BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN020K10

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                340   2e-113   Erythranthe guttata [common monkey flower]
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               328   8e-109   Glycine soja [wild soybean]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    328   8e-109   Glycine max [soybeans]
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    327   2e-108   Sesamum indicum [beniseed]
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             326   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    327   9e-108   Populus euphratica
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg             321   1e-107   
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                   321   1e-107   Citrus sinensis [apfelsine]
emb|CDP01043.1|  unnamed protein product                                324   3e-107   Coffea canephora [robusta coffee]
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    323   5e-107   
ref|XP_010105909.1|  putative methyltransferase                         320   6e-107   
ref|XP_002306578.1|  methyltransferase-related family protein           319   1e-106   
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             323   1e-106   Prunus persica
gb|KGN60339.1|  hypothetical protein Csa_3G895850                       318   1e-106   Cucumis sativus [cucumbers]
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   322   2e-106   Citrus sinensis [apfelsine]
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             322   3e-106   
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    322   4e-106   
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    321   4e-106   Prunus mume [ume]
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    320   4e-106   
gb|AFK47008.1|  unknown                                                 321   5e-106   Lotus japonicus
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    321   5e-106   
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         321   5e-106   Jatropha curcas
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    320   7e-106   Cicer arietinum [garbanzo]
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    320   7e-106   Vitis vinifera
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    319   7e-106   
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...    316   1e-105   
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             319   3e-105   
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    318   8e-105   Eucalyptus grandis [rose gum]
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             319   8e-105   Phaseolus vulgaris [French bean]
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        317   1e-104   Medicago truncatula
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    318   2e-104   
gb|KHN03912.1|  Putative methyltransferase, chloroplastic               311   5e-104   Glycine soja [wild soybean]
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    316   5e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    313   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    313   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    312   1e-102   Fragaria vesca subsp. vesca
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    310   9e-102   Cucumis melo [Oriental melon]
ref|XP_002889176.1|  predicted protein                                  309   2e-101   
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    309   3e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    309   3e-101   Camelina sativa [gold-of-pleasure]
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     305   1e-100   Eucalyptus grandis [rose gum]
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    307   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    307   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    306   4e-100   Eucalyptus grandis [rose gum]
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    306   5e-100   
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             305   5e-100   
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    305   7e-100   Eucalyptus grandis [rose gum]
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             305   7e-100   Eutrema salsugineum [saltwater cress]
gb|KJB59931.1|  hypothetical protein B456_009G281700                    305   9e-100   Gossypium raimondii
gb|KJB59929.1|  hypothetical protein B456_009G281700                    305   1e-99    Gossypium raimondii
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    301   4e-99    
gb|KHG01878.1|  hypothetical protein F383_23026                         302   8e-99    Gossypium arboreum [tree cotton]
emb|CDY14625.1|  BnaC02g24880D                                          302   9e-99    Brassica napus [oilseed rape]
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    302   1e-98    Pyrus x bretschneideri [bai li]
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    301   5e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    300   8e-98    
emb|CDY26853.1|  BnaA02g18780D                                          299   1e-97    Brassica napus [oilseed rape]
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    299   2e-97    Brassica rapa
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    299   2e-97    
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    298   4e-97    Tarenaya hassleriana [spider flower]
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    297   9e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    296   2e-96    
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    296   2e-96    Brassica rapa
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    295   1e-95    
emb|CDX88421.1|  BnaC06g38650D                                          295   1e-95    
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    294   1e-95    
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    286   2e-92    
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    286   2e-92    
emb|CDX87473.1|  BnaA07g34000D                                          285   7e-92    
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    281   1e-90    Elaeis guineensis
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   280   2e-90    Citrus sinensis [apfelsine]
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    276   8e-89    Phoenix dactylifera
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    266   5e-85    Phoenix dactylifera
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    265   9e-85    
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    265   1e-84    Elaeis guineensis
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...    255   2e-80    Zea mays [maize]
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          255   2e-80    Sorghum bicolor [broomcorn]
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    257   5e-80    
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    254   8e-80    
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   254   1e-79    Citrus sinensis [apfelsine]
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    252   4e-79    Setaria italica
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    252   6e-79    
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    252   6e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001061786.1|  Os08g0411200                                       251   1e-78    
gb|KJB14720.1|  hypothetical protein B456_002G140100                    251   3e-78    Gossypium raimondii
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    248   7e-78    
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...    248   7e-78    
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    248   2e-77    Brachypodium distachyon [annual false brome]
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...    248   2e-77    
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    248   3e-77    Elaeis guineensis
gb|EEE68668.1|  hypothetical protein OsJ_27281                          248   4e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    247   4e-77    Brachypodium distachyon [annual false brome]
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    245   1e-76    
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    245   1e-76    
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          244   6e-76    Sorghum bicolor [broomcorn]
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    243   1e-75    Cicer arietinum [garbanzo]
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    241   2e-75    Setaria italica
gb|EMT07919.1|  Putative methyltransferase                              241   6e-75    
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        241   6e-75    Zea mays [maize]
gb|ACF85541.1|  unknown                                                 241   7e-75    Zea mays [maize]
ref|NP_001132053.1|  uncharacterized LOC100193465                       241   7e-75    Zea mays [maize]
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    240   2e-74    Setaria italica
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    239   2e-74    Populus euphratica
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...    239   3e-74    
ref|NP_001058196.1|  Os06g0646000                                       239   3e-74    
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    238   6e-74    Fragaria vesca subsp. vesca
dbj|BAJ91607.1|  predicted protein                                      238   1e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94151.1|  predicted protein                                      238   1e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    237   1e-73    Fragaria vesca subsp. vesca
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    237   2e-73    Fragaria vesca subsp. vesca
ref|XP_006381066.1|  methyltransferase-related family protein           236   2e-73    
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    236   3e-73    Populus euphratica
ref|XP_002324579.2|  methyltransferase-related family protein           236   3e-73    
gb|EMT30153.1|  Putative methyltransferase                              238   5e-73    
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase        234   6e-73    Medicago truncatula
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    234   1e-72    
ref|XP_010099510.1|  putative methyltransferase                         235   2e-72    Morus notabilis
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         235   2e-72    Jatropha curcas
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    234   2e-72    Glycine max [soybeans]
emb|CDP10502.1|  unnamed protein product                                234   2e-72    Coffea canephora [robusta coffee]
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    234   3e-72    Sesamum indicum [beniseed]
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                234   3e-72    Erythranthe guttata [common monkey flower]
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...    232   9e-72    
gb|ACJ84583.1|  unknown                                                 233   1e-71    Medicago truncatula
gb|EEE66113.1|  hypothetical protein OsJ_22149                          229   2e-71    Oryza sativa Japonica Group [Japonica rice]
gb|AFK46366.1|  unknown                                                 232   2e-71    Medicago truncatula
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            229   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AFW76188.1|  hypothetical protein ZEAMMB73_680706                    225   2e-70    
gb|KJB53960.1|  hypothetical protein B456_009G013400                    228   3e-70    Gossypium raimondii
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    228   4e-70    Glycine max [soybeans]
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    229   5e-70    Eucalyptus grandis [rose gum]
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               228   5e-70    Glycine soja [wild soybean]
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    228   8e-70    Vitis vinifera
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    228   8e-70    
ref|NP_001242875.1|  uncharacterized protein LOC100798970               228   9e-70    
emb|CBI25578.3|  unnamed protein product                                228   9e-70    Vitis vinifera
gb|KJB53958.1|  hypothetical protein B456_009G013400                    227   1e-69    Gossypium raimondii
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             226   3e-69    Citrus clementina [clementine]
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    226   3e-69    Vitis vinifera
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   226   3e-69    Citrus sinensis [apfelsine]
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...    223   5e-69    
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...    226   6e-69    Cucumis melo [Oriental melon]
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    225   1e-68    
gb|KHG21340.1|  hypothetical protein F383_03824                         226   2e-68    Gossypium arboreum [tree cotton]
gb|EMT14235.1|  Putative methyltransferase                              228   2e-68    
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    224   2e-68    Nicotiana sylvestris
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...    224   2e-68    
gb|KJB27062.1|  hypothetical protein B456_004G275300                    223   4e-68    Gossypium raimondii
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...    223   4e-68    Eucalyptus grandis [rose gum]
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    223   6e-68    Vitis vinifera
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...    223   8e-68    Cucumis sativus [cucumbers]
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              220   9e-68    
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...    222   1e-67    Cucumis melo [Oriental melon]
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    222   2e-67    
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    222   2e-67    Solanum tuberosum [potatoes]
gb|EEC83568.1|  hypothetical protein OsI_29220                          222   2e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             222   2e-67    Prunus persica
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    222   2e-67    Tarenaya hassleriana [spider flower]
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             221   4e-67    Selaginella moellendorffii
gb|KHG26587.1|  hypothetical protein F383_01046                         221   4e-67    Gossypium arboreum [tree cotton]
gb|KGN60753.1|  hypothetical protein Csa_2G009410                       219   1e-66    Cucumis sativus [cucumbers]
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    219   3e-66    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    218   4e-66    Solanum lycopersicum
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    218   5e-66    
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    218   6e-66    Pyrus x bretschneideri [bai li]
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          218   7e-66    
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    218   8e-66    Brassica rapa
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    217   1e-65    Pyrus x bretschneideri [bai li]
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    217   1e-65    
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             218   2e-65    Eutrema salsugineum [saltwater cress]
ref|XP_001778776.1|  predicted protein                                  216   2e-65    
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    216   3e-65    Pyrus x bretschneideri [bai li]
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    216   4e-65    Solanum lycopersicum
emb|CDY57579.1|  BnaC04g56820D                                          216   5e-65    Brassica napus [oilseed rape]
gb|EMT00494.1|  Putative methyltransferase                              219   6e-65    
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    215   8e-65    Camelina sativa [gold-of-pleasure]
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   214   1e-64    Citrus sinensis [apfelsine]
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    215   1e-64    Camelina sativa [gold-of-pleasure]
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411             214   2e-64    
ref|NP_181637.2|  uncharacterized methyltransferase                     214   3e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             214   3e-64    Capsella rubella
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    214   4e-64    Camelina sativa [gold-of-pleasure]
gb|ABR16838.1|  unknown                                                 211   1e-63    Picea sitchensis
ref|XP_009602551.1|  PREDICTED: uncharacterized methyltransferase...    206   2e-63    
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...    211   2e-63    Solanum tuberosum [potatoes]
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...    209   4e-63    Fragaria vesca subsp. vesca
emb|CDY06948.1|  BnaA04g23670D                                          219   5e-63    
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                    209   2e-62    Arabis alpina [alpine rockcress]
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...    206   2e-61    
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg             204   2e-61    
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...    202   3e-60    
gb|AFK36862.1|  unknown                                                 193   7e-59    Lotus japonicus
gb|KJB59930.1|  hypothetical protein B456_009G281700                    195   5e-58    Gossypium raimondii
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                   195   2e-57    Citrus sinensis [apfelsine]
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                   194   4e-57    Citrus sinensis [apfelsine]
gb|KJB27061.1|  hypothetical protein B456_004G275300                    192   3e-56    Gossypium raimondii
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                     191   9e-56    Eucalyptus grandis [rose gum]
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                     191   9e-56    Eucalyptus grandis [rose gum]
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536             186   2e-53    Volvox carteri f. nagariensis
ref|XP_007227385.1|  hypothetical protein PRUPE_ppb016862mg             177   9e-52    
ref|XP_008356589.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    179   1e-51    
ref|XP_001694737.1|  predicted protein                                  179   1e-51    Chlamydomonas reinhardtii
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857              177   1e-50    
emb|CAN77779.1|  hypothetical protein VITISV_004172                     181   1e-49    Vitis vinifera
ref|XP_003080221.1|  methyltransferase-related (ISS)                    171   2e-47    Ostreococcus tauri
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...    166   6e-47    Eucalyptus grandis [rose gum]
ref|XP_001418638.1|  predicted protein                                  165   1e-46    Ostreococcus lucimarinus CCE9901
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...    168   1e-46    Coccomyxa subellipsoidea C-169
ref|XP_002500021.1|  predicted protein                                  169   1e-46    Micromonas commoda
ref|XP_007510827.1|  predicted protein                                  168   3e-46    Bathycoccus prasinos
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                   164   2e-45    Citrus sinensis [apfelsine]
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...    163   3e-45    
gb|KJB53959.1|  hypothetical protein B456_009G013400                    162   3e-45    Gossypium raimondii
gb|EMS47735.1|  hypothetical protein TRIUR3_02804                       158   4e-44    Triticum urartu
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...    158   2e-43    Wolffia arrhiza
ref|XP_003056709.1|  predicted protein                                  159   8e-43    Micromonas pusilla CCMP1545
ref|XP_006826926.1|  hypothetical protein AMTR_s00010p00172800          154   8e-43    
ref|XP_002506188.1|  predicted protein                                  157   3e-42    Micromonas commoda
ref|XP_003057905.1|  predicted protein                                  143   3e-38    Micromonas pusilla CCMP1545
ref|XP_009337420.1|  PREDICTED: uncharacterized methyltransferase...    132   6e-36    Pyrus x bretschneideri [bai li]
gb|KDO80936.1|  hypothetical protein CISIN_1g018003mg                   137   7e-36    Citrus sinensis [apfelsine]
ref|XP_009337419.1|  PREDICTED: uncharacterized methyltransferase...    132   1e-35    Pyrus x bretschneideri [bai li]
ref|XP_007514982.1|  predicted protein                                  137   7e-35    Bathycoccus prasinos
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502             137   4e-34    
ref|XP_005536724.1|  hypothetical protein, conserved                    136   5e-34    Cyanidioschyzon merolae strain 10D
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369             137   2e-33    
gb|EJK66010.1|  hypothetical protein THAOC_13088                        133   7e-33    Thalassiosira oceanica
dbj|BAC99645.1|  hypothetical protein                                   130   9e-33    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005824779.1|  hypothetical protein GUITHDRAFT_116106             131   1e-32    Guillardia theta CCMP2712
ref|XP_010534072.1|  PREDICTED: uncharacterized methyltransferase...    127   6e-32    
ref|XP_005713645.1|  unnamed protein product                            128   7e-32    Chondrus crispus [carageen]
gb|AAD12007.1|  hypothetical protein                                    126   1e-31    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002185698.1|  predicted protein                                  127   7e-31    Phaeodactylum tricornutum CCAP 1055/1
gb|KCW45297.1|  hypothetical protein EUGRSUZ_L01041                     123   1e-30    Eucalyptus grandis [rose gum]
gb|KIY98469.1|  putative methyltransferase                              117   5e-28    Monoraphidium neglectum
ref|XP_005855405.1|  hypothetical protein NGA_2005920                   113   6e-26    Nannochloropsis gaditana CCMP526
gb|EWM24600.1|  phosphatidylethanolamine n                              112   1e-25    Nannochloropsis gaditana
emb|CBJ26935.1|  S-adenosyl-L-methionine-dependent methyltransfer...    112   1e-25    Ectocarpus siliculosus
ref|XP_002503324.1|  chloroplast envelope protein translocase family    114   3e-25    Micromonas commoda
ref|XP_005781281.1|  hypothetical protein EMIHUDRAFT_442892             103   2e-22    Emiliania huxleyi CCMP1516
gb|KIE07218.1|  hypothetical protein DA73_0239355                       100   5e-22    Tolypothrix bouteillei VB521301
ref|XP_002992310.1|  hypothetical protein SELMODRAFT_430530           99.0    1e-21    
emb|CEF97980.1|  Methyltransferase type 11                            99.8    1e-21    Ostreococcus tauri
ref|XP_002502147.1|  predicted protein                                  100   2e-21    Micromonas commoda
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660    102   3e-21    
ref|XP_005705444.1|  phosphatidylethanolamine n-methyltransferase...  99.0    5e-21    Galdieria sulphuraria
ref|XP_003079346.1|  non-transporter ABC protein (ISS)                  101   1e-20    
ref|WP_037584032.1|  hypothetical protein                             95.5    4e-20    
gb|ADO73882.1|  Methyltransferase type 11                             95.1    5e-20    Stigmatella aurantiaca DW4/3-1
ref|XP_007514207.1|  predicted protein                                92.0    4e-19    Bathycoccus prasinos
gb|AEI63749.1|  methyltransferase type 11                             84.0    5e-16    Myxococcus macrosporus
ref|WP_031116772.1|  MULTISPECIES: hypothetical protein               83.6    6e-16    
ref|WP_007577247.1|  putative methyltransferase                       83.6    6e-16    
ref|WP_033335056.1|  hypothetical protein                             78.2    3e-15    
dbj|BAF93193.1|  putative methyltransferase-like                      79.7    5e-15    Hordeum vulgare [barley]
gb|ACL04197.1|  Methyltransferase type 11                             80.9    5e-15    Desulfatibacillum alkenivorans AK-01
ref|WP_009647626.1|  SAM-dependent methyltransferase                  80.1    5e-15    Actinomyces sp. ICM47
ref|WP_012828704.1|  type 11 methyltransferase                        80.5    6e-15    Haliangium ochraceum
ref|WP_005984449.1|  SAM-dependent methyltransferase                  79.7    6e-15    Actinomyces graevenitzii
ref|WP_003790083.1|  SAM-dependent methyltransferase                  79.7    7e-15    Actinomyces odontolyticus
ref|WP_003794338.1|  SAM-dependent methyltransferase                  79.7    9e-15    Actinomyces odontolyticus
ref|WP_034465932.1|  SAM-dependent methyltransferase                  79.7    9e-15    Actinomyces sp. ICM54
ref|WP_011024227.1|  fibrillarin-like rRNA methylase                  79.0    1e-14    
ref|WP_044509270.1|  SAM-dependent methyltransferase                  79.3    2e-14    Mycobacterium simiae
ref|WP_022122196.1|  hypothetical protein                             79.0    2e-14    
ref|WP_034501983.1|  SAM-dependent methyltransferase                  78.6    2e-14    Actinomyces sp. S6-Spd3
ref|WP_007588477.1|  SAM-dependent methyltransferase                  78.2    2e-14    Actinomyces sp. ICM39
ref|WP_006242682.1|  SAM-dependent methyltransferase                  78.2    4e-14    Mycolicibacterium tusciae
ref|XP_003056909.1|  predicted protein                                79.3    5e-14    Micromonas pusilla CCMP1545
ref|WP_043712622.1|  hypothetical protein                             76.6    6e-14    
ref|WP_021603648.1|  methyltransferase domain protein                 76.3    1e-13    Actinomyces graevenitzii
ref|WP_043403276.1|  hypothetical protein                             76.6    1e-13    
ref|WP_008332456.1|  methyltransferase, UbiE/COQ5 family protein      75.9    1e-13    Maritimibacter alkaliphilus
gb|KFA90141.1|  hypothetical protein Q664_29640                       76.3    2e-13    Archangium violaceum Cb vi76
ref|XP_008450988.1|  PREDICTED: uncharacterized methyltransferase...  72.8    3e-13    
ref|WP_033397012.1|  hypothetical protein                             73.2    4e-13    
ref|WP_021611333.1|  methyltransferase domain protein                 74.7    4e-13    Actinomyces sp. oral taxon 172
ref|WP_030245520.1|  MULTISPECIES: hypothetical protein               73.9    5e-13    
ref|XP_008450953.1|  PREDICTED: uncharacterized methyltransferase...  72.8    5e-13    
ref|WP_011557522.1|  MULTISPECIES: SAM-dependent methyltransferase    74.7    5e-13    
ref|WP_029321310.1|  methyltransferase                                74.3    6e-13    
ref|WP_036465838.1|  SAM-dependent methyltransferase                  74.3    7e-13    
ref|WP_006530961.1|  MULTISPECIES: methyltransferase                  74.3    7e-13    
ref|WP_011305165.1|  demethylmenaquinone methyltransferase            73.6    8e-13    
gb|ETB46623.1|  SAM-dependent methyltransferase                       74.3    8e-13    
ref|WP_041867434.1|  biotin synthase                                  74.3    8e-13    
ref|WP_033721305.1|  SAM-dependent methyltransferase                  74.3    9e-13    
dbj|BAE74180.1|  biotin synthesis protein BioC                        74.3    9e-13    
ref|WP_028922352.1|  hypothetical protein                             73.6    1e-12    
ref|XP_008462788.1|  PREDICTED: uncharacterized protein LOC103501079  72.0    2e-12    
ref|WP_035217698.1|  hypothetical protein                             72.0    2e-12    
ref|WP_003891430.1|  SAM-dependent methyltransferase                  73.2    2e-12    
ref|WP_005039618.1|  ubiquinone/menaquinone biosynthesis methyltr...  72.4    2e-12    
ref|WP_027728386.1|  SAM-dependent methyltransferase                  72.4    3e-12    
ref|WP_009058751.1|  SAM-dependent methyltransferase                  72.4    3e-12    
ref|WP_029113106.1|  ubiquinone biosynthesis protein                  72.0    3e-12    
ref|WP_040742155.1|  hypothetical protein                             72.4    4e-12    
ref|WP_007167123.1|  SAM-dependent methyltransferase                  72.4    4e-12    
ref|WP_008409621.1|  Demethylmenaquinone methyltransferase            72.4    4e-12    
ref|WP_033273715.1|  MULTISPECIES: methyltransferase                  72.0    4e-12    
ref|WP_037328854.1|  methyltransferase                                71.6    4e-12    
ref|WP_018992020.1|  hypothetical protein                             72.4    4e-12    
ref|WP_034251379.1|  SAM-dependent methyltransferase                  71.6    5e-12    
ref|WP_035770868.1|  hypothetical protein                             71.6    5e-12    
ref|WP_043809217.1|  hypothetical protein                             70.9    6e-12    
ref|WP_036430237.1|  SAM-dependent methyltransferase                  71.6    6e-12    
gb|EKY16220.1|  methyltransferase domain protein                      71.2    7e-12    
gb|AGB25690.1|  methylase involved in ubiquinone/menaquinone bios...  71.6    7e-12    
ref|WP_031348458.1|  SAM-dependent methyltransferase                  71.6    7e-12    
gb|ETB32802.1|  SAM-dependent methyltransferase                       71.6    7e-12    
ref|WP_033712326.1|  MULTISPECIES: SAM-dependent methyltransferase    71.6    8e-12    
ref|WP_041315040.1|  SAM-dependent methyltransferase                  71.2    8e-12    
gb|ETA95861.1|  SAM-dependent methyltransferase                       71.6    8e-12    
ref|WP_011726543.1|  SAM-dependent methyltransferase                  71.2    8e-12    
gb|ETB14793.1|  SAM-dependent methyltransferase                       71.2    8e-12    
ref|WP_008521718.1|  MULTISPECIES: methyltransferase                  71.2    8e-12    
ref|WP_009979883.1|  SAM-dependent methyltransferase                  71.2    9e-12    
ref|WP_003874284.1|  SAM-dependent methyltransferase                  71.2    1e-11    
gb|ETB02671.1|  SAM-dependent methyltransferase                       71.2    1e-11    
gb|ETB01440.1|  SAM-dependent methyltransferase                       71.2    1e-11    
ref|WP_013056673.1|  methyltransferase                                70.9    1e-11    
ref|WP_027737776.1|  methyltransferase type 11                        71.2    1e-11    
ref|WP_031353789.1|  SAM-dependent methyltransferase                  70.9    1e-11    
gb|AJR18080.1|  methyltransferase                                     70.5    1e-11    
ref|WP_036550599.1|  hypothetical protein                             70.5    1e-11    
ref|WP_039694375.1|  methyltransferase                                70.5    1e-11    
ref|WP_014620256.1|  methyltransferase                                70.5    1e-11    
ref|WP_039937297.1|  hypothetical protein                             72.8    2e-11    
ref|WP_007321706.1|  type 11 methyltransferase                        70.1    2e-11    
ref|WP_042432128.1|  methyltransferase                                69.7    2e-11    
ref|WP_015695701.1|  methyltransferase                                70.1    2e-11    
ref|WP_037715123.1|  methyltransferase type 11                        70.5    2e-11    
ref|WP_034268278.1|  methyltransferase                                70.1    2e-11    
ref|WP_024448835.1|  SAM-dependent methyltransferase                  70.1    2e-11    
gb|EFL22653.1|  methyltransferase domain protein                      72.4    2e-11    
ref|WP_037876752.1|  methyltransferase type 11                        70.5    2e-11    
ref|WP_036368657.1|  SAM-dependent methyltransferase                  70.1    2e-11    
gb|EFL09972.1|  predicted protein                                     70.5    2e-11    
ref|WP_004921007.1|  methyltransferase type 11                        70.5    2e-11    
ref|WP_028413664.1|  MULTISPECIES: methyltransferase                  69.7    2e-11    
ref|WP_033949340.1|  methyltransferase type 11                        70.5    3e-11    
ref|WP_011777434.1|  SAM-dependent methyltransferase                  69.7    3e-11    
ref|WP_021816190.1|  ubiquinone/menaquinone biosynthesis methyltr...  69.7    3e-11    
ref|WP_033092997.1|  biotin biosynthesis protein bioC                 70.1    3e-11    
ref|WP_007049331.1|  hypothetical protein                             69.3    3e-11    
ref|WP_040813287.1|  hypothetical protein                             68.9    3e-11    
ref|WP_033366411.1|  hypothetical protein                             71.6    3e-11    
ref|WP_031028461.1|  2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4...  69.3    3e-11    
ref|WP_009254158.1|  MULTISPECIES: methyltransferase                  68.9    3e-11    
ref|WP_025843753.1|  methylase                                        69.7    3e-11    
ref|WP_028655549.1|  hypothetical protein                             68.9    3e-11    
ref|WP_005827317.1|  MULTISPECIES: methylase                          69.7    4e-11    
ref|WP_030408594.1|  2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4...  69.3    4e-11    
ref|WP_021593077.1|  hypothetical protein                             69.7    4e-11    
ref|WP_033082084.1|  biotin biosynthesis protein bioC                 69.7    4e-11    
ref|WP_014460488.1|  methyltransferase                                68.9    4e-11    
ref|WP_012894953.1|  type 11 methyltransferase                        69.3    4e-11    
ref|WP_006894188.1|  putative methyltransferase                       68.9    4e-11    
ref|WP_037817629.1|  methyltransferase type 11                        69.3    4e-11    
ref|WP_020003619.1|  type 11 methyltransferase                        68.9    4e-11    
ref|WP_043839049.1|  methyltransferase type 11                        69.3    5e-11    
ref|WP_025737334.1|  SAM-dependent methyltransferase                  69.3    5e-11    
ref|WP_012032606.1|  ubiquinone/menaquinone biosynthesis methyltr...  68.9    5e-11    
gb|AHH19046.1|  methyltransferase domain-containing protein           69.3    5e-11    
ref|WP_032786064.1|  methyltransferase type 11                        69.7    5e-11    
ref|WP_024500970.1|  ubiquinone biosynthesis methyltransferase UbiE   68.9    5e-11    
gb|KGP68999.1|  ubiquinone biosynthesis methyltransferase UbiE        68.9    5e-11    
ref|WP_006905290.1|  type 11 methyltransferase                        68.6    5e-11    
ref|WP_016471571.1|  MULTISPECIES: 3-demethylubiquinone-9 3-O-met...  68.9    6e-11    
ref|WP_040025614.1|  methyltransferase type 11                        69.3    6e-11    
ref|WP_003683485.1|  ubiquinone/menaquinone biosynthesis methyltr...  68.9    6e-11    
ref|WP_021349912.1|  ubiquinone/menaquinone biosynthesis methyltr...  68.9    6e-11    
ref|WP_037304603.1|  methyltransferase type 11                        68.9    6e-11    
ref|WP_040522424.1|  hypothetical protein                             68.9    6e-11    
ref|WP_022848725.1|  type 11 methyltransferase                        68.6    6e-11    
ref|WP_039931048.1|  methyltransferase                                68.2    6e-11    
ref|WP_044283660.1|  hypothetical protein                             68.9    6e-11    
ref|WP_035544367.1|  hypothetical protein                             68.9    6e-11    
ref|WP_020640454.1|  hypothetical protein                             68.9    6e-11    
ref|WP_013082821.1|  methyltransferase                                68.6    6e-11    
ref|WP_033751605.1|  biotin biosynthesis protein BioC                 68.9    7e-11    
ref|WP_040620259.1|  hypothetical protein                             65.9    7e-11    
ref|WP_038683354.1|  hypothetical protein                             67.0    7e-11    
ref|WP_020074409.1|  methyltransferase [                              68.2    7e-11    
ref|WP_023554536.1|  methylase                                        68.9    7e-11    
ref|WP_011570463.1|  S-adenosylmethionine-dependent methyltransfe...  68.6    8e-11    
ref|WP_033389161.1|  methyltransferase type 11                        68.6    8e-11    
ref|WP_012686052.1|  methylase                                        68.9    8e-11    
ref|WP_041812816.1|  ubiquinone biosynthesis methyltransferase UbiE   68.6    8e-11    
ref|WP_023361780.1|  type 11 methyltransferase                        68.9    8e-11    
ref|WP_023465902.1|  ubiquinone/menaquinone biosynthesis methyltr...  68.6    8e-11    
ref|WP_019127220.1|  hypothetical protein                             67.8    8e-11    
ref|WP_016460104.1|  hypothetical protein                             67.8    8e-11    
ref|WP_037908141.1|  methyltransferase                                68.6    8e-11    
gb|EEI87192.1|  methyltransferase domain protein                      68.2    8e-11    
ref|WP_044852589.1|  methyltransferase type 11                        68.6    9e-11    
ref|WP_035985516.1|  methyltransferase type 11                        67.8    9e-11    
dbj|GAB09923.1|  hypothetical protein GOARA_048_01250                 68.6    9e-11    
ref|WP_011610229.1|  type 11 methyltransferase                        67.8    1e-10    
ref|XP_001417757.1|  predicted protein                                67.0    1e-10    
ref|WP_035316534.1|  methyltransferase                                67.8    1e-10    
ref|WP_025752014.1|  methyltransferase                                67.8    1e-10    
ref|WP_019028125.1|  hypothetical protein                             68.6    1e-10    
ref|WP_014932780.1|  putative type 11 methyltransferase               67.8    1e-10    
ref|WP_028408820.1|  methyltransferase                                67.8    1e-10    
ref|WP_015348567.1|  hypothetical protein                             68.2    1e-10    
ref|WP_021049895.1|  methylase involved in ubiquinone/menaquinone...  68.2    1e-10    
ref|WP_007031726.1|  type 11 methyltransferase                        68.2    1e-10    
ref|WP_030856331.1|  methyltransferase                                67.8    1e-10    
ref|WP_004039358.1|  ubiquinone biosynthesis protein UbiE             67.8    1e-10    
gb|EJF41683.1|  methyltransferase domain protein                      67.8    1e-10    
ref|WP_008722794.1|  type 11 methyltransferase                        67.4    1e-10    
ref|WP_010638185.1|  type 11 methyltransferase                        69.7    1e-10    
ref|WP_041947868.1|  hypothetical protein                             67.0    1e-10    
ref|WP_003921361.1|  SAM-dependent methyltransferase                  67.8    1e-10    
ref|WP_011043405.1|  biotin biosynthesis protein bioC                 68.2    1e-10    
ref|WP_040710863.1|  SAM-dependent methyltransferase                  67.4    2e-10    
ref|WP_006617666.1|  methyltransferase type 11                        67.0    2e-10    
ref|WP_028386584.1|  SAM-dependent methlyltransferase                 68.2    2e-10    
ref|WP_041086098.1|  hypothetical protein                             67.8    2e-10    
ref|WP_006079278.1|  ubiquinone/menaquinone biosynthesis methyltr...  67.0    2e-10    
gb|KIL52011.1|  hypothetical protein KP78_03810                       67.8    2e-10    
ref|WP_036881765.1|  ubiquinone biosynthesis methyltransferase UbiE   67.4    2e-10    
ref|WP_030577910.1|  methyltransferase type 11                        68.2    2e-10    
ref|WP_016211044.1|  methyltransferase domain protein                 68.2    2e-10    
ref|WP_026098045.1|  SAM-dependent methyltransferase                  67.8    2e-10    
ref|WP_023347129.1|  hypothetical protein                             67.0    2e-10    
ref|WP_030394695.1|  MULTISPECIES: 2-polyprenyl-3-methyl-5-hydrox...  67.4    2e-10    
ref|WP_041620698.1|  methyltransferase type 11                        67.0    2e-10    
ref|WP_003505027.1|  methyltransferase [                              67.0    2e-10    
ref|WP_005553246.1|  methyltransferase type 11                        67.0    2e-10    
dbj|GAM28086.1|  hypothetical protein SAMD00019534_112620             66.2    2e-10    
ref|WP_040624354.1|  hypothetical protein                             67.0    2e-10    
ref|WP_034433269.1|  methyltransferase                                67.0    2e-10    
ref|WP_028509762.1|  SAM-dependent methyltransferase                  66.6    2e-10    
gb|AFZ38370.1|  Methyltransferase type 11                             67.0    2e-10    
ref|WP_008010752.1|  Methyltransferase type 11                        66.6    2e-10    
ref|WP_029420297.1|  ubiquinone biosynthesis methyltransferase UbiE   67.0    2e-10    
ref|WP_043717337.1|  hypothetical protein                             67.4    2e-10    
gb|AGB21077.1|  methylase involved in ubiquinone/menaquinone bios...  66.6    2e-10    
ref|WP_027435503.1|  SAM-dependent methyltransferase                  66.6    2e-10    
ref|WP_013841591.1|  ubiquinone/menaquinone biosynthesis methyltr...  67.0    2e-10    
gb|AFA41142.1|  malonyl-CoA methyltransferase                         67.4    2e-10    
gb|ADI14994.1|  Methyltransferase type 11                             67.0    2e-10    
ref|WP_000774686.1|  ubiquinone/menaquinone biosynthesis methyltr...  67.0    3e-10    
ref|WP_041944111.1|  biotin synthase                                  67.4    3e-10    
ref|WP_028504361.1|  methyltransferase                                66.6    3e-10    
ref|WP_036227573.1|  hypothetical protein                             66.2    3e-10    
ref|WP_035151246.1|  methyltransferase                                66.6    3e-10    
ref|WP_041311233.1|  SAM-dependent methyltransferase                  66.6    3e-10    
ref|WP_016327530.1|  hypothetical protein                             67.4    3e-10    
ref|WP_015321662.1|  methylase involved in ubiquinone/menaquinone...  66.2    3e-10    
ref|WP_006180302.1|  MULTISPECIES: SAM-dependent methlyltransferase   66.2    3e-10    
ref|WP_015639106.1|  Ubiquinone/menaquinone biosynthesis methyltr...  66.6    3e-10    
ref|WP_028506503.1|  hypothetical protein                             66.2    3e-10    
ref|WP_006430418.1|  Methyltransferase type 11                        66.2    3e-10    
ref|WP_015410124.1|  probable S-adenosylmethionine-dependent meth...  66.6    3e-10    
ref|WP_009273390.1|  menaquinone biosynthesis methyltransferase UbiE  66.2    3e-10    
ref|WP_007769532.1|  SAM-dependent methyltransferase                  67.0    3e-10    
ref|WP_038683981.1|  hypothetical protein                             66.2    3e-10    
ref|WP_035808794.1|  ubiquinone biosynthesis methyltransferase UbiE   66.6    3e-10    
ref|WP_013823230.1|  ubiquinone biosynthesis protein UbiE             66.2    3e-10    
ref|WP_034547175.1|  methyltransferase                                66.2    3e-10    
ref|WP_015246971.1|  type 11 methyltransferase                        66.6    3e-10    
ref|WP_029680591.1|  hypothetical protein                             64.7    3e-10    
ref|WP_020681005.1|  hypothetical protein                             66.2    4e-10    
ref|WP_021945684.1|  demethylmenaquinone methyltransferase            66.2    4e-10    
ref|WP_017377351.1|  hypothetical protein                             67.0    4e-10    
ref|WP_027357282.1|  ubiquinone biosynthesis protein UbiE             65.9    4e-10    
ref|WP_041437843.1|  dimethylmenaquinone methyltransferase            66.2    4e-10    
ref|WP_036517890.1|  methyltransferase type 11                        65.9    4e-10    
ref|WP_015203444.1|  type 11 methyltransferase                        65.9    4e-10    
ref|WP_040374791.1|  methyltransferase                                66.2    4e-10    
ref|WP_028330855.1|  methyltransferase type 11                        65.9    4e-10    
ref|WP_037550475.1|  ubiquinone biosynthesis methyltransferase UbiE   66.2    4e-10    
emb|CED58911.1|  SAM dependent methyltransferase                      65.9    4e-10    
gb|AHG00272.1|  SAM-dependent methlyltransferase                      65.9    4e-10    
ref|WP_023539872.1|  methyltransferase type 11                        67.0    4e-10    
ref|WP_029231175.1|  hypothetical protein                             66.6    5e-10    
ref|WP_003543405.1|  MULTISPECIES: ubiquinone/menaquinone biosynt...  66.2    5e-10    
ref|WP_024468379.1|  methyltransferase                                65.5    5e-10    
ref|WP_036146126.1|  SAM-dependent methlyltransferase                 65.9    5e-10    
ref|WP_009954460.1|  SAM-dependent methyltransferase                  66.2    5e-10    
ref|WP_041435346.1|  hypothetical protein                             65.5    5e-10    
ref|WP_007259844.1|  methyltransferase type 11                        66.6    5e-10    
ref|WP_007070555.1|  SAM-dependent methyltransferase                  65.9    5e-10    
ref|WP_006130851.1|  MULTISPECIES: hypothetical protein               66.2    5e-10    
ref|WP_042914009.1|  SAM-dependent methyltransferase                  66.2    5e-10    
ref|WP_028235830.1|  SAM-dependent methyltransferase                  65.5    5e-10    
ref|WP_023772183.1|  MULTISPECIES: SAM-dependent methyltransferase    66.6    5e-10    
ref|WP_008262302.1|  MULTISPECIES: SAM-dependent methyltransferase    66.2    5e-10    
ref|WP_038509212.1|  methyltransferase type 11                        66.2    5e-10    
gb|ABP49094.1|  hypothetcal protein                                   67.0    5e-10    
ref|WP_034288964.1|  methyltransferase type 11                        66.2    5e-10    
ref|WP_031126010.1|  hypothetical protein                             65.5    5e-10    
gb|EDY87261.1|  SAM-dependent methyltransferase                       66.2    5e-10    
ref|WP_023781873.1|  SAM-dependent methyltransferase                  66.2    6e-10    
ref|WP_020631000.1|  hypothetical protein                             66.2    6e-10    
ref|WP_040589166.1|  hypothetical protein                             64.7    6e-10    
ref|WP_031762179.1|  ubiquinone biosynthesis methyltransferase UbiE   65.9    6e-10    



