RRPSGRPQGILNIGVAV  142



>gb|EYU39778.1| hypothetical protein MIMGU_mgv1a009123mg [Erythranthe guttata]
Length=352

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 77/136 (57%), Gaps = 11/136 (8%)
 Frame = +1

Query  49   AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV  228
            A S  ++++++SA+ L  V+     +  Y ++WI P+++  T++D+ G   P WN++ V 
Sbjct  24   AASQLLEISLISAQDLAPVS---KSMHTYGVVWIRPNKKHTTRTDNHGQRNPKWNDKCVF  80

Query  229  PLTLPPQ--ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV----DSGDSTQLKAFQLR  390
             L  PP+  ++ + VEI+    S     +VG +R+ + DL+         +T+  A Q+R
Sbjct  81   SLDNPPENNDATVTVEIY--TVSWFRDVIVGMVRVRVADLITPLTRTRNKNTRFVALQIR  138

Query  391  RPSGRPQGKIRLKIAV  438
            RPSG PQG + + +A+
Sbjct  139  RPSGSPQGILNMGVAL  154



>ref|XP_009591358.1| PREDICTED: uncharacterized protein LOC104088405 [Nicotiana tomentosiformis]
Length=267

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 76/144 (53%), Gaps = 15/144 (10%)
 Frame = +1

Query  64   VDVTVVSAKHLKN--VNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF---VV  228
            +++ ++SA+ LK    N+R   L+ Y ++++D   +L TK D  G   P WN++F   V 
Sbjct  9    LEINLISAQSLKTPIANFRR--LQTYALIFVDSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDL---VVDSGDSTQ---LKAFQLR  390
            P  +    S ++VEI+          LVGT+R+ L      +V+SG ST      A Q+R
Sbjct  67   PKFISGDTSGVSVEIY--AVGVLKDFLVGTVRLLLSSCFKGMVNSGISTATPVFTAVQIR  124

Query  391  RPSGRPQGKIRLKIAVRKIQEYQI  462
            RPSGR QG + +  AV    ++ +
Sbjct  125  RPSGRFQGVLNIGAAVYSSTDFSL  148



>ref|XP_001778275.1| predicted protein [Physcomitrella patens]
 gb|EDQ56942.1| predicted protein [Physcomitrella patens]
Length=221

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 70/132 (53%), Gaps = 9/132 (7%)
 Frame = +1

Query  61   DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE--RFVVPL  234
            +++VTV+SAK LKNV    G + PY + WI P  +++   ++ G   P WN   + V   
Sbjct  6    ELEVTVLSAKDLKNVKLTGGVMNPYCVAWIYPHMKVSGAVNNGGGVNPTWNTIIKLVAEE  65

Query  235  TLPPQESL-LAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQ  411
            +L  Q +  + VEI++    +     +G+  + L D+   S  S+    +Q+R+ SG+ Q
Sbjct  66   SLIQQGNANITVEIYNH--GKFSNKFIGSALVSLSDVKEQSKGSS----YQVRKKSGKVQ  119

Query  412  GKIRLKIAVRKI  447
            G I + + V ++
Sbjct  120  GLINVAVKVGRV  131



>ref|XP_010264865.1| PREDICTED: uncharacterized protein LOC104602763 [Nelumbo nucifera]
Length=418

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (49%), Gaps = 12/133 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPL---  234
            +++ V+SA+ L  V      +  Y + W+DP+R+L+T  D  G   P WN++FV  +   
Sbjct  12   LEINVISAQDLAPVTR---SMHTYAVAWVDPERKLSTCVDTHGHVDPTWNDKFVFRVDDE  68

Query  235  -----TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPS  399
                 T      + A+  F  V   T + LVG L  PL  L        +  A Q+RRPS
Sbjct  69   FLHSDTSAVMIKIFALRPFRDVHVGTVRVLVGNL-FPLSSLRSHQRSGMRFVALQVRRPS  127

Query  400  GRPQGKIRLKIAV  438
            GRPQG + +  A+
Sbjct  128  GRPQGILNIGAAL  140



>ref|XP_010936043.1| PREDICTED: uncharacterized protein LOC105055767 [Elaeis guineensis]
Length=280

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 75/132 (57%), Gaps = 10/132 (8%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++TV+SA+ L     R   ++ Y   W+ PD++L+T++D +G T+P WN++ V  +   
Sbjct  23   LELTVISAQDLFPATARA--MRAYATAWVHPDKKLSTRTDRAGHTEPTWNDKLVFRVDDA  80

Query  238  -LPPQESLLAVEIF---HSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSG-  402
             L    S + V+IF   H +      P +GT+R+ L  L  D G + +  A Q+RRP+  
Sbjct  81   FLLSVTSAITVDIFAVRHRLSPRLQDPHLGTVRVLLSALRPDPG-ARRFAALQVRRPNSL  139

Query  403  RPQGKIRLKIAV  438
            RPQG + + +A+
Sbjct  140  RPQGILNVGVAL  151