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL++DYLKPV+GG+IIDASCGSG+FSRLFAKSGLFSLVVALDFSETMLQQC
Sbjct  174  GFPGPEKEFELIKDYLKPVLGGSIIDASCGSGMFSRLFAKSGLFSLVVALDFSETMLQQC  233

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++NFP EN+I+VRADISRLPF SSSVDAVHAGAALHCWPSPS+AVAEISRVL+P
Sbjct  234  YDFIKQDKNFPEENLIMVRADISRLPFPSSSVDAVHAGAALHCWPSPSSAVAEISRVLKP  293

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FVATTYIVDG++S+ P  RPLR+N AQISGSH+FL EKELE+LCT+CGLV F   RN
Sbjct  294  GGMFVATTYIVDGLFSYLPLSRPLRQNIAQISGSHVFLSEKELEELCTSCGLVNFTSTRN  353

Query  543  RRFIMLTAMKP  575
            R F+M++AMKP
Sbjct  354  RMFVMISAMKP  364



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   328 bits (841),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ +LKP++GGNIIDASC SGLFSRLFAKSGLFS +VALD+SE MLQQC
Sbjct  162  GFPGPEKEFELMKGFLKPILGGNIIDASCASGLFSRLFAKSGLFSFIVALDYSENMLQQC  221

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QEENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP AAVAEISRVLRP
Sbjct  222  YEFIQQEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPSPLAAVAEISRVLRP  281

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG +S  PF+  LR+N  Q+SGS+IFL E+ELEDLC  CGLVGFKCIRN
Sbjct  282  GGVFVATTYILDGPFSVIPFLSSLRQNVRQVSGSYIFLSERELEDLCRACGLVGFKCIRN  341

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  342  GLFVMISATKPS  353



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   328 bits (841),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ +LKP++GGNIIDASC SGLFSRLFAKSGLFS +VALD+SE MLQQC
Sbjct  161  GFPGPEKEFELMKGFLKPILGGNIIDASCASGLFSRLFAKSGLFSFIVALDYSENMLQQC  220

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QEENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP AAVAEISRVLRP
Sbjct  221  YEFIQQEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPSPLAAVAEISRVLRP  280

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG +S  PF+  LR+N  Q+SGS+IFL E+ELEDLC  CGLVGFKCIRN
Sbjct  281  GGVFVATTYILDGPFSVIPFLSSLRQNVRQVSGSYIFLSERELEDLCRACGLVGFKCIRN  340

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  341  GLFVMISATKPS  352



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKE+ L+++YLKPV+GGNIIDASCGSG+FSRLFAKSGLFSLVVALDFSE+MLQQC
Sbjct  169  GFPGPEKEYVLVKEYLKPVLGGNIIDASCGSGMFSRLFAKSGLFSLVVALDFSESMLQQC  228

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQE+NFP EN+ILVRADISRLPFASS+VDAVHAGAALHCWPSPSA VAEISRVL+P
Sbjct  229  YDFIKQEDNFPEENLILVRADISRLPFASSTVDAVHAGAALHCWPSPSAGVAEISRVLKP  288

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FVA+TYI DG+ S+ P    LR+N AQ SGSH+FL + ELEDLC +CGL+ F C RN
Sbjct  289  GGMFVASTYIADGLVSYIPLRGALRQNIAQFSGSHVFLSDTELEDLCKSCGLIDFTCTRN  348

Query  543  RRFIMLTAMKP  575
            RRF+ML+AMKP
Sbjct  349  RRFVMLSAMKP  359



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   326 bits (836),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+M+DYLKPV+GGNI+DASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QC
Sbjct  158  GFPGPEKEFEMMKDYLKPVLGGNILDASCGSGLFSRLFAKSGLFSLVTALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEENFP EN+ILVRADI+RLPF S S+DAVHAGAA+HCWPSPSAAVAE+SRVLRP
Sbjct  218  YEFIKQEENFPKENLILVRADIARLPFVSGSLDAVHAGAAIHCWPSPSAAVAEVSRVLRP  277

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG +SF PF++P+ + F Q SG++ FL E+ELE +C  CGLV F C RN
Sbjct  278  GGVFVATTYILDGPFSFIPFLKPISQRFTQASGNNFFLSERELEAVCRACGLVNFTCTRN  337

Query  543  RRFIMLTAMKPS  578
            R+FIM +A KPS
Sbjct  338  RQFIMFSATKPS  349



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   327 bits (837),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+M+DYLKPV+GGNI+DASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QC
Sbjct  188  GFPGPEKEFEMMKDYLKPVLGGNILDASCGSGLFSRLFAKSGLFSLVTALDYSENMLKQC  247

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QEENFP EN ILVRADI+RLPF S S+DAVHAGAA+HCWPSPSAAVAE+SRVLRP
Sbjct  248  YEFVQQEENFPKENFILVRADIARLPFVSGSLDAVHAGAAIHCWPSPSAAVAEVSRVLRP  307

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG +SF PF++P+ + F Q+SGS+ FL E+ELE +C  CGLV F C RN
Sbjct  308  GGVFVATTYILDGPFSFIPFLKPISQRFTQVSGSNFFLSERELEAVCRACGLVNFTCTRN  367

Query  543  RRFIMLTAMKPS  578
            R+FIM +A KPS
Sbjct  368  RQFIMFSATKPS  379



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score =   321 bits (822),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  42   GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  101

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRP
Sbjct  102  YEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRP  161

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RN
Sbjct  162  GGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRN  221

Query  543  RRFIMLTAMKPS  578
            R F+M TA KPS
Sbjct  222  RGFVMFTATKPS  233



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score =   321 bits (822),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  42   GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  101

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRP
Sbjct  102  YEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRP  161

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RN
Sbjct  162  GGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRN  221

Query  543  RRFIMLTAMKPS  578
            R F+M TA KPS
Sbjct  222  RGFVMFTATKPS  233



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL++DYL PV+GG I+DASCGSG+FSRLFAKSGLFSLVVALDFSE ML+QC
Sbjct  167  GFPGPEKEFELIKDYLNPVLGGTIVDASCGSGMFSRLFAKSGLFSLVVALDFSEAMLRQC  226

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EFI QEENFP E IILVRADISRLPFAS +VDAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  227  SEFINQEENFPKEKIILVRADISRLPFASGTVDAVHAGAALHCWPSPSVAVAEISRVLRP  286

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FVATTYI+DG++S+ P V PLR+N AQ+SGSH+FL  KELEDLCT CGLV  K  RN
Sbjct  287  GGMFVATTYILDGLFSYIPLVGPLRQNVAQVSGSHVFLSNKELEDLCTACGLVDAKVTRN  346

Query  543  RRFIMLTAMKP  575
            R F+M+ A KP
Sbjct  347  RMFVMICATKP  357



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   323 bits (829),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL++DYLKPV+GGNIIDASCGSGLFSRLFAKSGLFSLVVALD+SE MLQQC
Sbjct  160  GFPGPEKEFELIKDYLKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLQQC  219

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQEENFP EN+I VRADISRLPF   SVDAVHAGAA+HCWPSPSAAVAEISRVLRP
Sbjct  220  YDFIKQEENFPTENLISVRADISRLPFLFGSVDAVHAGAAIHCWPSPSAAVAEISRVLRP  279

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T+I+DG +SF P + PLR+N AQISGS IFL E ELED+C  CGLVGF  IR+
Sbjct  280  GGVFVASTFILDGPFSFVPLMGPLRQNIAQISGSQIFLREYELEDICRACGLVGFTAIRD  339

Query  543  RRFIMLTAMKP  575
            R+F+M +A KP
Sbjct  340  RQFVMFSARKP  350



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   320 bits (820),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL + +L+PV GGNI+DASCGSGLFSRLFAKSGLFS VVALD+SE ML+QC
Sbjct  75   GFPGPEKEFELTKKFLEPVFGGNIVDASCGSGLFSRLFAKSGLFSRVVALDYSENMLRQC  134

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI QEENFP ENIILVRADISRLPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRP
Sbjct  135  YEFINQEENFPKENIILVRADISRLPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRP  194

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG ++F PF+R LR+   QISG++ FL E+ELEDLC  CGLVGF C+RN
Sbjct  195  GGVFVATTYILDGPFTFVPFLRELRQYTRQISGNYSFLSERELEDLCKACGLVGFTCVRN  254

Query  543  RRFIMLTAMKPS  578
              F+M++A KP+
Sbjct  255  GAFVMISATKPT  266



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score =   319 bits (817),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+DYLKPV+GGNI+DASCGSGLFSRLF KSGLFSLV+ALD+SE MLQQC
Sbjct  53   GFPGPEKEFELMKDYLKPVLGGNILDASCGSGLFSRLFTKSGLFSLVMALDYSENMLQQC  112

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEENFP EN+ILVRADI+RLPF S S+DAV AGAA+HCWPSPS AVAE+SRVLRP
Sbjct  113  YEFIKQEENFPKENLILVRADIARLPFISGSLDAVPAGAAIHCWPSPSVAVAEVSRVLRP  172

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG +S  PF++P+ + F Q+SGS+IFL E+ELED+C  CGLV F C RN
Sbjct  173  GGVFVATTYILDGHFSLIPFLKPISQRFTQVSGSNIFLSERELEDVCRACGLVDFTCTRN  232

Query  543  RRFIMLTAMKP  575
             RF+M +A KP
Sbjct  233  GRFVMFSATKP  243



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL +D+LKPV+GGNIIDASCGSGLFSRLFAKSGLFSLVVALD+SE ML+Q 
Sbjct  163  GFPGPEKEFELTKDFLKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLKQT  222

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIK+EENFP ENIILVRADISRLPFA+SSVDAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  223  YEFIKKEENFPEENIILVRADISRLPFATSSVDAVHAGAALHCWPSPSTAVAEISRVLRP  282

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG  S+ PF+R + +   QISGS IF  E+ELEDLC  CGLVG+ C+RN
Sbjct  283  GGVFVATTYILDGPLSYIPFLRNITQRTKQISGSQIFTSERELEDLCKACGLVGYTCVRN  342

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  343  GLFVMISATKPS  354



>gb|KGN60339.1| hypothetical protein Csa_3G895850 [Cucumis sativus]
Length=220

 Score =   318 bits (814),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL+++++ PV+GG+IIDASCGSG+FSR+FAKSGLFS VVALD+SE ML+QC
Sbjct  29   GFPGPEKEFELIKNFITPVLGGSIIDASCGSGMFSRIFAKSGLFSSVVALDYSENMLRQC  88

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRP
Sbjct  89   YEFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRP  148

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T+I+DG YSF PF+R   E   QISGS IFL E+ELE+LCT CGLV FKC+RN
Sbjct  149  GGVFVASTFIMDGPYSFVPFLRIQIEGIQQISGSRIFLSERELEELCTACGLVDFKCLRN  208

Query  543  RRFIMLTAMKPS  578
            R+F+ML+A K S
Sbjct  209  RQFVMLSATKCS  220



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  158  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRP
Sbjct  218  YEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRP  277

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RN
Sbjct  278  GGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRN  337

Query  543  RRFIMLTAMKPS  578
            R F+M TA KPS
Sbjct  338  RGFVMFTATKPS  349



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   322 bits (824),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  158  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRP
Sbjct  218  YEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRP  277

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RN
Sbjct  278  GGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRN  337

Query  543  RRFIMLTAMKPS  578
            R F+M TA KPS
Sbjct  338  RGFVMFTATKPS  349



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEF++ ++YLKPV+GGNIIDASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QC
Sbjct  175  GFPGPEKEFDMAKNYLKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVFALDYSENMLRQC  234

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI++EENFP E + LVRADISRLPF SSSVDAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  235  YEFIEKEENFPKEKVTLVRADISRLPFKSSSVDAVHAGAALHCWPSPSTAVAEISRVLRP  294

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG + F PF+R  R+N   I+GSHIFL E+EL+DLC TCGLVGF C+RN
Sbjct  295  GGVFVATTYILDGPFGFVPFLRTFRQNIMGIAGSHIFLSERELKDLCRTCGLVGFTCVRN  354

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  355  GLFVMISARKPS  366



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL++D+LKPV+GGNIIDASCGSGLFSRLFAKSGLFSLVVALD+SE ML+Q 
Sbjct  163  GFPGPEKEFELIKDFLKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLKQT  222

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIK+EENFP ENIILVRADISRLPFA+SSVDAVHAGAALHCWPSP+  VAEISRVLRP
Sbjct  223  YEFIKKEENFPEENIILVRADISRLPFATSSVDAVHAGAALHCWPSPATGVAEISRVLRP  282

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG  S+ PF+R + +   QISGS IF  E+ELEDLC  CGLVG+ C+RN
Sbjct  283  GGVFVATTYILDGPLSYIPFLRNITQRTKQISGSQIFTSERELEDLCKACGLVGYTCVRN  342

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  343  GLFVMISATKPS  354



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  140  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  199

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFA+SS+DAVHAGAA+HCWPSPS  VAEISRVLRP
Sbjct  200  YEFVQQEANFPKENFLLVRADISRLPFAASSIDAVHAGAAIHCWPSPSTGVAEISRVLRP  259

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTYI DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RN
Sbjct  260  GGVFVGTTYIFDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRN  319

Query  543  RRFIMLTAMKPS  578
            R F+M TA KPS
Sbjct  320  RGFVMFTATKPS  331



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ +L PV+GGNIIDASC SGLFSRLFAKSGLFSLVVALD+SE ML QC
Sbjct  161  GFPGPEKEFELMKGFLNPVLGGNIIDASCASGLFSRLFAKSGLFSLVVALDYSENMLAQC  220

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QE+NFP EN ILVRADI+RLPF +SSVDAVHAGAALHCWPSPSA VAEISRVLRP
Sbjct  221  YEFIQQEDNFPKENFILVRADIARLPFVTSSVDAVHAGAALHCWPSPSAVVAEISRVLRP  280

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG ++F PF+  +R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN
Sbjct  281  GGVFVATTYILDGPFTFVPFLSTVRQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRN  340

Query  543  RRFIMLTAMKP  575
              F+M++A KP
Sbjct  341  GPFVMISAAKP  351



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   321 bits (822),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  158  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFA+SS+DAVHAGAA+HCWPSPS  VAEISRVLRP
Sbjct  218  YEFVQQEANFPKENFLLVRADISRLPFAASSIDAVHAGAAIHCWPSPSTGVAEISRVLRP  277

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTYI DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RN
Sbjct  278  GGVFVGTTYIFDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRN  337

Query  543  RRFIMLTAMKPS  578
            R F+M TA KPS
Sbjct  338  RGFVMFTATKPS  349



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   321 bits (822),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEF+L+++YLKPV+G NIIDASCGSGLFSRLFAKSGLFSLVVALD+SE ML+QC
Sbjct  159  GFPGPEKEFDLIKNYLKPVLGKNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEENFP EN+ILVRADISRLPF S SVDAVHAGAA+HCWPSPS AVAEISRVLRP
Sbjct  219  YEFIKQEENFPKENLILVRADISRLPFRSGSVDAVHAGAAIHCWPSPSVAVAEISRVLRP  278

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGV VA+TYI+DG ++F P + PLR+N AQ+SGS IFL E+ELED+C  CGLVGF   RN
Sbjct  279  GGVLVASTYILDGPFNFVPLLGPLRQNIAQVSGSQIFLRERELEDICRACGLVGFTATRN  338

Query  543  RRFIMLTAMKP  575
            R+F+M +A KP
Sbjct  339  RQFVMFSARKP  349



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   320 bits (820),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ +LKPV+GGNIIDASCGSGLFSRLFAKSGLFS VVALD+SE ML+QC
Sbjct  147  GFPGPEKEFELMKSFLKPVLGGNIIDASCGSGLFSRLFAKSGLFSSVVALDYSENMLRQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QE NFP EN  LVRADI+RLPF SSSVDAVHAGAALHCWPSPSAAVAEISRVLRP
Sbjct  207  YEFIQQENNFPKENFNLVRADIARLPFVSSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  266

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG ++  PF+  LR+N  Q+SGS+IFL E+ELE LC  CGLVGFKCIRN
Sbjct  267  GGVFVATTYILDGPFTPVPFLSTLRQNIRQVSGSYIFLSERELEALCKACGLVGFKCIRN  326

Query  543  RRFIMLTAMKP  575
              F+M++A KP
Sbjct  327  GLFVMISATKP  337



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   320 bits (821),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG EKEFEL + YLKPV+GG I+DASCGSGLFSR FAKSGLFSLVVALDFSE ML+QC
Sbjct  159  GFPGLEKEFELAKGYLKPVLGGTIVDASCGSGLFSRTFAKSGLFSLVVALDFSENMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEE FP ENI+LVRADISRLPFASSSVDAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  219  YEFIKQEEGFPKENILLVRADISRLPFASSSVDAVHAGAALHCWPSPSIAVAEISRVLRP  278

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTY++DG +S  PF++ LR+N  +++GSH FL E+ELEDLCT CGL GF C+RN
Sbjct  279  GGVFVATTYLLDGPFSVLPFLKTLRQNMVRVAGSHAFLSERELEDLCTACGLGGFTCVRN  338

Query  543  RRFIMLTAMKPS  578
             RF+M++A KPS
Sbjct  339  GRFVMISATKPS  350



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   319 bits (818),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL+++++ PV+GG+IIDASCGSG+FSR+FAKSGLFS VVALD+SE ML+QC
Sbjct  122  GFPGPEKEFELIKNFITPVLGGSIIDASCGSGMFSRIFAKSGLFSSVVALDYSENMLRQC  181

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRP
Sbjct  182  YEFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRP  241

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T+I+DG YSF PF+R   E   QISGS IFL E+ELE+LCT CGLV FKC+RN
Sbjct  242  GGVFVASTFIMDGPYSFVPFLRIQIEGIQQISGSRIFLSERELEELCTACGLVDFKCLRN  301

Query  543  RRFIMLTAMKPS  578
            R+F+ML+A K S
Sbjct  302  RQFVMLSATKCS  313



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score =   316 bits (810),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ +LKPV+GGNIIDASC SGLFSRLFAKSGLFS VVALD+SE MLQQC
Sbjct  57   GFPGPEKEFELMKGFLKPVLGGNIIDASCASGLFSRLFAKSGLFSFVVALDYSENMLQQC  116

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI++EENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP A VAEISRVLRP
Sbjct  117  YEFIQKEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPSPIAVVAEISRVLRP  176

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTY++DG +S  PF+  LR+N  Q+SGS+IFL E+ELED C  CGLVGFKCIRN
Sbjct  177  GGVFVVTTYMLDGPFSVIPFLSTLRQNARQVSGSYIFLSERELEDHCRACGLVGFKCIRN  236

Query  543  RRFIMLTAMKPS  578
              F M++A KPS
Sbjct  237  GLFEMISATKPS  248



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 171/198 (86%), Gaps = 6/198 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+M+DYLKPV+GGNI+DASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QC
Sbjct  158  GFPGPEKEFEMMKDYLKPVLGGNILDASCGSGLFSRLFAKSGLFSLVTALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA------VAEI  344
            YEFIKQEENFP EN+ILVRADI+RLPF S S+DAVHAGAA+HCWPSPSAA      VAE+
Sbjct  218  YEFIKQEENFPKENLILVRADIARLPFVSGSLDAVHAGAAIHCWPSPSAALFFNSQVAEV  277

Query  345  SRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVG  524
            SRVLRPGGVFVATTYI+DG +SF PF++P+ + F Q SG++ FL E+ELE +C  CGLV 
Sbjct  278  SRVLRPGGVFVATTYILDGPFSFIPFLKPISQRFTQASGNNFFLSERELEAVCRACGLVN  337

Query  525  FKCIRNRRFIMLTAMKPS  578
            F C RNR+FIM +A KPS
Sbjct  338  FTCTRNRQFIMFSATKPS  355



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL + +LKPV+GGNI+DASCGSGLFSRLFAKSGLFSLV+ALD+SE ML+QC
Sbjct  173  GFPGPEKEFELTKGFLKPVLGGNIVDASCGSGLFSRLFAKSGLFSLVIALDYSENMLKQC  232

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+ EENFP E + LVRADISRLPFAS S+DAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  233  YEFIQGEENFPEEKLALVRADISRLPFASGSIDAVHAGAALHCWPSPSTAVAEISRVLRP  292

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTY++DG ++  P +RPL +N +QISGSHIFL E ELEDLC TCGL+GFK +RN
Sbjct  293  GGVFVATTYLLDGPFALFPLLRPLCQNISQISGSHIFLSEGELEDLCRTCGLIGFKFLRN  352

Query  543  RRFIMLTAMKP  575
             RF+M++A +P
Sbjct  353  ERFVMISASRP  363



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   319 bits (817),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ +LKPV+GGNI+DASC SGLFSRLFAKSGLFS VVALD+SE MLQQC
Sbjct  185  GFPGPEKEFELMKGFLKPVLGGNIVDASCASGLFSRLFAKSGLFSFVVALDYSENMLQQC  244

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+Q+ENFP  N ILVRADISRLPF S+SVDAVHAGAALHCWPSP AAVAEISRVLRP
Sbjct  245  YEFIQQDENFPKGNFILVRADISRLPFVSNSVDAVHAGAALHCWPSPLAAVAEISRVLRP  304

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG  S  PF   LR+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN
Sbjct  305  GGVFVATTYILDGPLSVIPFRSTLRQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRN  364

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  365  GLFVMISARKPS  376



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE M+ +LKPV+GGNIIDASCGSGLFSRLFAKSGLFSLVVALD+SE ML+QC
Sbjct  151  GFPGPEKEFEQMKGFLKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLRQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++Q++NFP EN ILVRADI+RLPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRP
Sbjct  211  YEFVQQKDNFPKENFILVRADIARLPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRP  270

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG ++  PF+  LR+   Q+SG + FL E+ELE LC TCGLVGFKCIRN
Sbjct  271  GGVFVATTYILDGPFTIVPFLSTLRQTINQVSGIYTFLSERELEALCKTCGLVGFKCIRN  330

Query  543  RRFIMLTAMKP  575
              F+M++A KP
Sbjct  331  GPFVMISAAKP  341



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL+++++ PV+GG+IIDASCGSG+FSR+FAKSGLFS VVALD+SE ML+QC
Sbjct  185  GFPGPEKEFELIKNFITPVLGGSIIDASCGSGMFSRIFAKSGLFSSVVALDYSENMLRQC  244

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRP
Sbjct  245  YEFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRP  304

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T+I+DG YSF PF+R   E   QISGS IFL E+ELE+LCT CGLV FKC+RN
Sbjct  305  GGVFVASTFIMDGPYSFVPFLRIQIEGIQQISGSRIFLSERELEELCTACGLVDFKCLRN  364

Query  543  RRFIMLTAMKPS  578
            R+F+ML+A K S
Sbjct  365  RQFVMLSATKCS  376



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score =   311 bits (796),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ +LKPV+GGNIIDASC SGLFSRLFAKSGLFS VVALD+SE MLQQC
Sbjct  23   GFPGPEKEFELMKGFLKPVLGGNIIDASCASGLFSRLFAKSGLFSFVVALDYSENMLQQC  82

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI++EENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP  AVAEISRVLRP
Sbjct  83   YEFIQKEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPSP-IAVAEISRVLRP  141

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTY++DG +S  PF+  LR+N  Q+SGS+IFL E+ELED C  CGLVGFKCIRN
Sbjct  142  GGVFVVTTYMLDGPFSVIPFLSTLRQNARQVSGSYIFLSERELEDHCRACGLVGFKCIRN  201

Query  543  RRFIMLTAMKPS  578
              F M++A KPS
Sbjct  202  GLFEMISATKPS  213



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   316 bits (809),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP+KEFE+ +DYLKPV+GG I+DASCGSGLFSRLFAKSGLFS VVALDFSE ML+QC
Sbjct  158  GFPGPDKEFEMAKDYLKPVLGGKIVDASCGSGLFSRLFAKSGLFSSVVALDFSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FI QE++FP EN+ILVRADISRLPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRP
Sbjct  218  YDFINQEKSFPKENLILVRADISRLPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRP  277

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYIVDGI    P  R LR+   QIS SHIFL E+ELEDLC  CGLVGF C RN
Sbjct  278  GGVFVATTYIVDGIVGALPVSRILRQYIGQISSSHIFLSERELEDLCKACGLVGFTCTRN  337

Query  543  RRFIMLTAMKPS  578
              FIM++A KP+
Sbjct  338  GPFIMMSATKPT  349



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QC
Sbjct  164  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQC  223

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN EN++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  224  YELLNQEENFPNKENLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  283

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG++SF PFV+  R+   + SG+H+FL E+ELEDLCT CGLVGF  +R
Sbjct  284  PGGVFVATTFIYDGLFSFIPFVKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVR  343

Query  540  NRRFIMLTAMKP  575
            N  FIML+A KP
Sbjct  344  NGPFIMLSATKP  355



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QC
Sbjct  163  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQC  222

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN EN++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  223  YELLNQEENFPNKENLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  282

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG++SF PFV+  R+   + SG+H+FL E+ELEDLCT CGLVGF  +R
Sbjct  283  PGGVFVATTFIYDGLFSFIPFVKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVR  342

Query  540  NRRFIMLTAMKP  575
            N  FIML+A KP
Sbjct  343  NGPFIMLSATKP  354



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL++D +KPV+GG+IIDASCGSGLFSRLFAKSGLFS VVALD+SE ML+QC
Sbjct  154  GFPGPEKEFELIKDCIKPVLGGSIIDASCGSGLFSRLFAKSGLFSHVVALDYSENMLKQC  213

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI++EENFP ENI LVRADISRLPFA+SS+DAVHAGAA+HCWPSP+ AVAEISRVLRP
Sbjct  214  YEFIEKEENFPKENITLVRADISRLPFATSSIDAVHAGAAIHCWPSPTGAVAEISRVLRP  273

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI+DG ++F PF+R   +   Q+SGS IFL E ELED+CT CGLVG   +RN
Sbjct  274  GGVFVATTYILDGPFAFVPFLREGTKRARQVSGSQIFLSEGELEDICTACGLVGVTVVRN  333

Query  543  RRFIMLTAMKPS  578
            R+F+M++A KPS
Sbjct  334  RQFVMISATKPS  345



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   310 bits (795),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFEL+++++ PV+GG+IIDASCGSG+FSR+FAKSGLFS VVALD+SE ML+QC
Sbjct  165  GFPGPEKEFELIKNFITPVLGGSIIDASCGSGMFSRIFAKSGLFSSVVALDYSENMLRQC  224

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y FIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAA+HCWPSPSA VAEISR+LRP
Sbjct  225  YGFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAAVHCWPSPSAGVAEISRILRP  284

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T+I+DG +SF PF+R   E   QI+GS IFL E+ELE+LCT CGLV FKC+RN
Sbjct  285  GGVFVASTFIMDGPFSFVPFLRIQIEGIQQIAGSRIFLSERELEELCTACGLVDFKCLRN  344

Query  543  RRFIMLTAMKPS  578
            R+F+ML+A K S
Sbjct  345  RQFVMLSATKRS  356



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 169/193 (88%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLV+ALD+SE ML+QC
Sbjct  160  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSELFSLVIALDYSENMLRQC  219

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  220  YELLNQEENFPNREKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  279

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++ LR+   + SGSH+FL+E+ELEDLC  CGLVGF  +R
Sbjct  280  PGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHMFLNERELEDLCKACGLVGFTRVR  339

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KPS
Sbjct  340  NGPFIMLSATKPS  352



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QC
Sbjct  168  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQC  227

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  228  YELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  287

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG++SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +R
Sbjct  288  PGGVFVATTFIYDGLFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVR  347

Query  540  NRRFIMLTAMKP  575
            N  FIML+A KP
Sbjct  348  NGPFIMLSATKP  359



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QC
Sbjct  167  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQC  226

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  227  YELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  286

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG++SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +R
Sbjct  287  PGGVFVATTFIYDGLFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVR  346

Query  540  NRRFIMLTAMKP  575
            N  FIML+A KP
Sbjct  347  NGPFIMLSATKP  358



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   305 bits (782),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            G PGPEKEFEL+  +LKPV+GGNI+DASCGSGLFSRLFAKSGLFS V+ALD+SE ML+QC
Sbjct  103  GSPGPEKEFELIMGFLKPVLGGNIVDASCGSGLFSRLFAKSGLFSRVIALDYSENMLKQC  162

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QEENFP EN  LVRADISRLPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRP
Sbjct  163  YEFIQQEENFPEENFALVRADISRLPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRP  222

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+++DG  +  P +RPL +   Q+SGSHIFL E ELE LC TCGL+G K +RN
Sbjct  223  GGVFVATTFLLDGPSALFPLLRPLCQISTQLSGSHIFLSEGELEGLCRTCGLIGVKFVRN  282

Query  543  RRFIMLTAMKPS  578
             RF+M++A KPS
Sbjct  283  ERFVMISASKPS  294



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QC
Sbjct  165  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQC  224

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  225  YELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  284

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +R
Sbjct  285  PGGVFVATTFIYDGPFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVR  344

Query  540  NRRFIMLTAMKP  575
            N  FIML+A KP
Sbjct  345  NGPFIMLSATKP  356



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QC
Sbjct  164  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQC  223

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  224  YELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  283

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +R
Sbjct  284  PGGVFVATTFIYDGPFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVR  343

Query  540  NRRFIMLTAMKP  575
            N  FIML+A KP
Sbjct  344  NGPFIMLSATKP  355



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   306 bits (783),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            G+PGP+KEFEL++ YL+PV+GGNIIDASCGSG F+RLF KSGLFSLVVALD+SE ML++C
Sbjct  155  GWPGPQKEFELIKGYLEPVLGGNIIDASCGSGPFTRLFTKSGLFSLVVALDYSENMLREC  214

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIK+EENFP E++ILVRADISRLPF SSSVDAVHAGAA+HCW SPS+AVAEISRVLRP
Sbjct  215  YEFIKKEENFPKEDLILVRADISRLPFVSSSVDAVHAGAAVHCWSSPSSAVAEISRVLRP  274

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FVATT+I DG Y+  PF + +++N  +ISG   FL E ELEDLC TCGL  FKC RN
Sbjct  275  GGIFVATTFIYDGPYALNPFSKLMQKNMFRISGGQFFLSEHELEDLCKTCGLEDFKCTRN  334

Query  543  RRFIMLTAMKPS  578
            RRF+M++A KPS
Sbjct  335  RRFVMISATKPS  346



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   306 bits (783),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            G PGPEKEFEL+  +LKPV+GGNI+DASCGSGLFSRLFAKSGLFS V+ALD+SE ML+QC
Sbjct  163  GSPGPEKEFELIMGFLKPVLGGNIVDASCGSGLFSRLFAKSGLFSRVIALDYSENMLKQC  222

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QEENFP EN  LVRADISRLPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRP
Sbjct  223  YEFIQQEENFPEENFALVRADISRLPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRP  282

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+++DG  +  P +RPL +   Q+SGSHIFL E ELE LC TCGL+G K +RN
Sbjct  283  GGVFVATTFLLDGPSALFPLLRPLCQISTQLSGSHIFLSEGELEGLCRTCGLIGVKFVRN  342

Query  543  RRFIMLTAMKPS  578
             RF+M++A KPS
Sbjct  343  ERFVMISASKPS  354



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   305 bits (782),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QC
Sbjct  154  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSELFSLVVALDYSENMLRQC  213

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + QEENFPN E ++LVRADI+RLPF S S+DAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  214  YELLNQEENFPNKEKLVLVRADIARLPFLSGSLDAVHAGAALHCWPSPSSAVAEISRVLR  273

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++ LR+ F   SGSH+FL E+ELEDLC  CGLVGF  +R
Sbjct  274  PGGVFVATTFIYDGPFSFIPFLKNLRQEFMSYSGSHVFLSERELEDLCKACGLVGFTRVR  333

Query  540  NRRFIMLTAMK  572
            N  FIML+A K
Sbjct  334  NGPFIMLSATK  344



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   305 bits (782),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            G PGPEKEFEL+  +LKPV+GGNI+DASCGSGLFSRLFAKSGLFS V+ALD+SE ML+QC
Sbjct  163  GSPGPEKEFELIMGFLKPVLGGNIVDASCGSGLFSRLFAKSGLFSRVIALDYSENMLKQC  222

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QEENFP EN +LVRADISRLPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRP
Sbjct  223  YEFIQQEENFPEENFLLVRADISRLPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRP  282

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGV VATT ++DG ++  P +RPL +   Q+SGSHIF  E ELE LC TCGL+G K +RN
Sbjct  283  GGVLVATTLLLDGPFALFPLLRPLSQISTQLSGSHIFRSEGELEGLCRTCGLIGVKFVRN  342