>ref|XP_009379739.1| PREDICTED: uncharacterized protein LOC103968123 [Pyrus x bretschneideri]
Length=395

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 74/137 (54%), Gaps = 11/137 (8%)
 Frame = +1

Query  40   RPPAKSYDV-DVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE  216
            RP   S+ + ++ ++SA+ L   +     ++ + + W++P R+L T+ D +G T P WNE
Sbjct  3    RPFNSSFQLLEINLISAQELTPAS---KAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNE  59

Query  217  RFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQL  387
            +FV  +    L    S + +EI+ S  +     L+GT  + + +L   S    +  A QL
Sbjct  60   KFVFRVDDDFLRDDTSKIMIEIYAS--AWLRDVLIGTAAVVVNNLQNKS--KMRFMAIQL  115

Query  388  RRPSGRPQGKIRLKIAV  438
            RRPSGRPQG + + + +
Sbjct  116  RRPSGRPQGILNIGLGL  132



>ref|XP_010463915.1| PREDICTED: uncharacterized protein LOC104744544 [Camelina sativa]
Length=392

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 75/142 (53%), Gaps = 22/142 (15%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D S    P+WNE+FV  + 
Sbjct  11   LEINLISAQDLAPVSR---NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVN  67

Query  238  ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV------------DSGDSTQL  372
               L    S + +EI+ +  ++    LVGT+ + L DL                 ++ +L
Sbjct  68   DKILDADASAIVIEIYAAAWAK--DALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRL  125

Query  373  KAFQLRRPSGRPQGKIRLKIAV  438
               Q+RRPSGR QG +RL +A+
Sbjct  126  VTLQIRRPSGRLQGFLRLGVAL  147



>ref|XP_010485810.1| PREDICTED: putative lysozyme-like protein [Camelina sativa]
Length=391

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 75/142 (53%), Gaps = 22/142 (15%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D S    P+WNE+FV  + 
Sbjct  11   LEINLISAQDLAPVSR---NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVN  67

Query  238  ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV------------DSGDSTQL  372
               L    S + +EI+ +  ++    LVGT+ + L DL                 ++ +L
Sbjct  68   DKILDADASAIVIEIYAAAWAK--DALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRL  125

Query  373  KAFQLRRPSGRPQGKIRLKIAV  438
               Q+RRPSGR QG +RL +A+
Sbjct  126  VTLQIRRPSGRLQGFLRLGVAL  147



>gb|EYU38921.1| hypothetical protein MIMGU_mgv1a022778mg [Erythranthe guttata]
Length=242

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 20/149 (13%)
 Frame = +1

Query  64   VDVTVVSAKHLK--NVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            +++ ++SA+ LK  + N R   ++ Y I WIDP  +L T  D  G   P WN++F+  ++
Sbjct  6    LEINLISAQGLKPPSANLRR--IQTYAITWIDPATKLRTHVDSVGGENPTWNDKFLFRVS  63

Query  238  ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV------VDSGDSTQL-----K  375
               +    S +AVEIF          L+GT+R  L   +      +DS     +      
Sbjct  64   DEFIAGDTSAVAVEIF--AVGYIKDILIGTVRFLLSTCLKRAASPIDSAGEGSIGTPSCT  121

Query  376  AFQLRRPSGRPQGKIRLKIAVRKIQEYQI  462
              Q+RRPSGR QG + +  A  +  +Y +
Sbjct  122  GLQIRRPSGRFQGVLNIAAAAYRSSDYAV  150



>gb|AAM67146.1| unknown [Arabidopsis thaliana]
Length=391

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 75/142 (53%), Gaps = 22/142 (15%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPLT  237
            +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D S    P+WNE+FV  + 
Sbjct  11   LEINLISAQDLAPVSR---NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVN  67

Query  238  ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV------------DSGDSTQL  372
               L    S + +EI+ +  ++    LVGT+ + L DL                 ++ +L
Sbjct  68   DKILDVDASAIVIEIYAAAWAK--DALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRL  125

Query  373  KAFQLRRPSGRPQGKIRLKIAV  438
               Q+RRPSGR QG +RL IA+
Sbjct  126  VTLQIRRPSGRLQGFLRLGIAL  147



>gb|KJB26681.1| hypothetical protein B456_004G254600 [Gossypium raimondii]
Length=259

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 77/138 (56%), Gaps = 15/138 (11%)
 Frame = +1

Query  55   SYDVDVTVVSAKHLK-NVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVP  231
            +Y +++T++SA+ LK    +R   ++ Y + WID   +L +  D  G   P WN++F+  
Sbjct  4    NYIIEITLISAQGLKKTTTFRR--MRTYAVAWIDSSVKLRSCIDCVGGENPTWNDKFLFK  61

Query  232  LT---LPPQESLLAVEIFH-SVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK-----AFQ  384
            ++   L  + S +++EIF   +  +T   LVGT+R+ + +L+ D      ++     A Q
Sbjct  62   VSSEFLYSETSGISIEIFADGIFRDT---LVGTVRLLVGNLLRDGSSYIAIRVPSFSAVQ  118