Query  543  RRFIMLTAMKPS  578
            +RF+M++A KPS
Sbjct  343  KRFVMISASKPS  354



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   305 bits (781),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 168/193 (87%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV+GGNIIDASCGSG+FSRLFA+S LFSLV+ALD+SE ML+QC
Sbjct  158  GFPGPEKEFEMAKDYLKPVLGGNIIDASCGSGMFSRLFARSELFSLVIALDYSENMLRQC  217

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YEF+ QEEN  N E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVL+
Sbjct  218  YEFLNQEENVTNKEKVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLK  277

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++ +R+   + SGSHIFL E+EL+D+C  CGLVGF C+R
Sbjct  278  PGGVFVATTFIYDGPFSFIPFLKNIRQEIMRYSGSHIFLSERELKDICGACGLVGFTCVR  337

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KPS
Sbjct  338  NGPFIMLSATKPS  350



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   305 bits (780),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RLFAKSGLFS V+ALD+SE MLQQC
Sbjct  147  GFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRLFAKSGLFSQVIALDYSENMLQQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QEENFP E + LVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  207  YEFIEQEENFPKEKVTLVRADISRLPFESSSIDAVHAGAALHCWPSPSTAVAEISRVLRP  266

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYIVDG ++F PFV   R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN
Sbjct  267  GGVFVATTYIVDGPFTFLPFVNAFRQNMMGIAGSYFAVSERELEDLCRTCGLVGFTCMRN  326

Query  543  RRFIMLTAMKPS  578
              F+M++A K S
Sbjct  327  GPFVMISARKRS  338



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RLFAKSGLFS V+ALD+SE MLQQC
Sbjct  157  GFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRLFAKSGLFSQVIALDYSENMLQQC  216

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+QEENFP E + LVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  217  YEFIEQEENFPKEKVTLVRADISRLPFESSSIDAVHAGAALHCWPSPSTAVAEISRVLRP  276

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYIVDG ++F PFV   R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN
Sbjct  277  GGVFVATTYIVDGPFTFLPFVNAFRQNMMGIAGSYFAVSERELEDLCRTCGLVGFTCMRN  336

Query  543  RRFIMLTAMKPS  578
              F+M++A K S
Sbjct  337  GPFVMISARKRS  348



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGPEKEFEL++D+LKPV+GG NIIDASCGSG+FSRLFAKSGLFSLVVALD+SE ML++
Sbjct  99   GFPGPEKEFELIKDFLKPVLGGGNIIDASCGSGMFSRLFAKSGLFSLVVALDYSENMLKE  158

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            CY FI+QE+NFP EN+ILVRADISRLPFA+SSVDAVHAGAA+HCWPSPS+AVAEISRVLR
Sbjct  159  CYGFIQQEDNFPKENMILVRADISRLPFATSSVDAVHAGAAIHCWPSPSSAVAEISRVLR  218

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +S  PF R + +   Q+SG+ +F  E EL+D+C  CGLVGF  +R
Sbjct  219  PGGVFVATTFIWDGPFSLIPFQRNIAQRTKQMSGNQLFTSESELQDICQACGLVGFTKVR  278

Query  540  NRRFIMLTAMKP  575
            N RF+M++A KP
Sbjct  279  NGRFVMISATKP  290



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   302 bits (774),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEF++ ++YLK V+GG IIDASCGSG+F+RLFAKSGLFS V+ALD+SE ML+QC
Sbjct  157  GFPGPEKEFDMAKNYLKRVLGGKIIDASCGSGMFTRLFAKSGLFSQVIALDYSENMLRQC  216

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQEENFP E + LVRADISRLPF S+S+DAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  217  YEFIKQEENFPKEKVTLVRADISRLPFESNSIDAVHAGAALHCWPSPSTAVAEISRVLRP  276

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATTYI DG ++F PFV   R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN
Sbjct  277  GGVFVATTYIFDGPFTFLPFVNTFRQNMMGIAGSYFAVSEQELEDLCRTCGLVGFTCMRN  336

Query  543  RRFIMLTAMKPS  578
              F+M++A K S
Sbjct  337  GPFVMISARKRS  348



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 166/193 (86%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ ++YLKPV+GGNIIDASCGSG+FSRLFAKS LFS V+ALD+SE ML+QC
Sbjct  146  GFPGPEKEFEMAREYLKPVLGGNIIDASCGSGMFSRLFAKSELFSRVIALDYSENMLKQC  205

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YEF+ QEEN  N EN++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  206  YEFLNQEENLTNKENVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  265

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL E+ELEDLC   GLVGF  +R
Sbjct  266  PGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVR  325

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KPS
Sbjct  326  NGLFIMLSATKPS  338



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGPEKEFEL++D+ KPV+GG N+IDASCGSG+FSRLFAKSGLFSLVVALD+SE ML++
Sbjct  156  GFPGPEKEFELIKDFFKPVLGGGNVIDASCGSGMFSRLFAKSGLFSLVVALDYSENMLKE  215

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            CY FI+QEENFP EN+ILVRADISRLPFA+SSVDAVHAGAA+HCWPSPS+AVAEISRVLR
Sbjct  216  CYGFIQQEENFPKENMILVRADISRLPFATSSVDAVHAGAAIHCWPSPSSAVAEISRVLR  275

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +S  PF R + +   Q+SG+ +F  E ELED+C  CGLVGF  +R
Sbjct  276  PGGVFVATTFIWDGPFSLIPFQRNIAQRTKQMSGNQLFTSESELEDICQACGLVGFTKVR  335

Query  540  NRRFIMLTAMKP  575
            NRRF+M++  KP
Sbjct  336  NRRFVMISCTKP  347



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 166/193 (86%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ + YLKPV+GGNIIDASCGSG+FSRLF +S LFSLV+ALD+SE ML+QC
Sbjct  163  GFPGPEKEFEMAKAYLKPVLGGNIIDASCGSGMFSRLFTRSDLFSLVIALDYSENMLRQC  222

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YE + +EENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  223  YELLNKEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  282

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL+E+ELED+C  CGLV F  +R
Sbjct  283  PGGVFVATTFIYDGPFSFIPFLKNLRQEIMRYSGSHIFLNERELEDICKACGLVNFTRVR  342

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KPS
Sbjct  343  NGPFIMLSATKPS  355



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   300 bits (768),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGPEKEFEL +D+LKPV+GG NIIDASCGSG+FSRLFAKSGLFSLVVALD+SE ML++
Sbjct  163  GFPGPEKEFELTKDFLKPVLGGGNIIDASCGSGMFSRLFAKSGLFSLVVALDYSENMLKE  222

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            CY FI+QEENFP E +ILVRADISRLPFA+ SVDAVHAGAA+HCWPSPS AVAEISRVLR
Sbjct  223  CYGFIQQEENFPKEXMILVRADISRLPFATGSVDAVHAGAAIHCWPSPSTAVAEISRVLR  282

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVA+TYI+DG +S  PF+R + +   QISG  +F  E ELED+C  CGLV F  +R
Sbjct  283  PGGVFVASTYILDGPFSLIPFLRNITQRTKQISGGQVFTSESELEDICQACGLVXFTKVR  342

Query  540  NRRFIMLTAMKPS  578
            NR F+M++A KP+
Sbjct  343  NRLFVMISATKPT  355



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV GGNIIDASCGSG+FSRLFA+S LFS VVALD+SE ML+QC
Sbjct  148  GFPGPEKEFEMAKDYLKPVFGGNIIDASCGSGMFSRLFARSELFSRVVALDYSENMLKQC  207

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            Y+F+ QEEN  N E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  208  YDFLNQEENLTNKEKVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  267

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL E+ELEDLC   GLVGF  +R
Sbjct  268  PGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVR  327

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KPS
Sbjct  328  NGLFIMLSATKPS  340



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +DYLKPV GGNIIDASCGSG+FSRLFA+S LFS VVALD+SE ML+QC
Sbjct  148  GFPGPEKEFEMAKDYLKPVFGGNIIDASCGSGMFSRLFARSELFSRVVALDYSENMLKQC  207

Query  183  YEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            Y+F+ QEEN  N E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  208  YDFLNQEENLTNKEKVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  267

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL E+ELEDLC   GLVGF  +R
Sbjct  268  PGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVR  327

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KPS
Sbjct  328  NGLFIMLSATKPS  340



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+EFE+ +DYLKP +GG IIDASCGSG+FSRLFA+SGLFS V+ALD+SE ML+QC
Sbjct  159  GFPGPEREFEMAKDYLKPALGGKIIDASCGSGMFSRLFARSGLFSQVIALDYSENMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF+ QEENFP E I+LVRADISRLPF S SVDAVHAGAALHCWPSP++AVAE+SRVLRP
Sbjct  219  YEFVNQEENFPKEKIVLVRADISRLPFLSGSVDAVHAGAALHCWPSPASAVAEVSRVLRP  278

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+I + + SF PF R +R+   + SGSH FL E+ELED+C  CGLVGF C+RN
Sbjct  279  GGVFVATTFINEPL-SFIPFSRNIRQGVIRYSGSHFFLSERELEDVCRACGLVGFNCVRN  337

Query  543  RRFIMLTAMKP  575
              FIML+A KP
Sbjct  338  GPFIMLSATKP  348



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   298 bits (764),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+EFE+ +DYLKP +GG IIDASCGSG+FSRLFA+SGLFS V+ALD+SE ML+QC
Sbjct  166  GFPGPEREFEMAKDYLKPALGGKIIDASCGSGMFSRLFARSGLFSQVIALDYSENMLRQC  225

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF+ QEENFP E I+LVRADISRLPF S SVDAVHAGAALHCWPSP++AVAE+SRVLRP
Sbjct  226  YEFVNQEENFPKEKIVLVRADISRLPFLSGSVDAVHAGAALHCWPSPASAVAEVSRVLRP  285

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+I + + SF PF R +R+   + SGSH FL E+ELED+C  CGLVGF C+RN
Sbjct  286  GGVFVATTFINEPL-SFIPFSRNIRQGVIRYSGSHFFLSERELEDVCRACGLVGFNCVRN  344

Query  543  RRFIMLTAMKP  575
              FIML+A KP
Sbjct  345  GPFIMLSATKP  355



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   297 bits (761),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            G+PG +KEFE+ ++Y KPV+GGNI+DASCGSGLFSRLFAKSGLFS VVALD+SE MLQQC
Sbjct  158  GYPGADKEFEMAKEYFKPVLGGNIVDASCGSGLFSRLFAKSGLFSRVVALDYSEAMLQQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF+K++  FP E +ILVRADISRLPF S S+DAVHAGAALHCWPSPS A AEISR+LRP
Sbjct  218  YEFVKEDPGFPKEKLILVRADISRLPFVSGSIDAVHAGAALHCWPSPSNAGAEISRILRP  277

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT I DG ++  PF    RE   QISGS IFL E+ELEDLCTTCGLV F+C RN
Sbjct  278  GGVFVATTTIGDGPFTLVPFRSNFREYLQQISGSRIFLSERELEDLCTTCGLVDFRCTRN  337

Query  543  RRFIMLTAMKPS  578
              F+M++A KP+
Sbjct  338  GLFVMISATKPN  349



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+  +YLK V+GGNIIDASCGSGLFSRLFAKS  F++V ALD+SE ML+QC
Sbjct  144  GFPGPEKEFEMASEYLKHVLGGNIIDASCGSGLFSRLFAKSEHFAMVYALDYSENMLRQC  203

Query  183  YEFIKQEENFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YEF+KQE N  ++ I+ L RADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  204  YEFLKQEANLIDKKIVVLARADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  263

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG++ F PF++ LR+   + SGSH+FL E+ELEDLC +CGLVGF C+R
Sbjct  264  PGGVFVATTFIYDGLFRFVPFLKELRQEIMRYSGSHMFLSERELEDLCKSCGLVGFTCVR  323

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KP+
Sbjct  324  NGLFIMLSATKPT  336



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+  +YLK V+GGNIIDASCGSGLFSRLFAKS  F++V ALD+SE ML+QC
Sbjct  155  GFPGPEKEFEMASEYLKHVLGGNIIDASCGSGLFSRLFAKSEHFAMVYALDYSENMLRQC  214

Query  183  YEFIKQEENFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YEF+KQE N  ++ I+ L RADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  215  YEFLKQEANLIDKKIVVLARADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  274

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG++ F PF++ LR+   + SGSH+FL E+ELEDLC +CGLVGF C+R
Sbjct  275  PGGVFVATTFIYDGLFRFVPFLKELRQEIMRYSGSHMFLSERELEDLCKSCGLVGFTCVR  334

Query  540  NRRFIMLTAMKPS  578
            N  FIML+A KP+
Sbjct  335  NGLFIMLSATKPT  347



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            G PGPEKEFE  +++LKPV+GG NIIDASCGSGLFSR FAKSGLFSLVVALD+SE ML++
Sbjct  163  GLPGPEKEFEWTKNFLKPVLGGGNIIDASCGSGLFSRRFAKSGLFSLVVALDYSENMLKE  222

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            CY FI+QEENFP EN ILVRADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLR
Sbjct  223  CYGFIQQEENFPKENXILVRADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLR  282

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVA+TYI+DG +S  PF+R +     QISGS +F  E E EDLC  CGLVGF  +R
Sbjct  283  PGGVFVASTYILDGRFSLIPFLRNITRVTKQISGSQVFTSESEFEDLCQACGLVGFTKVR  342

Query  540  NRRFIMLTAMKPS  578
               F+M++A KP+
Sbjct  343  YGLFVMISATKPT  355



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 165/196 (84%), Gaps = 1/196 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ ++YLK V+GGNIIDASCGSG+FSRLFAKS  F++V ALD+SE ML+QC
Sbjct  155  GFPGPEKEFEMAKEYLKHVLGGNIIDASCGSGIFSRLFAKSEHFAMVYALDYSENMLRQC  214

Query  183  YEFIKQEENFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            YEF+KQE N  ++ I+ L RADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLR
Sbjct  215  YEFLKQEANLIDKKIVVLARADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLR  274

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I DG+  F PF++ LR+     SGSH+FL E+ELEDLC +CGLVGF C+R
Sbjct  275  PGGVFVATTFIYDGLVRFVPFLKELRQEVMGYSGSHMFLSERELEDLCKSCGLVGFTCVR  334

Query  540  NRRFIMLTAMKPS*LL  587
            N  FIML+A KP+ +L
Sbjct  335  NGLFIMLSATKPTDML  350



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            G PGPEKEFE  +++LKPV+GG NIIDASCGSGLFSR FAKSGLFSLVVALD+SE ML++
Sbjct  156  GLPGPEKEFEWTKNFLKPVLGGGNIIDASCGSGLFSRRFAKSGLFSLVVALDYSENMLKE  215

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            CY FI+QEENFP EN ILVRADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLR
Sbjct  216  CYGFIQQEENFPKENXILVRADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLR  275

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVA+TYI+DG +S  PF+R +     QISGS +F  E E EDLC  CGLVGF  +R
Sbjct  276  PGGVFVASTYILDGRFSLIPFLRNITRVTKQISGSQVFTSESEFEDLCQACGLVGFTKVR  335

Query  540  NRRFIMLTAMKPS  578
               F+M++A KP+
Sbjct  336  YGLFVMISATKPT  348



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+EFE+ + YLKP  GG IIDASCGSGLFSRLFAKSG+FSLV+ALDFSE MLQQC
Sbjct  165  GFPGPEREFEMAKGYLKPSTGGTIIDASCGSGLFSRLFAKSGMFSLVIALDFSENMLQQC  224

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y FI QE   P EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRP
Sbjct  225  YNFINQE-GMPRENLILVRADISRLPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRP  283

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+I+D +    P ++ +R+ + + S ++++L E ELEDLC TCGLV F C+RN
Sbjct  284  GGVFVATTFILDVLPPVIPILKTVRQYYIRASSNYLYLSEGELEDLCQTCGLVNFTCVRN  343

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  344  GPFVMISATKPS  355



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+EFE+ + YLKP  GG IIDASCGSGLFSRLFAKSG+FSLV+ALDFSE MLQQC
Sbjct  162  GFPGPEREFEMAKGYLKPSTGGTIIDASCGSGLFSRLFAKSGMFSLVIALDFSENMLQQC  221

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y FI QE   P EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRP
Sbjct  222  YNFINQE-GMPRENLILVRADISRLPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRP  280

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+I+D +    P ++ +R+ + + S ++++L E ELEDLC TCGLV F C+RN
Sbjct  281  GGVFVATTFILDVLPPVIPILKTVRQYYIRASSNYLYLSEGELEDLCQTCGLVNFTCVRN  340

Query  543  RRFIMLTAMKPS  578
              F+M++A KPS
Sbjct  341  GPFVMISATKPS  352



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   285 bits (729),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 164/201 (82%), Gaps = 9/201 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ +++LK V+GGNIIDASCGSGLFSRLFAKS  F++V ALD+SE ML+QC
Sbjct  155  GFPGPEKEFEMAKEHLKHVLGGNIIDASCGSGLFSRLFAKSEHFAMVYALDYSENMLRQC  214

Query  183  YEFIKQEENFPNENII-LVRADISRL--------PFASSSVDAVHAGAALHCWPSPSAAV  335
            YEF+KQE N  ++ I+ L RADI+RL        PF S  VDAVHAGAALHCWPSPS+AV
Sbjct  215  YEFLKQEANLIDKKIVVLARADIARLQGHGPARLPFLSGVVDAVHAGAALHCWPSPSSAV  274

Query  336  AEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCG  515
            AEISRVLRPGGVFVATT+I DG++ F PF++ LR+   + SGSH+FL E+ELEDLC +CG
Sbjct  275  AEISRVLRPGGVFVATTFIYDGLFRFVPFLKKLRQEVMRYSGSHMFLSERELEDLCESCG  334

Query  516  LVGFKCIRNRRFIMLTAMKPS  578
            LVGF C+RN  FIML+A KP+
Sbjct  335  LVGFTCVRNGLFIMLSATKPT  355



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EFE+ + YL P +GG I+DASCGSGLFSRLFA+SG++SLVVALDFSE ML QC
Sbjct  151  GFPGPQREFEMAKVYLTPTIGGTIVDASCGSGLFSRLFAESGMYSLVVALDFSENMLLQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EFIKQ+     EN+ILVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  211  DEFIKQK-GISKENLILVRADISRLPFVSSSIDAVHAGAALHCWPSPSTAVAEISRVLRP  269

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+++D I    P  R +RE F++ SG H++L E ELED+C  CGL+GF CIRN
Sbjct  270  GGVFVATTFVLDTIPPAVPIFRAIREFFSRNSGQHLYLSEGELEDICRACGLIGFTCIRN  329

Query  543  RRFIMLTAMKPS  578
              FIM++A KPS
Sbjct  330  GFFIMISATKPS  341



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 151/192 (79%), Gaps = 17/192 (9%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  158  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP +                 S+DAVHAGAA+HCW SPS  VAEISRVLRP
Sbjct  218  YEFVQQESNFPKD-----------------SIDAVHAGAAIHCWSSPSTGVAEISRVLRP  260

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RN
Sbjct  261  GGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRN  320

Query  543  RRFIMLTAMKPS  578
            R F+M TA KPS
Sbjct  321  RGFVMFTATKPS  332



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   276 bits (707),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 156/191 (82%), Gaps = 1/191 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EFE+ + YL P +GG I+DASCGSGLFSRLFA+SG++SLVVALDFSE ML QC
Sbjct  149  GFPGPQREFEMAKVYLTPTIGGTIVDASCGSGLFSRLFAESGMYSLVVALDFSENMLLQC  208

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EFIKQ+     EN+ILVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRP
Sbjct  209  DEFIKQK-GISKENLILVRADISRLPFVSSSIDAVHAGAALHCWPSPSTAVAEISRVLRP  267

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+++D I    P  R +RE + + SG H++L E ELED+C+ CGL+GF  IRN
Sbjct  268  GGVFVATTFVLDTIPPAVPIFRAIRELYTRTSGQHLYLSEGELEDICSACGLIGFTRIRN  327

Query  543  RRFIMLTAMKP  575
              FIM++A KP
Sbjct  328  GSFIMISATKP  338



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+E E+ + YL+P  GG I+DASCGSGLFSRLFAKSG++SLVVALDFSE MLQ C
Sbjct  123  GFPGPERELEMAKYYLRPAKGGTIVDASCGSGLFSRLFAKSGIYSLVVALDFSENMLQHC  182

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FIKQE     +N+ILVRADI RLPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRP
Sbjct  183  NKFIKQE-GISKKNLILVRADICRLPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRP  241

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+I D I    P +R LR+ +   S ++IFL E EL+DLC  CGLVG  CIR+
Sbjct  242  GGVFVATTFIFDVIPIAVPVLRMLRKFYIGNSSNYIFLSEGELKDLCEACGLVGVTCIRH  301

Query  543  RRFIMLTAMKPS  578
            R F+M++A+KP+
Sbjct  302  RLFVMISAIKPN  313



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   265 bits (678),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+E E+ + YL+P  GG I+DASCGSGLFSRLFAKSG++SLVVALDFSE MLQ C
Sbjct  123  GFPGPERELEMAKYYLRPAKGGTIVDASCGSGLFSRLFAKSGIYSLVVALDFSENMLQHC  182

Query  183  YEFIKQEE-NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             +FIKQE  +   EN+ILVRADI RLPF SSS+DAVHAGAALHCW SPSAAVAEISR+LR
Sbjct  183  NKFIKQEGISKKYENLILVRADICRLPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILR  242

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            PGGVFVATT+I D I    P +R LR+ +   S ++IFL E EL+DLC  CGLVG  CIR
Sbjct  243  PGGVFVATTFIFDVIPIAVPVLRMLRKFYIGNSSNYIFLSEGELKDLCEACGLVGVTCIR  302

Query  540  NRRFIMLTAMKPS  578
            +R F+M++A+KP+
Sbjct  303  HRLFVMISAIKPN  315



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++E E+ ++YL+P  GG I+DASCGSGLFSR FAKSG++SLVVALDFSE MLQ C
Sbjct  123  GFPGLQREIEMAKNYLRPAKGGTIVDASCGSGLFSRQFAKSGMYSLVVALDFSENMLQHC  182

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FIKQE     +N+ILVRAD+SRLPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRP
Sbjct  183  NKFIKQE-GISKKNLILVRADVSRLPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRP  241

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+I D I    P +R LR+ +   SG ++FL E EL+DLC  CGLV   CIRN
Sbjct  242  GGVFVATTFIFDAIPIAVPVLRMLRKFYIGNSGKYMFLSEGELKDLCQACGLVDVTCIRN  301

Query  543  RRFIMLTAMKPS  578
            R F+M+ A KPS
Sbjct  302  RLFVMIAATKPS  313



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EFE+ + YLKP +GG I+DASCGSGLFSRLF KSGL+SLVVALDFSE ML+QC
Sbjct  158  GFPGLEREFEMAKTYLKPTIGGTIVDASCGSGLFSRLFIKSGLYSLVVALDFSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             ++IKQE N  +E ++LVRADISRLPF S S+DA+HAGAA+HCWPSP+ AVA+ISRVLRP
Sbjct  218  NQYIKQE-NISDERLVLVRADISRLPFVSGSIDALHAGAAIHCWPSPACAVADISRVLRP  276

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FVA+T++ D I    P ++ +R   +QI+G++ FL E ELEDLC  CGLV FK +R+
Sbjct  277  GGIFVASTFVADVIPPAIPVLKIVRPYISQITGNNTFLSEVELEDLCKACGLVDFKFVRS  336

Query  543  RRFIMLTAMK  572
              +IM +A K
Sbjct  337  GFYIMFSATK  346



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EFE+ + YLKP  GG I+DASCGSGLFSRLF KSGL+SLVVALDFSE ML+QC
Sbjct  162  GFPGLEREFEMAKTYLKPTFGGTIVDASCGSGLFSRLFVKSGLYSLVVALDFSENMLKQC  221

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             E+IKQE N  +E + LVRADISRLPF S S+DAVHAGAA+HCWPSP+ AVA+ISRVLRP
Sbjct  222  NEYIKQE-NISDERLALVRADISRLPFVSGSIDAVHAGAAIHCWPSPACAVADISRVLRP  280

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T++ D I    P +R  R   +QI+G++ FL E E EDLC  CGLV FK +R+
Sbjct  281  GGVFVASTFVADVIPPVIPVLRIGRPYISQITGNNTFLSEVEFEDLCKACGLVDFKFVRS  340

Query  543  RRFIMLTAMKPS  578
              +IM +A K S
Sbjct  341  GFYIMFSATKAS  352



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGPEKEFEL++D+LKPV+GG NIIDASCGSG+FSRLFAKSGLFSLVVALD+SE ML++
Sbjct  163  GFPGPEKEFELIKDFLKPVLGGGNIIDASCGSGMFSRLFAKSGLFSLVVALDYSENMLKE  222

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            CY FI+QEENFP EN+ILVRADISRLPFA+ SVDAVHAGAA+HCWPSPS AVAEISRVLR
Sbjct  223  CYGFIQQEENFPKENMILVRADISRLPFATGSVDAVHAGAAIHCWPSPSTAVAEISRVLR  282

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSH  467
            PGGVFVA+TYI+DG +S  PF+R + +   QI+GS 
Sbjct  283  PGGVFVASTYILDGPFSLIPFLRNITQRTKQIAGSE  318



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   254 bits (649),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+E+E  + YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDFSE ML+QC
Sbjct  168  GFPGPEREYETAKAYLKPTAGGIIVDASCGSGLFSRLFVKSELYSLVVALDFSENMLKQC  227

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EFIK EEN  +E + LVRADISRLPF S S+DAVHAGAA+HCWPSP+ AVAEISRVLRP
Sbjct  228  NEFIK-EENISDEKLALVRADISRLPFVSGSIDAVHAGAAIHCWPSPACAVAEISRVLRP  286

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T++ D +    P +R  R   +Q +G++IFL E E EDLC  CGLV F  +RN
Sbjct  287  GGVFVASTFVADILPPAVPVLRIGRPYISQFTGTNIFLSEVEFEDLCRACGLVDFTFVRN  346

Query  543  RRFIMLTAMKPS  578
              +IM +A K S
Sbjct  347  GFYIMFSATKAS  358



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  158  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRP
Sbjct  218  YEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRP  277

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRE  440
            GGVFV TTYIVDG ++  PF R LR+
Sbjct  278  GGVFVGTTYIVDGPFNLIPFSRLLRQ  303



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EFE+ + YL P +GG I+DASCGSGLFSRLF KSGL+SLVVALDFSE ML+QC
Sbjct  160  GFPGLEREFEMAKTYLNPTIGGTIVDASCGSGLFSRLFVKSGLYSLVVALDFSENMLKQC  219

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             E++KQE N  +E + LVRADISRLPF + S+DAVHAGAA+HCWPSP+ AVAEISRVLR 
Sbjct  220  NEYVKQE-NISDERLALVRADISRLPFVNGSIDAVHAGAAIHCWPSPACAVAEISRVLRS  278

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FVA+T++ D I    P +R  R   +QI G++ FL E ELEDLC  CGLV FK +R+
Sbjct  279  GGIFVASTFVADVIPPAIPILRIARPYISQIGGNNTFLSEVELEDLCKACGLVDFKFVRS  338

Query  543  RRFIMLTAMKPS  578
              +IM +A K S
Sbjct  339  GFYIMFSATKAS  350



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 149/195 (76%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  156  GFPGPDEEFNMAQEYFKPVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLRQC  215

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            +EFIKQ+E     N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR 
Sbjct  216  FEFIKQDETLSTINLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRS  275

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++   + +  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ + 
Sbjct  276  GGVFVATTFLSSPLNN--PFSSEALRPLRQFFGQENNSYNYFTEKEIEDLCKSCGLINYT  333

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +A KP
Sbjct  334  SKVQRSFIMFSAQKP  348



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 148/193 (77%), Gaps = 2/193 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+Y KPV GG ++D SCGSGLFSR FAKSG FS VVALDFSE ML+QC
Sbjct  161  GFPGLDEEFNMAQEYFKPVAGGLLVDVSCGSGLFSRKFAKSGSFSAVVALDFSENMLRQC  220

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ++     N+ LVRAD+SRLPFAS S+DAVHAGAALHCWPSPS AVAEISRVLR 
Sbjct  221  YEFIKQDDTLITTNLALVRADVSRLPFASGSIDAVHAGAALHCWPSPSNAVAEISRVLRS  280

Query  363  GGVFVATTYIVDGIYSFTPF--VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCI  536
            GGVFVATT++V  + +  P    + LR++F Q++ S+ +  EKE+EDLC +CGLV +   
Sbjct  281  GGVFVATTFLVSPLNTPLPLEAFQSLRQSFGQVTNSYNYFTEKEIEDLCRSCGLVNYTST  340

Query  537  RNRRFIMLTAMKP  575
              R FIM +A KP
Sbjct  341  VRRSFIMFSAQKP  353



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDFSE ML+QC
Sbjct  168  GFPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRLFVKSELYSLVVALDFSENMLKQC  227

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             E++KQE N  ++ + L RADISRLPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRP
Sbjct  228  NEYVKQE-NISDKTLALARADISRLPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRP  286

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVA+T++ D +    P +R  R   +Q +GS+IFL E E EDLC  CGL+ FK +RN
Sbjct  287  GGVFVASTFVADILPPAVPVLRIGRPYISQFTGSNIFLSEAEFEDLCRACGLIDFKFVRN  346

Query  543  RRFIMLTAMKPS  578
              +IM +A K S
Sbjct  347  GFYIMFSATKAS  358



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 11/189 (6%)
 Frame = +3

Query  24   EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE  203
            +FE+ + YLKPV+GGNI+DASCGSGLFSRLFAKSGLFS VVALD+SE ML+QCYE  K  
Sbjct  205  DFEMAKKYLKPVLGGNIVDASCGSGLFSRLFAKSGLFSQVVALDYSENMLRQCYEKRKT-  263

Query  204  ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA----VAEISRVLRPGGV  371
                +  + LVRADISRLPF SSSVDA+HAGAALHCWPSPS A      ++ +VLRPGG+
Sbjct  264  ----SPKMTLVRADISRLPFKSSSVDALHAGAALHCWPSPSTACLLYAGQLQQVLRPGGL  319

Query  372  FVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRF  551
            FVATTYI+DG   F PF+R   +N   I+GSH+FL E+ELEDLC TCGL+GF CIRN  F
Sbjct  320  FVATTYILDG--PFIPFLRTFHQNVMGIAGSHVFLSERELEDLCRTCGLIGFTCIRNSCF  377

Query  552  IMLTAMKPS  578
            +M++A K S
Sbjct  378  VMISARKRS  386



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   248 bits (632),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 147/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML QC
Sbjct  123  GFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQC  182

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            +EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR 
Sbjct  183  FEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRS  242

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ + 
Sbjct  243  GGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYT  300

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +A KP
Sbjct  301  SKVQRSFIMFSAQKP  315



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score =   248 bits (632),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 147/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML QC
Sbjct  122  GFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQC  181

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            +EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR 
Sbjct  182  FEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRS  241

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ + 
Sbjct  242  GGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYT  299

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +A KP
Sbjct  300  SKVQRSFIMFSAQKP  314



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 145/190 (76%), Gaps = 1/190 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EFE+ + YLKP  GG I+DASCGSGLFSRLF  S ++SLVVALDFSE ML+QC
Sbjct  171  GFPGLEREFEMAKTYLKPTTGGIIVDASCGSGLFSRLFVTSEIYSLVVALDFSENMLKQC  230

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EFIKQE N  +E + LVRADISRLPF + S+D VHAGAALHCWPSP+ AVAEISRVLRP
Sbjct  231  KEFIKQE-NISDERLALVRADISRLPFVNGSIDVVHAGAALHCWPSPACAVAEISRVLRP  289

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FVA+T++ D +    P +R  R    Q++G++ FL E ELEDLC  CGLV F  +RN
Sbjct  290  GGIFVASTFVADVLPPVVPLLRIGRSYIGQLTGNNTFLSEAELEDLCKACGLVDFTFVRN  349

Query  543  RRFIMLTAMK  572
              +I+ +A K
Sbjct  350  GFYIIFSATK  359



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 147/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML QC
Sbjct  162  GFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQC  221

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            +EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR 
Sbjct  222  FEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRS  281

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ + 
Sbjct  282  GGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYT  339

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +A KP
Sbjct  340  SKVQRSFIMFSAQKP  354



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 147/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML QC
Sbjct  163  GFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQC  222

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            +EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR 
Sbjct  223  FEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRS  282

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ + 
Sbjct  283  GGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYT  340

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +A KP
Sbjct  341  SKVQRSFIMFSAQKP  355



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 147/202 (73%), Gaps = 10/202 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDFSE ML+QC
Sbjct  168  GFPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRLFVKSELYSLVVALDFSENMLKQC  227

Query  183  YEFIKQEE-------NFPNEN---IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  332
             E++KQE         FPN     + L RADISRLPF S S+DAVHA AA+HCWPSP+ A
Sbjct  228  NEYVKQENISDKYGPQFPNHQHLTLALARADISRLPFVSGSIDAVHAAAAIHCWPSPACA  287

Query  333  VAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTC  512
            VAEISRVLRPGGVFVA+T++ D +    P +R  R   +Q +GS+IFL E E EDLC  C
Sbjct  288  VAEISRVLRPGGVFVASTFVADILPPAVPVLRIGRPYISQFTGSNIFLSEAEFEDLCRAC  347

Query  513  GLVGFKCIRNRRFIMLTAMKPS  578
            GL+ FK +RN  +IM +A K S
Sbjct  348  GLIDFKFVRNGFYIMFSATKAS  369



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   247 bits (630),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 148/195 (76%), Gaps = 5/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY +PV GG +ID SCGSGLF+R FAKSG +S VVALDFSE ML+QC
Sbjct  163  GFPGLDEEFQMAQDYFQPVAGGILIDVSCGSGLFTRKFAKSGAYSAVVALDFSENMLRQC  222

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YE+IKQ++   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  223  YEYIKQDDTPLNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAVAEISRVLRP  282

Query  363  GGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++      G +S  P +RPLR+    ++ S+ F  E ELEDLC +CGLV + 
Sbjct  283  GGVFVATTFLSTPTNSGPFSVGP-LRPLRQIVGPVNSSYNFFTEAELEDLCKSCGLVNYS  341

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  342  SKVQRSFIMFSGQKP  356



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 148/192 (77%), Gaps = 2/192 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG  +EFE+ + YL P +GG I+DASCGSGLFSRLF KSGL+SLVVALDFSE ML+QC
Sbjct  134  GFPGRTREFEMAKTYLNPTIGGTIVDASCGSGLFSRLFIKSGLYSLVVALDFSENMLKQC  193

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             E++ + EN  +E + LVRADISRLPF + S+DAVHAGAA+HCWPSPS AVAEISRVLRP
Sbjct  194  KEYV-EHENISDERLALVRADISRLPFVNGSIDAVHAGAAIHCWPSPSCAVAEISRVLRP  252

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGV VA+T++ D I    P +R  R   ++I+G +IFL E ELEDLC  CGLV F+ +RN
Sbjct  253  GGVLVASTFVED-IPLAIPILRIGRPYISRITGMNIFLSEAELEDLCRACGLVDFEFVRN  311

Query  543  RRFIMLTAMKPS  578
              +IM +A K S
Sbjct  312  GFYIMFSATKAS  323



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 1/143 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            G PGPEKEFE  +++LKPV+GG NIIDASCGSGLFSR FAKSGLFSLVVALD+SE ML++
Sbjct  163  GLPGPEKEFEWTKNFLKPVLGGGNIIDASCGSGLFSRRFAKSGLFSLVVALDYSENMLKE  222

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            CY FI+QEENFP EN ILVRADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLR
Sbjct  223  CYGFIQQEENFPKENXILVRADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLR  282

Query  360  PGGVFVATTYIVDGIYSFTPFVR  428
            PGGVFVA+TYI+DG +S  PF+R
Sbjct  283  PGGVFVASTYILDGRFSLIPFLR  305



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 145/195 (74%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EFE+ QDY +PV GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QC
Sbjct  159  GFPGLDEEFEMAQDYFQPVAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ++   N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  219  YEFIKQDDTLLNANLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRP  278

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  279  GGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYS  336

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  337  SKVQRSFIMFSGQKP  351



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 145/192 (76%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+EF++ Q+Y +P  GG IID SCGSGLFSR FA SG +S VVALDFSE ML+QC
Sbjct  160  GFPGPEEEFKMAQEYFEPAKGGLIIDVSCGSGLFSRKFANSGTYSGVVALDFSENMLRQC  219

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FIK+++   + NI LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR 
Sbjct  220  NDFIKKDDTLSSTNIALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRS  279

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S TP++ RP RE  +Q  G   FL E+E++DLCT+CGL  + C  
Sbjct  280  GGVFVGTTFL--RYTSSTPWILRPFRERTSQGYG---FLKEEEIKDLCTSCGLTNYSCKI  334

Query  540  NRRFIMLTAMKP  575
               FIM TA KP
Sbjct  335  QNSFIMFTAQKP  346



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 144/195 (74%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY +PV GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QC
Sbjct  106  GFPGLDEEFQMAQDYFQPVAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQC  165

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  166  YEFIKQDDTLLKANLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRP  225

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  226  GGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYS  283

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  284  SKVQRSFIMFSGQKP  298



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY KPV GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  165  GFPGRDEEFQMAQDYFKPVAGGILVDVSCGSGLFSRKFASSGAYSAVIALDFSENMLRQC  224

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++I+QEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+P
Sbjct  225  YDYIRQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKP  284

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++     S  PF    +RPLR+    ++ S+ F  E EL+DLC +CGLV + 
Sbjct  285  GGVFVATTFLSTPTNS-GPFSIDALRPLRQIVGPVNSSYNFFTEGELKDLCISCGLVNYS  343

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  344  SKVQRSFIMFSGQKP  358



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 146/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY +P+ GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QC
Sbjct  151  GFPGLDEEFQMAQDYFQPIAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ+++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  211  YEFIKQDDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRP  270

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  271  GGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYS  328

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  329  SNVQRSFIMFSGQKP  343



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 146/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY +P+ GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QC
Sbjct  153  GFPGLDEEFQMAQDYFQPIAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQC  212

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ+++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  213  YEFIKQDDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRP  272

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  273  GGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYS  330

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  331  SNVQRSFIMFSGQKP  345



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   241 bits (616),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 146/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY +P+ GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QC
Sbjct  163  GFPGLDEEFQMAQDYFQPIAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQC  222

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ+++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  223  YEFIKQDDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRP  282

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  283  GGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYS  340

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  341  SNVQRSFIMFSGQKP  355



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 144/195 (74%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY +PV GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QC
Sbjct  161  GFPGLDEEFQMAQDYFQPVAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQC  220

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  221  YEFIKQDDTLLKANLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRP  280

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  281  GGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYS  338

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  339  SKVQRSFIMFSGQKP  353



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 145/192 (76%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EFE+ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  150  GFPGPDEEFEMAQEYFKPAGGGLLVDVSCGSGLFSRKFAKSGAYSKVIALDFSENMLRQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQ++     N+ LVRAD+SRLPFAS SVDAVHAGAA+HCWPSPS AVAEI RVLR 
Sbjct  210  YDYIKQDDTISTTNLGLVRADVSRLPFASGSVDAVHAGAAMHCWPSPSNAVAEICRVLRS  269

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S TP + RP RE   +IS ++ F  E+E+EDLC+TCGL  +    
Sbjct  270  GGVFVGTTFL--RYSSTTPRIERPFRE---RISRNYNFFTEEEIEDLCSTCGLTNYSKKV  324

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  325  QRTFIMFSAQKP  336



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 145/195 (74%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY + V GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QC
Sbjct  160  GFPGLDEEFQMAQDYFQSVTGGVLLDVSCGSGLFTRKFAKSGSYSAVIALDFSENMLRQC  219

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+Q++   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  220  YEFIQQDDTLLNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAVAEISRVLRP  279

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  280  GGVFVATTFLSSP--RNNPFSVEALRPLRQVVGPVNTSYNYFTEGELEDLCKSCGLVNYS  337

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  338  SKVQRAFIMFSGQKP  352



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 145/195 (74%), Gaps = 6/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY + V GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML QC
Sbjct  153  GFPGLDEEFQMAQDYFQSVAGGVLLDVSCGSGLFTRKFAKSGSYSAVIALDFSENMLCQC  212

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFI+Q++   N N+ LVRADISRLPFASSS+DA+HAGAA+HCWPSPS AVAEISRVLRP
Sbjct  213  YEFIQQDDTLVNTNLALVRADISRLPFASSSIDAIHAGAAIHCWPSPSNAVAEISRVLRP  272

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV + 
Sbjct  273  GGVFVATTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYS  330

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  331  SKVQRSFIMFSGQKP  345



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 145/195 (74%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  151  GFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSRKFAKSGSYSGVVALDFSENMLRQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+F+K++      N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR 
Sbjct  211  YDFLKRDATLLATNLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRS  270

Query  363  GGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP    ++RP RE  AQ    + +L E+E++DLCT+CGL  + 
Sbjct  271  GGVFVGTTFL-----RYTPTTPWYIRPFRERIAQ---GYSYLTEEEIQDLCTSCGLTNYS  322

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  323  SKVQQSFIMFSAQKP  337



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY + V GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  155  GFPGRDEEFQMAQDYFQSVAGGILVDVSCGSGLFSRKFASSGAYSSVIALDFSENMLRQC  214

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+P
Sbjct  215  YDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKP  274

Query  363  GGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++      G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV + 
Sbjct  275  GGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYS  333

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  334  SKVQRSFIMFSGQKP  348



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY + V GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  155  GFPGRDEEFQMAQDYFQSVAGGILVDVSCGSGLFSRKFASSGAYSSVIALDFSENMLRQC  214

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+P
Sbjct  215  YDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKP  274

Query  363  GGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++      G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV + 
Sbjct  275  GGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYS  333

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  334  SKVQRSFIMFSGQKP  348



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 146/195 (75%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  149  GFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSRKFAKSGSYSGVVALDFSENMLRQC  208

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+F+K++      N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR 
Sbjct  209  YDFLKRDATLLATNLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRS  268

Query  363  GGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP    ++RP RE   +I+  + +L E+E++DLCT+CGL  + 
Sbjct  269  GGVFVGTTFL-----RYTPTTPWYIRPFREQ--RIAQGYSYLTEEEIQDLCTSCGLTNYS  321

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  322  SKVQQSFIMFSAQKP  336



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 146/195 (75%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  151  GFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSRKFAKSGSYSGVVALDFSENMLRQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+F+K++      N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR 
Sbjct  211  YDFLKRDATLLATNLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRS  270

Query  363  GGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP    ++RP RE   +I+  + +L E+E++DLCT+CGL  + 
Sbjct  271  GGVFVGTTFL-----RYTPTTPWYIRPFREQ--RIAQGYSYLTEEEIQDLCTSCGLTNYS  323

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  324  SKVQQSFIMFSAQKP  338



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 142/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  122  GFPGPDEEFKMAQEYFKPTEGGLLVDVSCGSGLFSRKFAKSGTYSKVIALDFSENMLRQC  181

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++     N+ LVRAD+SRLPFAS SVDA+HAGAALHCWPS S AVAEI R LR 
Sbjct  182  YDFIKQDDTISTRNLALVRADVSRLPFASGSVDAIHAGAALHCWPSASNAVAEICRALRS  241

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S T ++ RP RE   Q   ++ +  E+E+EDLCTTCGL  +  I 
Sbjct  242  GGVFVGTTFL--QYSSTTSWIERPFRERIMQ---NYNYFTEEEIEDLCTTCGLTNYTRIV  296

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  297  QRSFIMFSAQKP  308



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 142/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  152  GFPGPDEEFKMAQEYFKPTEGGLLVDVSCGSGLFSRKFAKSGTYSKVIALDFSENMLRQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++     N+ LVRAD+SRLPFAS SVDA+HAGAALHCWPS S AVAEI R LR 
Sbjct  212  YDFIKQDDTISTRNLALVRADVSRLPFASGSVDAIHAGAALHCWPSASNAVAEICRALRS  271

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S T ++ RP RE   Q   ++ +  E+E+EDLCTTCGL  +  I 
Sbjct  272  GGVFVGTTFL--QYSSTTSWIERPFRERIMQ---NYNYFTEEEIEDLCTTCGLTNYTRIV  326

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  327  QRSFIMFSAQKP  338



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 144/192 (75%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EFE+ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  146  GFPGPDEEFEMAQEYFKPARGGLLVDVSCGSGLFSRKFAKSGAYSKVIALDFSENMLRQC  205

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQ++     N+ L+RAD+SRLPFAS SVDAVHAGAA+HCWPSPS AVAEI RVLR 
Sbjct  206  YDYIKQDDTISTTNLGLIRADVSRLPFASGSVDAVHAGAAMHCWPSPSNAVAEICRVLRS  265

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S TP + RP RE   +IS +  F  E+E+EDLC+TCGL  +    
Sbjct  266  GGVFVGTTFL--RYSSTTPRIERPFRE---RISRNSNFFTEEEIEDLCSTCGLTNYSKKV  320

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  321  QQTFIMFSAQKP  332



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY + V GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  223  GFPGRDEEFQMAQDYFQSVAGGILVDVSCGSGLFSRKFASSGAYSSVIALDFSENMLRQC  282

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+P
Sbjct  283  YDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKP  342

Query  363  GGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++      G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV + 
Sbjct  343  GGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYS  401

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  402  SKVQRSFIMFSGQKP  416



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score =   234 bits (596),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y +P  GG I+D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  91   GFPGPDEEFRMAQEYFEPAKGGRIVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  150

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK+++     N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR 
Sbjct  151  YDFIKKDDTLSTTNLALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRS  210

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S T +V R  RE   + S  + +L E+E++DLCT+CGL  + C  
Sbjct  211  GGVFVGTTFLR--YTSSTSWVARLFRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKI  265

Query  540  NRRFIMLTAMKP  575
             + FIM TA KP
Sbjct  266  QKSFIMFTAQKP  277



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 142/192 (74%), Gaps = 4/192 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FA SG +S VVALDFSE ML+QC
Sbjct  102  GFPGPDEEFKMAQEYFKPAEGGILVDVSCGSGLFSRKFATSGTYSKVVALDFSENMLRQC  161

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++N   +++ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI R LR 
Sbjct  162  YDFIKQDDNISEKDLALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAIAEICRTLRS  221

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     S +   R  RE   +I   + +  E+E+EDLCT+CGL  ++    
Sbjct  222  GGVFVGTTFLRYNATS-SWIERSFRE---RIMSGYNYYTEEEIEDLCTSCGLTNYQSKVQ  277

Query  543  RRFIMLTAMKPS  578
            R FIM TA KPS
Sbjct  278  RSFIMFTAEKPS  289



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  160  GFPGPDEEFKMAQGYFKSVEGGLLVDVSCGSGLFSRKFAKSGTYSAVIALDFSENMLRQC  219

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++    N N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSP+ AVAEI+R+LR 
Sbjct  220  YDFIKRDGALLNSNLALVRADVSRLPFSSGSVDAVHAGAALHCWPSPTNAVAEITRILRS  279

Query  363  GGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GG+FV TT++     S TP  VRPLR+   Q   ++ +L E+E+EDLCT+CGL  +    
Sbjct  280  GGIFVGTTFLR--YTSSTPLIVRPLRQRVLQ---NYNYLTEEEIEDLCTSCGLTNYSSKV  334