Query  385  LRRPSGRPQGKIRLKIAV  438
            +RRPSGR QG I +  +V
Sbjct  119  VRRPSGRFQGVINIGASV  136



>ref|XP_008370760.1| PREDICTED: uncharacterized protein LOC103434221 [Malus domestica]
 ref|XP_008370902.1| PREDICTED: uncharacterized protein LOC103434347 [Malus domestica]
Length=402

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 74/137 (54%), Gaps = 11/137 (8%)
 Frame = +1

Query  40   RPPAKSYDV-DVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE  216
            RP   S+ + ++ ++SA+ L   +     ++ + + W++P R+L T+ D +G T P WNE
Sbjct  3    RPFGSSFQLLEINLISAQDLTPAS---KAMRTFAVAWVNPKRKLTTRFDQTGHTNPTWNE  59

Query  217  RFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQL  387
            +FV  +    L    S + +EI+ S  +     L+GT  + + +L   S    +  A QL
Sbjct  60   KFVFRVDDDFLRHDTSKIMIEIYAS--AWLRDVLIGTAAVVVNNLQNKS--KMRFMAIQL  115

Query  388  RRPSGRPQGKIRLKIAV  438
            RRPSGRPQG + + + +
Sbjct  116  RRPSGRPQGILNIGLGL  132



>ref|XP_004242771.1| PREDICTED: formin-J [Solanum lycopersicum]
Length=370

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 72/132 (55%), Gaps = 12/132 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            +++T++SA+ L  V      L+ Y + W++P+R+  T+ D+ G   P WN++F   +   
Sbjct  36   LEITLISAQDLSPV---CKSLRTYALTWVNPNRKRTTRIDNHGHNNPNWNDKFSFRVDDE  92

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV----VDSGDSTQLKAFQLRRPSG  402
             L    S + VEI+    S     LVGT+++ L +LV      S  S +  A Q+RRPSG
Sbjct  93   FLISDSSAIHVEIY--TVSWFRDILVGTVKVILNNLVNPFENTSNSSKKFVALQIRRPSG  150

Query  403  RPQGKIRLKIAV  438
             PQG + + +++
Sbjct  151  NPQGILNMGVSL  162



>ref|XP_007132355.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
 gb|ESW04349.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
Length=385

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 72/129 (56%), Gaps = 11/129 (9%)
 Frame = +1

Query  64   VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT--  237
            ++V ++SA+ L  V+     +K Y + W+DP+R+L T+    G   P WNE+FV  +   
Sbjct  11   LEVNIISAQDLAPVS---KSIKAYAVAWLDPERKLTTQIHPDGHNNPTWNEKFVFRIDED  67

Query  238  -LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV---VDSGDSTQLKAFQLRRPSGR  405
             L   +S++ +EI+ S  +     LVGT+ + L +L+   ++     +  A Q+RRPSG 
Sbjct  68   FLYADDSVVMIEIYAS--TWLRDILVGTVGVLLSNLLPRSINRTSKIRFIALQVRRPSGH  125

Query  406  PQGKIRLKI  432
            PQG + + +
Sbjct  126  PQGILNIGV  134



>ref|XP_002301388.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
 gb|EEE80661.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
Length=243

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 72/134 (54%), Gaps = 13/134 (10%)
 Frame = +1

Query  64   VDVTVVSAKHLK--NVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERF---VV  228
            +++ ++SA+ LK  + N R   ++ Y I+WIDP  +L T++D  GS  P WN++F   V 
Sbjct  6    LEINLISAQGLKPPSANLRR--MQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKVT  63

Query  229  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST----QLKAFQLRRP  396
            P  L  + S +++EI+          L+GT+R  + +L + +  +        A Q+RRP
Sbjct  64   PEYLSSETSGVSIEIY--AIGCIRDALIGTVRFLVGNLRLSTPSAAITMPSCIALQIRRP  121

Query  397  SGRPQGKIRLKIAV  438
            SGR  G I +   V
Sbjct  122  SGRFHGVINIGANV  135



>ref|XP_008366882.1| PREDICTED: uncharacterized protein LOC103430513 [Malus domestica]
Length=395

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 74/137 (54%), Gaps = 11/137 (8%)
 Frame = +1

Query  40   RPPAKSYDV-DVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNE  216
            RP   S+ + ++ ++SA+ L   +     ++ + + W++P R+L T+ D +G T P WNE
Sbjct  3    RPFNSSFQLLEINLISAQDLTPAS---KAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNE  59

Query  217  RFVVPLT---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQL  387
            +FV  +    L    S + +EI+ S  +     L+GT  + + +L   S    +  A QL
Sbjct  60   KFVFRVDEDFLRDDTSKIMIEIYAS--AWLRDVLIGTAAVVVNNLQNKS--KMRFMAIQL  115

Query  388  RRPSGRPQGKIRLKIAV  438
            RRPSGRPQG + + + +
Sbjct  116  RRPSGRPQGILNIGLGL  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625