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  335  QQSFIMFSAQKP  346



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 144/194 (74%), Gaps = 8/194 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  157  GFPGPDEEFKMAQEYFKQAEGGLLVDVSCGSGLFSRKFAKSGTYSKVIALDFSENMLRQC  216

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ+    N N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A+AEI RVLR 
Sbjct  217  YDFIKQDVTISNTNLALVRADVSRLPFPSGSVDAVHAGAALHCWPSPSNAIAEICRVLRS  276

Query  363  GGVFVATTYIVDGIYSFTP--FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCI  536
            GGVFV TT++    YS T    +RP R+   +I  ++ +  E+E+EDLCT+CGL  +K  
Sbjct  277  GGVFVGTTFLQ---YSATTSWILRPFRQ---RIQENYFYFTEEEIEDLCTSCGLTNYKSK  330

Query  537  RNRRFIMLTAMKPS  578
              + FIM +A KPS
Sbjct  331  VQQSFIMFSAEKPS  344



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y +   GG I+D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  155  GFPGPDEEFKMAQEYFESAKGGLIVDVSCGSGLFSRKFAKSGAYSGVIALDFSENMLRQC  214

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIK+++     NI LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVL+ 
Sbjct  215  YEFIKKDDTLSTTNIALVRADVSRLPFPSGSVDAVHAGAALHCWPSPSNAVAEITRVLKS  274

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +    
Sbjct  275  GGVFVGSTFLR--YSSLTPWFLRPFRERIPQGYG---YLTEEEIKDLCTSCGLTNYSSKI  329

Query  540  NRRFIMLTAMKP  575
             + FIM TA KP
Sbjct  330  QQAFIMFTAQKP  341



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 145/192 (76%), Gaps = 7/192 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP+ EF++ Q+Y +PV GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML QC
Sbjct  150  GFPGPDDEFKMAQEYFQPVEGGVLVDVSCGSGLFSRKFAKSGTYSKVVALDFSENMLLQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK +++  N N+ LVRADISRLPF S SVD VHAGAALHCWPSPS AVAEI+R+LR 
Sbjct  210  YDFIKSDDSMLNSNLALVRADISRLPFPSGSVDGVHAGAALHCWPSPSNAVAEINRILRS  269

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S TP F+RPLR    Q   ++ +L E+E+ED+CT+CGL+ +    
Sbjct  270  GGVFVGTTFLR--FSSSTPAFLRPLR----QAGRNYNYLTEEEIEDVCTSCGLINYTSKV  323

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  324  QQSFIMFSAQKP  335



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 146/192 (76%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  152  GFPGPDEEFNMAQEYFKPAEGGVLVDVSCGSGLFSRKFAKSGAYSRVIALDFSENMLRQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK ++   + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+R+LR 
Sbjct  212  YDFIKNDDAILSSNLALVRADVSRLPFPSGSVDAVHAGAALHCWPSPSNAVAEINRILRS  271

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++   I S TP  +RP R+   +I+  + +L E+E+EDLCT+CGLV +    
Sbjct  272  GGVFVGSTFL--RISSSTPILLRPFRQ---RITNDYNYLTEEEIEDLCTSCGLVNYSKKV  326

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  327  QQSFIMFSAEKP  338



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 150/193 (78%), Gaps = 7/193 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y KP  GG +ID SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  152  GFPGPDEEFSMAQEYFKPAEGGVLIDVSCGSGLFSRKFAKSGSYSRVVALDFSENMLRQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            ++FIK ++   N N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  212  FDFIKNDDAILNSNLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAIAEINRILRS  271

Query  363  GGVFVATTYIVDGIYSFTP-FVRPL-RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCI  536
            GGVFV +T++   + S TP ++RPL RE   +I+ ++ +L E+E+E++C +CGLV +  I
Sbjct  272  GGVFVGSTFL--RVSSSTPTWLRPLIRE---RITSNYNYLTEEEIEEVCKSCGLVNYTKI  326

Query  537  RNRRFIMLTAMKP  575
              + FIM +A KP
Sbjct  327  VQQSFIMFSAQKP  339



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   232 bits (591),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+EFE+ + YLKP  GG IIDASCGSGLFSRLFAKSG+FSLV+ALDFSE MLQQC
Sbjct  165  GFPGPEREFEMAKGYLKPSTGGTIIDASCGSGLFSRLFAKSGMFSLVIALDFSENMLQQC  224

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y FI QE   P EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRP
Sbjct  225  YNFINQE-GMPRENLILVRADISRLPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRP  283

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRE  440
            GGVFVATT+I+D +    P ++ +R+
Sbjct  284  GGVFVATTFILDVLPPVIPILKTVRQ  309



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y +P  GG I+D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  156  GFPGPDEEFRMAQEYFEPAKGGRIVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  215

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK+++     N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR 
Sbjct  216  YDFIKKDDTLSTTNLALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRS  275

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S T +V R  RE   + S  + +L E+E++DLCT+CGL  + C  
Sbjct  276  GGVFVGTTFLR--YTSSTSWVARLFRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKI  330

Query  540  NRRFIMLTAMKP  575
             + FIM TA KP
Sbjct  331  QKSFIMFTAQKP  342



>gb|EEE66113.1| hypothetical protein OsJ_22149 [Oryza sativa Japonica Group]
Length=237

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 138/187 (74%), Gaps = 6/187 (3%)
 Frame = +3

Query  27   FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEE  206
            F++ QDY + V GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML QCYEFI+Q++
Sbjct  53   FQMAQDYFQSVAGGVLLDVSCGSGLFTRKFAKSGSYSAVIALDFSENMLCQCYEFIQQDD  112

Query  207  NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT  386
               N N+ LVRADISRLPFASSS+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT
Sbjct  113  TLVNTNLALVRADISRLPFASSSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATT  172

Query  387  YIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFI  554
            ++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FI
Sbjct  173  FLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFI  230

Query  555  MLTAMKP  575
            M +  KP
Sbjct  231  MFSGQKP  237



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 142/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y +P  GG I+D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  156  GFPGPDEEFRMAQEYFEPAKGGRIVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  215

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK+++     N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR 
Sbjct  216  YDFIKKDDTLSTTNLALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRS  275

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT+      S T +V R  RE   + S  + +L E+E++DLCT+CGL  + C  
Sbjct  276  GGVFVGTTFFR--YTSSTSWVARLFRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKI  330

Query  540  NRRFIMLTAMKP  575
             + FIM TA KP
Sbjct  331  QKSFIMFTAQKP  342



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 134/192 (70%), Gaps = 37/192 (19%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFE+ + YLKPV+GGNIIDASCGSG+FSR                        
Sbjct  163  GFPGPEKEFEMAKAYLKPVLGGNIIDASCGSGMFSR------------------------  198

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
                          ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRP
Sbjct  199  -------------KLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRP  245

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT+I DG +SF PF++ LR+   + SGSHIFL+E+ELED+C  CGLV F  +RN
Sbjct  246  GGVFVATTFIYDGPFSFIPFLKNLRQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRN  305

Query  543  RRFIMLTAMKPS  578
              FIML+A KPS
Sbjct  306  GPFIMLSATKPS  317



>gb|AFW76188.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=206

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 138/189 (73%), Gaps = 6/189 (3%)
 Frame = +3

Query  21   KEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQ  200
            K F+ ++   +P+ GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIKQ
Sbjct  19   KSFKWLKTIFQPIAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIKQ  78

Query  201  EENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA  380
            +++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV 
Sbjct  79   DDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVG  138

Query  381  TTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR  548
            TT++        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R 
Sbjct  139  TTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRS  196

Query  549  FIMLTAMKP  575
            FIM +  KP
Sbjct  197  FIMFSGQKP  205



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  114  GFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  173

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR 
Sbjct  174  NDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRS  233

Query  363  GGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP+ +RP RE   Q   S+ +L E+E+E++CT  GL  F    
Sbjct  234  GGVFVGSTFL--RYTSSTPWIIRPFRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKV  288

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  289  QRSFIMFSAQKP  300



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y +   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  150  GFPGPDEEFKMAQEYFESAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FI++++     NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ 
Sbjct  210  YDFIEKDDTLSTNNIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKN  269

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +    
Sbjct  270  GGVFVGSTFLR--YSSKTPWFLRPFRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKI  324

Query  540  NRRFIMLTAMKP  575
             + FIM TA KP
Sbjct  325  QQAFIMFTAQKP  336



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 143/195 (73%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML QC
Sbjct  164  GFPGQEEEFKMAQEYFKPAEGGLLLDVSCGSGLFSRKFAKSGTYSGVIALDYSENMLCQC  223

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEISRVLR 
Sbjct  224  YDFIKQDDAVLKANLALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAIAEISRVLRS  283

Query  363  GGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP     ++P R+  +Q   ++ FL  +E+EDLCT+CGL  + 
Sbjct  284  GGVFVGTTFL-----RYTPSTPWIIQPFRQRASQ---NYSFLTAEEIEDLCTSCGLTNYT  335

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  336  SKTQQSFIMFSAQKP  350



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y +   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  155  GFPGPDEEFKMAQEYFESAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  214

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FI++++     NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ 
Sbjct  215  YDFIEKDDTLSTNNIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKN  274

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +    
Sbjct  275  GGVFVGSTFLR--YSSKTPWFLRPFRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKI  329

Query  540  NRRFIMLTAMKP  575
             + FIM TA KP
Sbjct  330  QQAFIMFTAQKP  341



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 141/193 (73%), Gaps = 7/193 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML QC
Sbjct  151  GFPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLHQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++      N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR 
Sbjct  211  YDFIKKDNPSLTTNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRS  270

Query  363  GGVFVATTYIVDGIY---SFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
            GG+FV TT++   IY   S    +RP R++  Q S    +L EKE+EDLC +C L+ +  
Sbjct  271  GGIFVGTTFL-RPIYTNSSIPAILRPFRQSILQTSN---YLTEKEIEDLCRSCALINYTS  326

Query  534  IRNRRFIMLTAMK  572
               + FIM +A K
Sbjct  327  TIQQSFIMFSAQK  339



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  154  GFPGPDEEFRMAQEYFKPAEGGILVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  213

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FI+Q+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPS S AVAEISR+LR 
Sbjct  214  NDFIEQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPSTSNAVAEISRILRS  273

Query  363  GGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP+ VRP RE   Q   ++ +L E+E+ED+CT+CGL  F    
Sbjct  274  GGVFVGSTFL--RYSSTTPWIVRPFRERILQ---NYNYLTEEEIEDVCTSCGLTNFTKKV  328

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  329  QQSFIMFSAQKP  340



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y +   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  155  GFPGPDEEFKMAQEYFESAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  214

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FI++++     NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ 
Sbjct  215  YDFIEKDDALSTNNIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKN  274

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +    
Sbjct  275  GGVFVGSTFLR--YSSKTPWFLRPFRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKI  329

Query  540  NRRFIMLTAMKP  575
             + FIM TA KP
Sbjct  330  QQAFIMFTAQKP  341



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 141/193 (73%), Gaps = 7/193 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML QC
Sbjct  149  GFPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLHQC  208

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++      N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR 
Sbjct  209  YDFIKKDNPSLTTNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRS  268

Query  363  GGVFVATTYIVDGIY---SFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
            GG+FV TT++   IY   S    +RP R++  Q S    +L EKE+EDLC +C L+ +  
Sbjct  269  GGIFVGTTFL-RPIYTNSSIPAILRPFRQSILQTSN---YLTEKEIEDLCRSCALINYTS  324

Query  534  IRNRRFIMLTAMK  572
               + FIM +A K
Sbjct  325  TIQQSFIMFSAQK  337



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  157  GFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  216

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR 
Sbjct  217  NDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRS  276

Query  363  GGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP+ +RP RE   Q   S+ +L E+E+E++CT  GL  F    
Sbjct  277  GGVFVGSTFL--RYTSSTPWIIRPFRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKV  331

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  332  QRSFIMFSAQKP  343



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 138/191 (72%), Gaps = 4/191 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  147  GFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR 
Sbjct  207  YDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRS  266

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     S +   R LRE   Q   ++ +L E+E+EDLCT+CGL  +     
Sbjct  267  GGVFVGTTFL-RYTSSTSLTGRVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQ  322

Query  543  RRFIMLTAMKP  575
            + FIM  A KP
Sbjct  323  QSFIMFAAQKP  333



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 146/193 (76%), Gaps = 4/193 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ Q+Y +PV+GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML+QC
Sbjct  151  GFPGRDEEFKMAQEYFEPVIGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLRQC  210

Query  183  YEFIKQEE-NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            Y+FIK+E       N+ LVRAD+SRLPF++ SVDAVHAGAALHCWPSPS AVAEI+R+LR
Sbjct  211  YDFIKKENPALATTNLALVRADVSRLPFSTGSVDAVHAGAALHCWPSPSNAVAEITRILR  270

Query  360  PGGVFVATTYIVD--GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GG+FV TT++    G  S T  +RP R+ + +   ++  L EKE+EDLCT+CGL+ ++ 
Sbjct  271  SGGIFVGTTFLRPSFGNSSITSILRPFRQ-WERSLQNYNNLTEKEIEDLCTSCGLINYRS  329

Query  534  IRNRRFIMLTAMK  572
               R FIM +A K
Sbjct  330  KVQRSFIMFSAQK  342



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 138/191 (72%), Gaps = 4/191 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  147  GFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR 
Sbjct  207  YDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRS  266

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     S +   R LRE   Q   ++ +L E+E+EDLCT+CGL  +     
Sbjct  267  GGVFVGTTFL-RYTSSTSLTGRVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQ  322

Query  543  RRFIMLTAMKP  575
            + FIM  A KP
Sbjct  323  QSFIMFAAQKP  333



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  77   GFPGIDEEFKMAQDYFKSAEGGVLLDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  136

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+F+K++      N+ LVRAD+SRLPF S S+ AVHAGAALHCWPSPS A+AEISR+LR 
Sbjct  137  YDFLKKDPTLLATNLALVRADVSRLPFPSGSIGAVHAGAALHCWPSPSNAIAEISRILRS  196

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GG+FV TT++     S TP++ RPLRE   Q    + +L E+E+EDLCT+ GL+ +    
Sbjct  197  GGIFVGTTFLR--YTSSTPWILRPLRERALQ---DYSYLTEEEIEDLCTSSGLINYSSKV  251

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  252  QQSFIMFSAQKP  263



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 143/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG FS V+ALDFSE ML QC
Sbjct  152  GFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFSGVIALDFSENMLLQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R 
Sbjct  212  YDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRS  271

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S TP ++R LRE   Q  G   +L E+E+E+LC +CGL+ +    
Sbjct  272  GGVFVGTTFLR--YTSSTPWYLRFLRERGFQPYG---YLTEEEIEELCKSCGLINYSSKV  326

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  327  QRSFIMFSAQKP  338



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 139/192 (72%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  147  GFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGAYSGVVALDFSENMLRQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+L+ 
Sbjct  207  YDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILQS  266

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S T  + R LRE   Q   ++ +L E+E+EDLCT+CGL  +    
Sbjct  267  GGVFVGTTFLR--YTSSTSLIGRVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKV  321

Query  540  NRRFIMLTAMKP  575
             + FIM  A KP
Sbjct  322  QQSFIMFAAQKP  333



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR FA+SG +S V+ALDFSE ML+QC
Sbjct  208  GFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSRKFAQSGTYSGVIALDFSENMLRQC  267

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR 
Sbjct  268  NDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRS  327

Query  363  GGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP+ +RP RE   Q   S+ +L E+E+E++CT  GL  F    
Sbjct  328  GGVFVGSTFL--RYTSSTPWIIRPFRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKV  382

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  383  QRSFIMFSAQKP  394



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 5/179 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY++PV GG ++D S GSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  138  GFPGRDEEFQMAQDYIQPVAGGILVDVSGGSGLFSRKFASSGAYSSVIALDFSENMLRQC  197

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+P
Sbjct  198  YDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKP  257

Query  363  GGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGF  527
            GGVFVATT++     S  PF    +RPLR+    ++ S+ F  E ELEDLC +CGLV +
Sbjct  258  GGVFVATTFLSTPTNS-GPFSIDALRPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNY  315



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG +ID SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  159  GFPGPDEEFKMAQEYFKVAEGGVVIDVSCGSGLFSRKFAKSGAYSRVVALDFSENMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK +E+  + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  219  YDFIKNDESILSSNLALVRADVSRLPFFSGSIDAVHAGAALHCWPSPSNAIAEINRILRS  278

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     + T F R L +N  +   ++ +  ++E+EDL TTCGL+ +     
Sbjct  279  GGVFVGTTFLRVNPSAPTIF-RALEQNVGR---TYSYFTQEEIEDLVTTCGLINYTSKVQ  334

Query  543  RRFIMLTAMKP  575
              FIM +A KP
Sbjct  335  NSFIMFSAQKP  345



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 139/195 (71%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q 
Sbjct  141  GFPGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSRKFAKSGTYSAVVALDFSENMLRQS  200

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  201  YEFFKRDPTJLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRS  260

Query  363  GGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP      R LRE+  Q    + +L E+E+EDLC +CGL  + 
Sbjct  261  GGVFVGTTFL-----RYTPSTPWITRQLRESALQ---GYNYLTEEEIEDLCASCGLTNYT  312

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  313  SNVQQAFIMFSAQKP  327



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR F KSG +S V+ALDFSE ML+QC
Sbjct  151  GFPGPDEEFRMAQEYFKPVEGGILVDVSCGSGLFSRKFVKSGTYSGVIALDFSENMLRQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FI+Q+ +    NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSP  AVAEISR+LR 
Sbjct  211  NDFIEQDASILASNIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPLNAVAEISRILRS  270

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP  +RP RE   Q   ++ +L E+E+E LCT+CGL  +    
Sbjct  271  GGVFVGSTFL--RYTSSTPRIIRPFRERILQ---NYSYLTEEEIEALCTSCGLTNYTRNI  325

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  326  QQSFIMFSAQKP  337



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 142/195 (73%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ LD+SE ML+QC
Sbjct  150  GFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIPLDYSENMLRQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR 
Sbjct  210  YDFIKQDDAVLKANLALVRADVSRLPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRS  269

Query  363  GGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP     + P R+  AQ   ++ +L  +E+EDLCT+CGL  + 
Sbjct  270  GGVFVGTTFL-----RYTPSTPWIILPFRQRTAQ---NYSYLTAEEIEDLCTSCGLTNYT  321

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  322  RKIQQSFIMFSAQKP  336



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 143/198 (72%), Gaps = 14/198 (7%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML QC
Sbjct  151  GFPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLHQC  210

Query  183  YEFIKQEENFPN-----ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEIS  347
            Y+FIK++   P+      N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+
Sbjct  211  YDFIKKDN--PSLTTMCSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEIT  268

Query  348  RVLRPGGVFVATTYIVDGIY---SFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGL  518
            R+LR GG+FV TT++   IY   S    +RP R++  Q S    +L EKE+EDLC +C L
Sbjct  269  RILRSGGIFVGTTFL-RPIYTNSSIPAILRPFRQSILQTSN---YLTEKEIEDLCRSCAL  324

Query  519  VGFKCIRNRRFIMLTAMK  572
            + +     + FIM +A K
Sbjct  325  INYTSTIQQSFIMFSAQK  342



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score =   223 bits (567),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG F+ V+ALDFSE ML QC
Sbjct  152  GFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFAGVIALDFSENMLLQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R 
Sbjct  212  YDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRS  271

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     S   ++R LRE   Q  G   +L E+E+E+LC +CGL+ +     
Sbjct  272  GGVFVGTTFL-RYTSSTLWYLRFLRERGFQPYG---YLTEEEIEELCKSCGLINYSSKVQ  327

Query  543  RRFIMLTAMKP  575
            R FIM +A KP
Sbjct  328  RSFIMFSAQKP  338



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   220 bits (561),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++E ++  +YL+P  GG I+D SCGSGLF+R  AK G F+ V+ALDFSE+ML+QC
Sbjct  89   GFPGPDEELKMALEYLRPAFGGVIVDVSCGSGLFTRRLAKCGSFAAVIALDFSESMLRQC  148

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EF+KQ+++    +I LVRAD+ RLPFAS +V A+HAGAALHCWPSPS+AVAEI RVL+P
Sbjct  149  AEFVKQDKSLRTADIALVRADVIRLPFASGTVSAIHAGAALHCWPSPSSAVAEICRVLKP  208

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT++ + I+ F P  R         S S  +  EKELE+LC  CGLV ++    
Sbjct  209  GGVFVATTFLSNSIFPFLPQRR---------SSSLRYWTEKELEELCKLCGLVDYQKKIK  259

Query  543  RRFIMLTAMK  572
              FIMLTA K
Sbjct  260  GNFIMLTARK  269



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 143/193 (74%), Gaps = 7/193 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG FS V+ALDFSE ML QC
Sbjct  152  GFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFSGVIALDFSENMLLQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R 
Sbjct  212  YDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRS  271

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFA-QISGSHIFLDEKELEDLCTTCGLVGFKCI  536
            GGVFV TT++     S TP ++R LRE    Q  G   +L E+E+E+LC +CGL+ +   
Sbjct  272  GGVFVGTTFLR--YTSSTPWYLRFLREQRGFQPYG---YLTEEEIEELCKSCGLINYSSK  326

Query  537  RNRRFIMLTAMKP  575
              R FIM +A KP
Sbjct  327  VQRSFIMFSAQKP  339



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG F+ V+ALDFSE ML QC
Sbjct  152  GFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFAGVIALDFSENMLLQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++    N N+ LVRADISRLPF+S SVD VHAGAALHCWPSPS A+AEI+R++R 
Sbjct  212  YDFIKKDATLLNSNLALVRADISRLPFSSGSVDGVHAGAALHCWPSPSNAIAEITRIMRS  271

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT+      S TP ++R LRE   Q  G   +L E+E+E+LC +CGL+ +    
Sbjct  272  GGVFVGTTFXR--YTSSTPWYLRFLRERGFQPYG---YLTEEEIEELCKSCGLINYSSKV  326

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  327  QRSFIMFSAQKP  338



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 142/190 (75%), Gaps = 4/190 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY K   GG ++D SCGSGLFSR FAKSG++S V+ALDFSE ML+QC
Sbjct  159  GFPGPDEEFKMAQDYFKVAEGGVLVDVSCGSGLFSRKFAKSGVYSRVIALDFSENMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK +E+  + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  219  YDFIKTDESILSSNLALVRADVSRLPFFSGSVDAVHAGAALHCWPSPSNAIAEINRILRS  278

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GG+FV TT++     S  P +R L+++  +   ++ F  ++E+EDL TTCGL+ +     
Sbjct  279  GGIFVGTTFLRVNP-SAPPILRALQQSATR---TYSFFTQEEIEDLVTTCGLINYTSKVQ  334

Query  543  RRFIMLTAMK  572
              FIM +A K
Sbjct  335  GGFIMFSAQK  344



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 131/176 (74%), Gaps = 10/176 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDFSE ML+QC
Sbjct  170  GFPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRLFVKSELYSLVVALDFSENMLKQC  229

Query  183  YEFIKQEE-------NFPNEN---IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  332
             E++KQE         FPN     + LVRADISRLPF S S+DAVHA AA+HCWPSP+ A
Sbjct  230  NEYVKQENISDKYGPQFPNHQHLTLALVRADISRLPFVSGSIDAVHAAAAIHCWPSPACA  289

Query  333  VAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  500
            VAEISRVLRPGGVFVA+T++ D +    P +R  R   +Q +GS+IFL E E EDL
Sbjct  290  VAEISRVLRPGGVFVASTFVADILPPAVPVLRIGRPYISQFTGSNIFLSEAEFEDL  345



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 142/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  166  GFPGLDEEFKMAQDYFKSAEGGVLLDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  225

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+F+K++      N+ LVRAD+SRLPF S SV AVHAGAALHCWPSPS A+AEISR+LR 
Sbjct  226  YDFLKKDPTLLATNLALVRADVSRLPFPSGSVGAVHAGAALHCWPSPSNAIAEISRILRT  285

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GG+FV TT++     S TP++ RPLRE   Q   ++ +L E+E+EDLCT+ GL+ +    
Sbjct  286  GGIFVGTTFLR--YTSSTPWILRPLRERALQ---NYSYLTEEEIEDLCTSSGLINYSSKV  340

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  341  QQSFIMFSAQKP  352



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 138/192 (72%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y +   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  159  GFPGPDEEFRMAQEYFRSAEGGLLVDVSCGSGLFSRKFAKSGKYSAVVALDFSENMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FIKQ+    + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEISRVLR 
Sbjct  219  NDFIKQDNTLSSTNLALVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEISRVLRS  278

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     + TP F+RP RE   Q   ++ +L   E++D+CT+CGL  +    
Sbjct  279  GGVFVGTTFL--RYNASTPWFIRPFRERILQ---NYNYLLRDEIKDVCTSCGLTNYSDDV  333

Query  540  NRRFIMLTAMKP  575
               FIM  A KP
Sbjct  334  RSSFIMFAAQKP  345



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++E ++  +YL+P  GG I+D SCGSGLF+R  AK G F+ V+ALDFSE+ML+QC
Sbjct  159  GFPGPDEELKMALEYLRPAFGGVIVDVSCGSGLFTRRLAKCGSFAAVIALDFSESMLRQC  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EF+KQ+++    +I LVRAD+ RLPFAS +V A+HAGAALHCWPSPS+AVAEI RVL+P
Sbjct  219  AEFVKQDKSLRTADIALVRADVIRLPFASGTVSAIHAGAALHCWPSPSSAVAEICRVLKP  278

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFVATT++ + I+ F P  R         S S  +  EKELE+LC  CGLV ++    
Sbjct  279  GGVFVATTFLSNSIFPFLPQRR---------SSSLRYWTEKELEELCKLCGLVDYQKKIK  329

Query  543  RRFIMLTAMK  572
              FIMLTA K
Sbjct  330  GNFIMLTARK  339



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR FAKS  +S V+ALDFSE ML+QC
Sbjct  151  GFPGPDEEFRMAQEYFKPVEGGILVDVSCGSGLFSRKFAKSRTYSGVIALDFSENMLRQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FI+Q+ +    N+ LVRAD+SRLPF+S S+DAVHAGAALHCWPSP  AVAEISR+LR 
Sbjct  211  NDFIEQDASILASNMALVRADVSRLPFSSGSIDAVHAGAALHCWPSPLNAVAEISRILRS  270

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV +T++     S TP  +RP RE   Q   ++ +L E+E+E LCT+CGL  +    
Sbjct  271  GGVFVGSTFL--RYTSSTPRIIRPFRERVLQ---NYSYLTEEEIEALCTSCGLANYTRKI  325

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  326  QQSFIMFSAQKP  337



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 141/192 (73%), Gaps = 5/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG F+ V+ALDFSE ML QC
Sbjct  152  GFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFAGVIALDFSENMLLQC  211

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R 
Sbjct  212  YDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRS  271

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFA-QISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFV TT++     S   ++R LRE    Q  G   +L E+E+E+LC +CGL+ +    
Sbjct  272  GGVFVGTTFL-RYTSSTLWYLRFLREQRGFQPYG---YLTEEEIEELCKSCGLINYSSKV  327

Query  540  NRRFIMLTAMKP  575
             R FIM +A KP
Sbjct  328  QRSFIMFSAQKP  339



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EF++ Q+Y KP  GG ++D SCGSGLFSR FA+ G +S V+ALDFSE ML+QC
Sbjct  153  GFPGLEEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRKFAECGTYSGVIALDFSENMLRQC  212

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+F K+E    + N+ LVRAD++RLPF S+S+DAVHAGAALHCWPSPS+A+A+I+RVLR 
Sbjct  213  YDFTKKEGPALSNNLALVRADVARLPFPSASIDAVHAGAALHCWPSPSSAIADITRVLRS  272

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     S    +RPLRE   Q   ++ +L E+E+E LC +CGLV +     
Sbjct  273  GGVFVGTTFL-RYTASTPSLLRPLRERILQ---TYSYLIEEEIEALCKSCGLVDYSSKVQ  328

Query  543  RRFIMLTAMKP  575
            + FIM +A KP
Sbjct  329  QSFIMFSARKP  339



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 139/190 (73%), Gaps = 4/190 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + QDY K   GG ++D SCGSGLFSR FAKSG++S V+ALDFSE ML+QC
Sbjct  155  GFPGPDEEFNMAQDYFKVAEGGVLVDVSCGSGLFSRKFAKSGVYSKVIALDFSENMLRQC  214

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK +E+  + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  215  YDFIKTDESILSSNLALVRADVSRLPFFSGSVDAVHAGAALHCWPSPSNAIAEINRILRS  274

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     S  P  R L+++  +   ++ F   +E+EDL TTCGL+ +     
Sbjct  275  GGVFVGTTFLRVNP-STPPIFRALQQSATR---TYSFFTREEIEDLVTTCGLINYTSKVQ  330

Query  543  RRFIMLTAMK  572
              FI+ +A K
Sbjct  331  GGFIIFSAQK  340



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 138/195 (71%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY      G ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q 
Sbjct  159  GFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQS  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF K++    + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  219  YEFFKRDPTLLDTNLALVRADVARLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRS  278

Query  363  GGVFVATTYIVDGIYSFTPFV----RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP      R LRE   Q   S+ +L E+E+ DLCT+CGL  + 
Sbjct  279  GGVFVGTTFL-----RYTPSTSWIPRQLRERARQ---SYNYLTEEEIADLCTSCGLTNYT  330

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  331  SNVQQSFIMFSAQKP  345



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 138/195 (71%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY      G ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q 
Sbjct  159  GFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQS  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF K++    + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  219  YEFFKRDPTLLDTNLALVRADVARLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRS  278

Query  363  GGVFVATTYIVDGIYSFTPFV----RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFV TT++      +TP      R LRE   Q   S+ +L E+E+ DLCT+CGL  + 
Sbjct  279  GGVFVGTTFL-----RYTPSTSWIPRQLRERARQ---SYNYLTEEEIADLCTSCGLTNYT  330

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  331  SNVQQSFIMFSAQKP  345



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q++ +P  GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  133  GFPGPDEEFKMAQEFFEPAAGGLLVDVSCGSGLFSRKFADSGSYSGVIALDFSENMLRQC  192

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK ++   N N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI R+LRP
Sbjct  193  YDFIKNDDTLLNANLALVRADVSRLPFPSCSVDAVHAGAALHCWPSPSNAVAEICRILRP  252

Query  363  GGVFVATTYIVDGIYSFTP--FVRPLRENFAQISGSHIFLDEKELEDLCTTCG  515
            GGVFVATT++      + P   +RPLR+    ++ ++ +L EKE+EDLC   G
Sbjct  253  GGVFVATTFLSSVFSDYLPSDVLRPLRQAVQPLANTYSYLTEKEIEDLCLEPG  305



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 143/194 (74%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  168  GFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  227

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK++  F +  NI +VRAD+SRLPFAS SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  228  NEFIKKDTTFDSSTNIAVVRADVSRLPFASGSVDAVHAGAALHCWPSPTNAIAEICRVLR  287

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   ++ +L + E++D+CTTCGL  ++ 
Sbjct  288  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYED  341

Query  534  IRNRRFIMLTAMKP  575
            I    FIM TA KP
Sbjct  342  IVQDSFIMFTARKP  355



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 137/192 (71%), Gaps = 6/192 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q 
Sbjct  158  GFPGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSRKFAKSGTYSAVVALDFSENMLRQS  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  218  YEFFKRDPTLLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRS  277

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGV V TT++       TP++ R LR    Q    + +L E+E+EDLC +CGL  +    
Sbjct  278  GGVLVGTTFLR--YTPSTPWITRQLRGRALQ---GYNYLTEEEIEDLCASCGLTNYTSNV  332

Query  540  NRRFIMLTAMKP  575
             + FIM +A KP
Sbjct  333  QQAFIMFSAQKP  344



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 137/195 (70%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q 
Sbjct  162  GFPGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQS  221

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  222  YEFFKRDPTLLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRS  281

Query  363  GGVFVATTYIVDGIYSFTPFV----RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            G VFV TT++      +TP      R L E   Q   S+ +L E+E+ DLCT+CGL  + 
Sbjct  282  GAVFVGTTFL-----RYTPSTSWIPRQLXERARQ---SYNYLTEEEIADLCTSCGLTNYT  333

Query  531  CIRNRRFIMLTAMKP  575
                + FIM +A KP
Sbjct  334  SNVQQSFIMFSAQKP  348



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + + Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  176  GFPGPDEEFRMAERYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  235

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK++  F +  NI +VRAD+SRLPF SSSVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  236  NEFIKKDNTFDSSTNIAVVRADVSRLPFPSSSVDAVHAGAALHCWPSPTNAIAEICRVLR  295

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +E   Q   S+ +L + E++D+CT+CGL  +  
Sbjct  296  SGGVFVGTTFLR---YSPSTPWIIRPFQERILQ---SYNYLMQDEIKDVCTSCGLTDYAD  349

Query  534  IRNRRFIMLTAMKP  575
            +    FIM TA KP
Sbjct  350  VVQDSFIMFTARKP  363



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 143/191 (75%), Gaps = 3/191 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K V GG I+D SCGSGLF+R FA+SG FS V+ALDFSE ML+Q 
Sbjct  118  GFPGPDEEFKMAQNYFKSVQGGVILDVSCGSGLFTRRFAQSGDFSSVIALDFSENMLRQS  177

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             EFI+Q+ +  N NI LVRAD++RLPFA+ S+DAVHAGAALHCWPSP+A +AEI+R+L+P
Sbjct  178  NEFIRQDPSLANSNIALVRADVARLPFATGSIDAVHAGAALHCWPSPAAGMAEIARILKP  237

Query  363  GGVFVATTYIVD-GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
            GGVFVATT++    I  F    + +R+  A  S +  + DE ELE+L   CGLV +  +R
Sbjct  238  GGVFVATTFLTPLPIIDFGN--KDIRKVGAISSSTLRYWDEAELEELMGVCGLVEYTRVR  295

Query  540  NRRFIMLTAMK  572
              +FIM++A +
Sbjct  296  LNQFIMVSAKR  306



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 139/197 (71%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY      G ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q 
Sbjct  159  GFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQS  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF K++    + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  219  YEFFKRDPTLLDTNLALVRADVARLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRS  278

Query  363  GGVFVATTYIVDGIYSFTPFV----RPLRE--NFAQISGSHIFLDEKELEDLCTTCGLVG  524
            GGVFV TT++      +TP      R LRE   + +   S+ +L E+E+ DLCT+CGL  
Sbjct  279  GGVFVGTTFL-----RYTPSTSWIPRQLREVLMWQRARQSYNYLTEEEIADLCTSCGLTN  333

Query  525  FKCIRNRRFIMLTAMKP  575
            +     + FIM +A KP
Sbjct  334  YTSNVQQSFIMFSAQKP  350



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 139/190 (73%), Gaps = 4/190 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  153  GFPGPDEEFKMAQEYFKVAEGGVLVDVSCGSGLFSRKFAKSGAYSRVVALDFSENMLRQC  212

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK +E+    N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+R+LR 
Sbjct  213  YDFIKNDESIIGSNLALVRADVSRLPFPSGSIDAVHAGAALHCWPSPSNAIAEINRILRS  272

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     + T F R L ++  +   ++ +  ++E+EDL T+CGL+ +     
Sbjct  273  GGVFVGTTFLRVNPSAPTIF-RALEQSALR---TYSYFTQEEIEDLVTSCGLINYTSKVQ  328

Query  543  RRFIMLTAMK  572
              FIM +A K
Sbjct  329  SSFIMFSAQK  338



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 142/194 (73%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  166  GFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  225

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK++  F +  NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  226  NEFIKKDATFDSSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLR  285

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   ++ +L + E++D+CTTCGL  ++ 
Sbjct  286  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYED  339

Query  534  IRNRRFIMLTAMKP  575
            I    FIM TA KP
Sbjct  340  IVQDSFIMFTARKP  353



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 140/195 (72%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF+        V GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  307  GFPGRDEEFQ-------SVAGGILVDVSCGSGLFSRKFASSGAYSSVIALDFSENMLRQC  359

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQEE   N N+ LVRADI RLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+P
Sbjct  360  YDYIKQEETPMNTNLALVRADILRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKP  419

Query  363  GGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++      G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV + 
Sbjct  420  GGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFIEGELEDLCRSCGLVNYS  478

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  479  SKVQRSFIMFSRQKP  493



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   215 bits (548),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 141/194 (73%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  168  GFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  227

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK ++ F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  228  KEFIKNDDTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLR  287

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++ 
Sbjct  288  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYED  341

Query  534  IRNRRFIMLTAMKP  575
                 FIM TA KP
Sbjct  342  YIQDSFIMFTARKP  355



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++E     +Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  147  GFPGPDEE-----EYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  201

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR 
Sbjct  202  YDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRS  261

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     S +   R LRE   Q   ++ +L E+E+EDLCT+CGL  +     
Sbjct  262  GGVFVGTTFL-RYTSSTSLTGRVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQ  317

Query  543  RRFIMLTAMKP  575
            + FIM  A KP
Sbjct  318  QSFIMFAAQKP  328



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 141/194 (73%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  169  GFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  228

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK ++ F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  229  KEFIKNDDTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLR  288

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++ 
Sbjct  289  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYED  342

Query  534  IRNRRFIMLTAMKP  575
                 FIM TA KP
Sbjct  343  YIQDSFIMFTARKP  356



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 140/194 (72%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  163  GFPGPDEEFRMAEEYFKESEGGILVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  222

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK +  F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  223  KEFIKNDNTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLR  282

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++ 
Sbjct  283  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYED  336

Query  534  IRNRRFIMLTAMKP  575
                 FIM TA KP
Sbjct  337  YIQDSFIMFTARKP  350



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 140/194 (72%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FA+SG +S V+ALD+SE ML+QC
Sbjct  165  GFPGPDEEFRMAEEYFKEAEGGLLVDVSCGSGLFSRKFAQSGKYSGVIALDYSENMLRQC  224

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK +  F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  225  KEFIKNDNTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLR  284

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++ 
Sbjct  285  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYED  338

Query  534  IRNRRFIMLTAMKP  575
                 FIM TA KP
Sbjct  339  YIQDSFIMFTARKP  352



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 140/194 (72%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  169  GFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  228

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK +  F N  NI +VRAD++RLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  229  KEFIKNDNTFDNSTNIAVVRADVARLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLR  288

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++ 
Sbjct  289  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEE  342

Query  534  IRNRRFIMLTAMKP  575
                 FIM TA KP
Sbjct  343  YIKDSFIMFTARKP  356



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 141/194 (73%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  168  GFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  227

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFI+ ++ F N  NI +VRAD+SRLPF S S+DAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  228  KEFIQNDDTFDNSTNIAVVRADVSRLPFPSGSIDAVHAGAALHCWPSPTNAIAEICRVLR  287

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++ 
Sbjct  288  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYED  341

Query  534  IRNRRFIMLTAMKP  575
                 FIM TA KP
Sbjct  342  YVQDSFIMFTARKP  355



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q  L+P  GG ++DASCGSGLFSR FA  GL+S VVALDFSE ML QC
Sbjct  167  GFPGPDEEFRMAQKILEPAAGGLLVDASCGSGLFSRRFANCGLYSGVVALDFSENMLHQC  226

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEFIKQ++     N+ LVRADISRLPF + SVDAVHAGAALHCWPSPS+AVAEISRVLRP
Sbjct  227  YEFIKQDKTLSTANLALVRADISRLPFTAGSVDAVHAGAALHCWPSPSSAVAEISRVLRP  286

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRE  440
            GGVFVATT+++ GI   +  V+PLR+
Sbjct  287  GGVFVATTFVLSGILD-SDIVKPLRQ  311



>ref|XP_009602551.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Nicotiana tomentosiformis]
Length=181

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 133/184 (72%), Gaps = 4/184 (2%)
 Frame = +3

Query  24   EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE  203
            +F++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FIK +
Sbjct  2    QFKMAQEYFKVAEGGVLVDVSCGSGLFSRKFAKSGTYSRVIALDFSENMLRQCYDFIKND  61

Query  204  ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT  383
            E+  + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+RVLR GGVFV T
Sbjct  62   ESILSSNLALVRADVSRLPFFSGSIDAVHAGAALHCWPSPSNAIAEINRVLRSGGVFVGT  121

Query  384  TYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  563
            T++     + T F R L ++  +   ++ +   +E+EDL TTCGL+ +       FIM +
Sbjct  122  TFLRVNPSAPTIF-RALEQSAGR---TYSYFTREEIEDLVTTCGLINYTSKVQNSFIMFS  177

Query  564  AMKP  575
            A KP
Sbjct  178  AQKP  181



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 139/190 (73%), Gaps = 4/190 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  157  GFPGPDEEFKMAQEYFKVAEGGVLVDVSCGSGLFSRKFAKSGAYSRVIALDFSENMLRQC  216

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIK +E+  + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+R+L  
Sbjct  217  YDFIKNDESIISSNLALVRADVSRLPFPSGSIDAVHAGAALHCWPSPSNAIAEINRILCS  276

Query  363  GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
            GGVFV TT++     + T F R L ++  +   ++ +  ++E+EDL T+CGL+ +     
Sbjct  277  GGVFVGTTFLRVNPSAPTIF-RALEQSALR---TYSYFTQEEIEDLVTSCGLINYTSKVQ  332

Query  543  RRFIMLTAMK  572
              FIM +A K
Sbjct  333  SSFIMFSAQK  342



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 7/192 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY K   GG ++D SCGSGLF+  FAKSG +S VVALDFSE ML QC
Sbjct  104  GFPGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFAIRFAKSGTYSGVVALDFSENMLLQC  163

Query  183  YEFIKQEENFP-NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            Y+++ ++ + P   +++LVRAD SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR
Sbjct  164  YDYLMRDPDTPLATDLVLVRADASRLPFTSCSVDAVHAGAALHCWPSPSNAVAEITRVLR  223

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIR  539
             GG+FV TT++     S +   +PL E   +I  S  +  E+E+EDLCT+CGL  +    
Sbjct  224  SGGIFVGTTFLRS---SPSWIFKPLNE---RILPSGNYFTEEEIEDLCTSCGLTNYTSKV  277

Query  540  NRRFIMLTAMKP  575
             + FI+ +A KP
Sbjct  278  EQSFIIFSAKKP  289



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 143/194 (74%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  613  GFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQC  672

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             EFIK++  F +  NI +VRAD+SRLPFAS SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  673  NEFIKKDTTFDSSTNIAVVRADVSRLPFASGSVDAVHAGAALHCWPSPTNAIAEICRVLR  732

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ +RP +    Q   ++ +L + E++D+CTTCGL  ++ 
Sbjct  733  SGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYED  786

Query  534  IRNRRFIMLTAMKP  575
            I    FIM TA KP
Sbjct  787  IVQDSFIMFTARKP  800



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 139/194 (72%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG E+EF++ ++Y K   GG ++D SCGSG+FSR FAKSG +S V+ALD+SE ML+QC
Sbjct  156  GFPGAEEEFKMAEEYFKEAEGGILVDVSCGSGIFSRKFAKSGKYSGVIALDYSENMLRQC  215

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
             +FIK +  F +  NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR
Sbjct  216  NDFIKNDNTFDSSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLR  275

Query  360  PGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  533
             GGVFV TT++    YS  TP+ ++P +    Q   ++ +L + E++D+CT CGL  +  
Sbjct  276  SGGVFVGTTFLR---YSPTTPWIIKPFQSRILQ---NYNYLMQDEIKDVCTACGLTDYAD  329

Query  534  IRNRRFIMLTAMKP  575
            I    FIM TA KP
Sbjct  330  IVKDSFIMFTARKP  343



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 143/202 (71%), Gaps = 14/202 (7%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG--------GNIIDASCGSGLFSRLFAKSGLFSLVVALDF  158
            GFPGP++EF++  DY +            G ++D SCGSGLFSR FAKSG+F+ VVALDF
Sbjct  127  GFPGPDQEFKMAMDYFQSATDQGEGGGSGGVVVDVSCGSGLFSRRFAKSGVFAGVVALDF  186

Query  159  SETMLQQCYEFIKQE-ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  335
            SE+ML+QCY F+K +  +    N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AV
Sbjct  187  SESMLRQCYNFLKADPASLFATNLGLVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAV  246

Query  336  AEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTC  512
            AEI+R+LR G +FV TT++    Y  TP++ +P RE  ++ S S  +L E+E+EDLC +C
Sbjct  247  AEITRILRSGAIFVGTTFLRSSPY--TPWIFKPFREKMSRSSNS--YLTEREIEDLCRSC  302

Query  513  GLVGFKCIRNRRFIMLTAMKPS  578
            GL  +     + FIM +A KP+
Sbjct  303  GLTNYSSKVQQSFIMFSARKPA  324



>ref|XP_006434006.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47246.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|KDO80934.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
 gb|KDO80935.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=288

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 10/131 (8%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  158  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            YEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  V         
Sbjct  218  YEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGV---------  268

Query  363  GGVFVATTYIV  395
             GVF   T I+
Sbjct  269  -GVFFQVTLII  278



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 141/202 (70%), Gaps = 15/202 (7%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG--------GNIIDASCGSGLFSRLFAKSGLFSLVVALDF  158
            GFPGP++EF++  DY +            G ++D SCGSGLFSR FAKSG+F+ VVALDF
Sbjct  127  GFPGPDQEFKMAMDYFQSATDQGEGGGSGGVVVDVSCGSGLFSRRFAKSGVFAGVVALDF  186

Query  159  SETMLQQCYEFIKQE-ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  335
            SE+ML+QCY F+K +  +    N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AV
Sbjct  187  SESMLRQCYNFLKADPASLFATNLGLVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAV  246

Query  336  AEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTC  512
            AEI+R+LR G +FV TT++    Y  TP++ +P RE       S+ +L E+E+EDLC +C
Sbjct  247  AEITRILRSGAIFVGTTFLRSSPY--TPWIFKPFRE---MSRSSNSYLTEREIEDLCRSC  301

Query  513  GLVGFKCIRNRRFIMLTAMKPS  578
            GL  +     + FIM +A KP+
Sbjct  302  GLTNYSSKVQQSFIMFSARKPA  323



>gb|AFK36862.1| unknown [Lotus japonicus]
Length=132

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  219  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  398
             N ILVRADI+RLPF +SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+D
Sbjct  13   RNFILVRADIARLPFVTSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYILD  72

Query  399  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  575
            G ++F PF+  +R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  73   GPFTFVPFLSTVRQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGPFVMISAAKP  131



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RLFAKSGLFS V+ALD+SE MLQQC
Sbjct  147  GFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRLFAKSGLFSQVIALDYSENMLQQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  335
            YEFI+QEENFP E + LVRADISRLPF SSS+DAVHAGAALHCWPSPS A+
Sbjct  207  YEFIEQEENFPKEKVTLVRADISRLPFESSSIDAVHAGAALHCWPSPSTAL  257



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  147  GFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR 
Sbjct  207  YDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRS  266

Query  363  GGVFVATTYIVDGIYSFTPFV-RPLRENFAQI  455
            GGVFV TT++     S T    R LRE+ A++
Sbjct  267  GGVFVGTTFLR--YTSSTSLTGRVLREDSAEL  296



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  147  GFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR 
Sbjct  207  YDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRS  266

Query  363  GGVFVATTYI  392
            GGVFV TT++
Sbjct  267  GGVFVGTTFL  276



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 3/147 (2%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR F KSG +S V+ALDFSE ML+QC
Sbjct  151  GFPGPDEEFRMAQEYFKPVEGGILVDVSCGSGLFSRKFVKSGTYSGVIALDFSENMLRQC  210

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +FI+Q+ +    NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSP  AVAEISR+LR 
Sbjct  211  NDFIEQDASILASNIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPLNAVAEISRILRS  270

Query  363  GGVFVATTYIVDGIYSFTP-FVRPLRE  440
            GGVFV +T++     S TP  +RP RE
Sbjct  271  GGVFVGSTFL--RYTSSTPRIIRPFRE  295



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score =   191 bits (484),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ LD+SE ML+QC
Sbjct  150  GFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIPLDYSENMLRQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR 
Sbjct  210  YDFIKQDDAVLKANLALVRADVSRLPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRS  269

Query  363  GGVFVATTYI  392
            GGVFV TT++
Sbjct  270  GGVFVGTTFL  279



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score =   191 bits (484),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ LD+SE ML+QC
Sbjct  150  GFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIPLDYSENMLRQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR 
Sbjct  210  YDFIKQDDAVLKANLALVRADVSRLPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRS  269

Query  363  GGVFVATTYI  392
            GGVFV TT++
Sbjct  270  GGVFVGTTFL  279



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 131/204 (64%), Gaps = 12/204 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNI-IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPG +KE+++   YL P   G + +D SCGSGLFSR FA+SG FS VVA DFSE+MLQQ
Sbjct  163  GFPGADKEYDIAMSYLLPAAAGKVLVDMSCGSGLFSRRFARSGAFSGVVAADFSESMLQQ  222

Query  180  CYEFIKQEENFPNEN--IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV  353
              E+   E    N +  I+L+RAD+ RLPFA+ SV AVHAGAA+HCWP+P  A+AEISRV
Sbjct  223  TREYCMAEGGTLNGSTPIMLLRADVGRLPFATGSVAAVHAGAAIHCWPNPQVALAEISRV  282

Query  354  LRPGGVFVATTYIVD----GIYSFTPFVRPLRENFAQISGSHI-----FLDEKELEDLCT  506
            L PGGVFVA+T++      G       VRPL +     +G  +     + +E+EL DLCT
Sbjct  283  LAPGGVFVASTFLTATAPLGQVLGDDAVRPLSQLDPTTAGGIVGTPYRWWEEQELLDLCT  342

Query  507  TCGLVGFKCIRNRRFIMLTAMKPS  578
              GL  ++  R  RFIM    KP+
Sbjct  343  AVGLQDWRRERTWRFIMFAVTKPN  366



>ref|XP_007227385.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
 gb|EMJ28584.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
Length=205

 Score =   177 bits (449),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 117/184 (64%), Gaps = 38/184 (21%)
 Frame = +3

Query  27   FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEE  206
            FEL +D+LKPV GG+IID SCGSGLFSRLFA+SGLFSLVVALD+SE MLQQ         
Sbjct  60   FELAKDFLKPVYGGSIIDTSCGSGLFSRLFARSGLFSLVVALDYSENMLQQ---------  110

Query  207  NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT  386
                 NI+LVRADISR PFA+SS DAVHA  ++    +    VA+ISRVLRPGG      
Sbjct  111  -----NIVLVRADISRPPFATSSADAVHAVYSVSNLAAMVLKVADISRVLRPGG------  159

Query  387  YIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTA  566
                              N + I+GS  F+ + +LEDLC  CGLV F  +RNR F+M++A
Sbjct  160  ------------------NISHITGSQQFVSDGKLEDLCNVCGLVSFTSVRNRAFVMISA  201

Query  567  MKPS  578
             KP+
Sbjct  202  TKPN  205



>ref|XP_008356589.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At1g78140, chloroplastic-like [Malus domestica]
Length=259

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPG EKEFEL +D+LKPV+GG NIIDASC SG+F RLFAKSGLFSLVV LD+SE ML +
Sbjct  133  GFPGLEKEFELTKDFLKPVLGGGNIIDASCWSGMFXRLFAKSGLFSLVVDLDYSENMLNE  192

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  332
            CY FI QEENFP EN+ILVRADIS+LPFA+  VD VHAG A+HCWPSPS A
Sbjct  193  CYGFIXQEENFPKENMILVRADISQLPFATGFVDTVHAGXAIHCWPSPSXA  243



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 140/196 (71%), Gaps = 8/196 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNI-IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPG ++E+++  DYL P  GG + +D SCGSGLFSR FA+SG FS V+A DFSE+MLQQ
Sbjct  72   GFPGADREYDIAMDYLLPAAGGKVLVDMSCGSGLFSRRFARSGSFSGVIAADFSESMLQQ  131

Query  180  CYEFIKQEENFPNEN--IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV  353
              E+  QE    N +  I+L+RAD++RLPFA+ SV A+HAGAA+HCWP+P AA+AEISRV
Sbjct  132  TREYCMQEGEGLNGSTPIMLLRADVARLPFATGSVAAIHAGAAIHCWPNPQAALAEISRV  191

Query  354  LRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQ-ISGSHIFLDEKELEDLCTTCGLVGFK  530
            L PGGVFVA+T++     +  P  + L ++  + +S S  + +E+EL DLC   GL GF+
Sbjct  192  LAPGGVFVASTFLT----ASAPLGQVLGDDLVRPLSQSMKYWEEQELRDLCEAVGLQGFQ  247

Query  531  CIRNRRFIMLTAMKPS  578
              R+ +FIM +A KP+
Sbjct  248  RERSWQFIMFSARKPA  263



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 128/197 (65%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYL-------KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFS  161
            GFPGP++E EL + +L       +P     ++D SCG+GL SR FAKS  F+ VVA DFS
Sbjct  112  GFPGPDREVELAETFLQTAVDPSRPDEENLLVDISCGTGLHSRRFAKSATFTAVVAADFS  171

Query  162  ETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAE  341
            E ML QC+  + ++++  NE ++LVRAD SRLPFAS S+ AV++GAALHCW SPS A+AE
Sbjct  172  EAMLIQCHALLNEKQSPWNEKVVLVRADASRLPFASGSISAVYSGAALHCWESPSIAIAE  231

Query  342  ISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLV  521
            I RVLRPGGV VATT++           + +R  F    G+ IF  E EL++L  T GLV
Sbjct  232  ICRVLRPGGVLVATTFLPRWKSKLQTTQKFMRLIF----GTKIFFFEDELDELFETSGLV  287

Query  522  GFKCIRNRRFIMLTAMK  572
             ++ I+   +IM+ A K
Sbjct  288  SYQKIKIDSYIMVCARK  304



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 111/146 (76%), Gaps = 4/146 (3%)
 Frame = +3

Query  24   EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE  203
            +F++ Q+Y KP  GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML+QCY+FIK++
Sbjct  332  QFKMAQEYFKPAAGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLRQCYDFIKKD  391

Query  204  ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT  383
                  N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV T
Sbjct  392  NPSLTTNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGT  451

Query  384  TYIVDGIY---SFTPFVRPLRENFAQ  452
            T++   IY   S    +RP R+   +
Sbjct  452  TFL-RPIYTNSSIPAILRPFRQGIQK  476


 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 119/177 (67%), Gaps = 20/177 (11%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ Q+Y  PV+GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML+QC
Sbjct  60   GFPGRDEEFKMAQEYFXPVIGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLRQC  119

Query  183  YEFIKQEE-NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
            Y+FIK+E       N+ LVRAD+SRLPF++ SVDAVHAGAALHCWPSPS AV       R
Sbjct  120  YDFIKKENPALATTNLALVRADVSRLPFSTGSVDAVHAGAALHCWPSPSNAV-------R  172

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
                  +   +   I     + R L +N+         L EKE+EDLCT+CGL+ ++
Sbjct  173  INSFMTSDMVLAKSI----EWERSL-QNYNN-------LTEKEIEDLCTSCGLINYR  217



>ref|XP_003080221.1| methyltransferase-related (ISS) [Ostreococcus tauri]
 emb|CAL54388.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=389

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 124/198 (63%), Gaps = 8/198 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKP-VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGP++E  L  D L      G I+DASCGSGLFSR F K+  +  VVALD+S+ ML+Q
Sbjct  187  GFPGPDEETRLAMDALGEFARDGIIVDASCGSGLFSRRFLKTKAYKGVVALDYSDAMLRQ  246

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
              ++++ E+   N ++  VRADI+RLPF  SS+D VHAGAA+HCWP  + AVAEI+RVL+
Sbjct  247  AKQYMEDEKLLGNADVCFVRADIARLPFPESSLDGVHAGAAIHCWPDSTTAVAEIARVLK  306

Query  360  PGGVFVATTYIVDGIYSFTPFVRPLRENFA-QISGSH------IFLDEKELEDLCTTCGL  518
            PG  F  TT++   +  F    + + +    Q SG+        +  +KEL DL T CGL
Sbjct  307  PGATFCGTTFMNPQVPFFDEDQQEVFDGVVRQFSGTENAARGFRWWSKKELRDLFTECGL  366

Query  519  VGFKCIRNRRFIMLTAMK  572
            V FKC   ++FI  +A K
Sbjct  367  VDFKCETRQQFIFYSAKK  384



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  150  GFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDYSENMLRQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  335
            Y+FIKQ++     N+ LVRAD+SRLPF+SSSVDAVHAGAALHCWPSPS AV
Sbjct  210  YDFIKQDDAVLKANLALVRADVSRLPFSSSSVDAVHAGAALHCWPSPSNAV  260



>ref|XP_001418638.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96931.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=227

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 120/203 (59%), Gaps = 13/203 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKP-VMGGNIIDASCGSGLFSRLFAK-----SGLFSLVVALDFSE  164
            GFPGP++E  L  D L     GG ++DASCGSGLF+R F K     S  +  VVALD+S+
Sbjct  25   GFPGPDEEARLAVDALGEFAKGGIVVDASCGSGLFTRRFLKTYKGRSKAYKGVVALDYSD  84

Query  165  TMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEI  344
             ML+Q  ++++ E    + ++  VRADI+RLPF   S+D VHAGAA+HCWP     VAEI
Sbjct  85   AMLRQAKQYMEDENLLGDADVCFVRADIARLPFPEGSLDGVHAGAAIHCWPDAKTGVAEI  144

Query  345  SRVLRPGGVFVATTYIVDGIYSFTP-----FVRPLRENFAQISGSHIF--LDEKELEDLC  503
            +RVL+PG  F  TT++   +  F       F   +RE    ++    F    +KEL DLC
Sbjct  145  ARVLKPGATFCGTTFMNPQVPFFDEDQQAIFDNAVREFSGTVNAERGFRWWSKKELRDLC  204

Query  504  TTCGLVGFKCIRNRRFIMLTAMK  572
            T CGLV FKC    +FI  +A K
Sbjct  205  TECGLVDFKCEIRNQFIFYSAKK  227



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 126/197 (64%), Gaps = 6/197 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG +KEFE+  DYL+   G  ++D SCGSGLFSR F +SG F+ V+A DFSE+ML Q 
Sbjct  159  GFPGEQKEFEMAMDYLQAAYGEVLVDMSCGSGLFSRRFVRSGKFAGVIAADFSESMLTQA  218

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             +F  ++ +      +L+RAD+ RLPF + SV A+HAGAA+HCWP+P+ AVAEISRVLRP
Sbjct  219  KQFFDEDRSLDTRQYVLLRADVGRLPFPTGSVAAIHAGAAIHCWPNPTMAVAEISRVLRP  278

Query  363  GGVFVATTYI-----VDGIYSFTPFVRPLRENFAQISGSHI-FLDEKELEDLCTTCGLVG  524
            GGVFV +T++     +  + +    VRPL        GS+  + +E EL +L    GL  
Sbjct  279  GGVFVGSTFLKASAPLGQLLNNDDLVRPLNSLDPMSGGSNYQWWEEAELRELTAAMGLQD  338

Query  525  FKCIRNRRFIMLTAMKP  575
            F+  R  RFIM    KP
Sbjct  339  FQRHRTNRFIMFAVQKP  355



>ref|XP_002500021.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61279.1| predicted protein [Micromonas sp. RCC299]
Length=385

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 125/217 (58%), Gaps = 29/217 (13%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGN-IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGP++EF L Q  L P   G  ++DASCGSGLF+R F KSG +  VVALDFS+ ML+Q
Sbjct  170  GFPGPDEEFRLAQAKLLPFAAGKCVVDASCGSGLFTRRFVKSGDYGCVVALDFSDAMLRQ  229

Query  180  CYEFI--------KQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  332
               F         K E    N E+++ VRADI+R+P  S SV  VHAGAA+HCWP P  A
Sbjct  230  ARTFATEEGLVDGKNEATLTNQEDLLFVRADIARIPMTSDSVGGVHAGAAIHCWPQPREA  289

Query  333  VAEISRVLRPGGVFVATTYIVDGIYSFTPFVR---------PLRENFAQI----SGSHIF  473
            VAEI RVL PGG F  TT++   +    PF            +RE  A +     G+  F
Sbjct  290  VAEICRVLEPGGSFCGTTFLTPQL----PFADDETQQRVDAAMRELQAAVVGRAGGARGF  345

Query  474  --LDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  578
               ++K+L DLC  CGLV F+C     FI  +A KP+
Sbjct  346  RQWNKKDLRDLCVECGLVDFECDIRGGFIFFSARKPA  382



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 124/210 (59%), Gaps = 19/210 (9%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPV------------MGGNIIDASCGSGLFSRLFAKSGLFSLVV  146
            GFPG EKEF++   +++              +G  ++D SCGSGLF+R F  S  F  VV
Sbjct  159  GFPGKEKEFDVAMRFVRENTNQRQQQNQKQQLGEVVLDVSCGSGLFARKFVDSKAFVRVV  218

Query  147  ALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPS  326
            A DFSE ML +  +F + EEN     I  VRAD+ RLPF + SVD VHAGAALHCWPSP+
Sbjct  219  ASDFSENMLIEASQFAR-EENIDANVITFVRADVGRLPFETGSVDVVHAGAALHCWPSPT  277

Query  327  AAVAEISRVLRPGGVFVATTYI-----VDGIYSFTPFVRPLRENFAQISGS-HIFLDEKE  488
             AVAEISRVL+PGG FVA+T++     ++      PF    R+      G+ + F  E+E
Sbjct  278  QAVAEISRVLKPGGTFVASTFLDPSANLNNDDLTKPFSDFFRDAKLGTGGAFNRFWTEQE  337

Query  489  LEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  578
            L+DLC   GL  FK  R R++I+    K S
Sbjct  338  LKDLCQMVGLEDFKRERERQYILFAVKKNS  367



>gb|KDO59317.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=319

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC
Sbjct  147  GFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQC  206

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEIS  347
            Y+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS A +  S
Sbjct  207  YDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAASVFS  261



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q 
Sbjct  158  GFPGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSRKFAKSGTYSAVVALDFSENMLRQS  217

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV  353
            YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS AV+ +S V
Sbjct  218  YEFFKRDPTJLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAVSCVSCV  274



>gb|KJB53959.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=269

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC
Sbjct  157  GFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQC  216

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  332
             +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A
Sbjct  217  NDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNA  266



>gb|EMS47735.1| hypothetical protein TRIUR3_02804 [Triticum urartu]
Length=241

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 114/195 (58%), Gaps = 38/195 (19%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ QDY + V GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QC
Sbjct  81   GFPGRDEEFQMAQDYFQSVAGGILVDVSCGSGLFSRKFASSGAYSAVIALDFSENMLRQC  140

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            Y++IKQEE   N N+ L                                 +AEISRVL+P
Sbjct  141  YDYIKQEETPMNTNLAL---------------------------------IAEISRVLKP  167

Query  363  GGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  530
            GGVFVATT++       ++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV + 
Sbjct  168  GGVFVATTFLSTPTNSSLFSIDA-LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYS  226

Query  531  CIRNRRFIMLTAMKP  575
                R FIM +  KP
Sbjct  227  SKVQRSFIMFSGQKP  241



>gb|AEJ88263.1| putative S-adenosylmethionine-dependent methyltransferase [Wolffia 
arrhiza]
Length=274

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+Y KPV GG ++D SCGSGLF R FA SG++S V+ALDFSE ML+QC
Sbjct  165  GFPGLDEEFRMAQEYFKPVEGGFLLDVSCGSGLFLRKFASSGVYSGVIALDFSENMLRQC  224

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  332
            Y+FI +++   N  I LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A
Sbjct  225  YDFISKDDTLLNAKIALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNA  274



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 127/240 (53%), Gaps = 49/240 (20%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG-----GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSET  167
            GFPG E+E E+   +L+           ++D SCGSGLFSR FA SG F+ VVA DFS +
Sbjct  140  GFPGEEEETEIAMTFLRGAGATTAPRATLLDVSCGSGLFSRRFAASGEFAHVVASDFSAS  199

Query  168  MLQQCYEFIKQEENFPNE---------------------------------NIILVRADI  248
            M++Q   + + +    N                                   +  VRAD+
Sbjct  200  MMRQTKAYCEADARLSNALRRKPVWEAGWEEEDAAARASASTSTSTSTTSTRLSFVRADV  259

Query  249  SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY------IVDGIYS  410
             RLPFA+ S DAVHAGAA+HCWPSPSAAVAEISRVLRPGGVF+A+T+      + D + S
Sbjct  260  GRLPFATGSFDAVHAGAAMHCWPSPSAAVAEISRVLRPGGVFIASTFLDPTSMLGDALGS  319

Query  411  ---FTPFVRPLRENFAQISGS-HIFLDEKELEDLCT-TCGLVGFKCIRNRRFIMLTAMKP  575
                 P     RE+     G+ + F  EKEL DL T  CGL  F+  R R+FI  +  KP
Sbjct  320  DEMVQPLSAAFRESGLGTGGAFNQFWSEKELRDLTTGMCGLERFERKRERQFIFFSVRKP  379



>ref|XP_006826926.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
 gb|ERM94163.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
Length=215

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GF G +KEFE +  YL+P +GG I+DASCGSG+FSR FAK+G++S+ VALDF+E ML++C
Sbjct  101  GFSGLDKEFETVTKYLQPTLGGIIVDASCGSGMFSRRFAKNGMYSVAVALDFTENMLKEC  160

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  335
            Y F+KQ E+    N++LVRADISRLPF +SSVDAVHAGAA+HC  SPS AV
Sbjct  161  YGFVKQ-ESITTRNLVLVRADISRLPFVTSSVDAVHAGAAIHCCLSPSTAV  210



>ref|XP_002506188.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67446.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 122/211 (58%), Gaps = 20/211 (9%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGN----IIDASCGSGLFSRLFAKSGLFSLVVALDFSETM  170
            GFPG   E+E   +Y+K    G     ++D SCGSGLF+R FA SG F  VVA D+S +M
Sbjct  148  GFPGESTEWEYAMEYVKAAGHGGGGGVLLDVSCGSGLFTRRFAASGAFDHVVASDYSASM  207

Query  171  LQQCYEFIKQEEN----FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVA  338
            ++Q   +   ++       +  +  VRAD+ RLPFA+ SVD VHAGAA+HCWPSPSAA+ 
Sbjct  208  MRQTVTYCDADDATCSAVKDGALSFVRADVGRLPFATGSVDVVHAGAAMHCWPSPSAAMV  267

Query  339  EISRVLRPGGVFVATTY-----IVDGIYSFTPFVRP-------LRENFAQISGSHIFLDE  482
            E++RVLRPGGVFVA+T+     +++ ++               +          + F  E
Sbjct  268  EVARVLRPGGVFVASTFMDPTSMLEDVFGAGAEAAAAPLAEAFVNSGVGTGGAFNQFWRE  327

Query  483  KELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  575
            K+L DL   CGL GF+  R+R+FI+    KP
Sbjct  328  KDLRDLTGMCGLEGFERRRSRQFILFRVNKP  358



>ref|XP_003057905.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57856.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=235

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 118/215 (55%), Gaps = 28/215 (13%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNI-IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGP++E++L +  L P     + +DASCGSGLF+R FAKSG +S VVALD+S  ML Q
Sbjct  25   GFPGPDEEYDLARAKLLPHAADKVLVDASCGSGLFTRRFAKSGDYSAVVALDYSAAMLTQ  84

Query  180  CYEFIKQE--------ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  335
              +F   E            N +I  VRADI+R+PF   SV  VHAGAA+HCWP P AA 
Sbjct  85   ARQFAIDEGLLDASGAAKDDNTDITFVRADIARMPFPEGSVGGVHAGAAIHCWPDPRAAA  144

Query  336  AEISRVLRPGGVFVATTYIVDGIYSFTPFVR---------PLRENFAQISG------SHI  470
            AEI+R L  GG F  TT++   +    PF+           +RE    ISG         
Sbjct  145  AEIARALERGGSFCGTTFLTPRV----PFLDDAGQQQLDAAMREVQDAISGRAGGARGFR  200

Query  471  FLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  575
              +  +L+DLC  CGLV F+      FI  +A KP
Sbjct  201  MWNRADLKDLCEECGLVDFESDVRDGFIFFSAKKP  235



>ref|XP_009337420.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009337422.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=89

 Score =   132 bits (333),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = +3

Query  198  QEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  377
            +    P ENIILV+ADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV
Sbjct  6    RRRTSPKENIILVKADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  65

Query  378  ATTYIVDGIYSFTPFVRPLRENFAQIS  458
            A+TYI+DG +S  PF+R    N  Q++
Sbjct  66   ASTYILDGRFSHIPFLR----NITQVT  88



>gb|KDO80936.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=232

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QC
Sbjct  158  GFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQC  217

Query  183  YEFIKQEENFPNE  221
            YEF++QE NFP E
Sbjct  218  YEFVQQESNFPKE  230



>ref|XP_009337419.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337421.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=110

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = +3

Query  198  QEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  377
            +    P ENIILV+ADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV
Sbjct  6    RRRTSPKENIILVKADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  65

Query  378  ATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL--CTTCG  515
            A+TYI+DG +S  PF+R    N  Q+  S+  L   +  D   C  C 
Sbjct  66   ASTYILDGRFSHIPFLR----NITQVHLSYSKLSLLQFWDSAECAPCS  109



>ref|XP_007514982.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15222.1| predicted protein [Bathycoccus prasinos]
Length=383

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 111/200 (56%), Gaps = 10/200 (5%)
 Frame = +3

Query  3    GFPGPEKEFE-LMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPG E E E  M+   +  +G  IID SCGSGLF+R FA+SG +  +VALDFSE+M+++
Sbjct  185  GFPGVEVEKENAMEALGEDAVGDVIIDCSCGSGLFTREFARSGKYDGIVALDFSESMIKE  244

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
              E  +++ + P + I  VRAD+ RLPFA+ S+  V A AA+HCWP   +A AEI RVL+
Sbjct  245  AMERAQKDTSVPADKIAFVRADVGRLPFANDSIGGVSASAAIHCWPDVQSACAEIFRVLK  304

Query  360  PGGVFVATTYIV--------DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCG  515
            PG +F  TT+          D     +   R L  +    +G   F +  +L D   + G
Sbjct  305  PGRIFTGTTFATPNVPFLDDDQNRLLSTLSRDLSASRPGTNGLR-FWNSADLRDQLQSIG  363

Query  516  LVGFKCIRNRRFIMLTAMKP  575
                  +R + ++   A KP
Sbjct  364  FSDVTILREKDYLFWKARKP  383



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+ L+P  G  I+D SC  G  +R FA S  + LV+A D+SE ML + 
Sbjct  148  GFPGFDEEFTMAQEILRPCFGKAIMDLSCAGGTLTRKFAASNAYKLVIASDYSEAMLNES  207

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            +  +  + +     ++LV+AD  RLPF SSS+ AVH  AA+HCWP P  AVAEI+R+L+P
Sbjct  208  FHLLAGDPDINVSKVVLVKADAGRLPFTSSSLAAVHTSAAIHCWPQPLHAVAEIARLLQP  267

Query  363  GGVFVATT  386
            GG+FVA+T
Sbjct  268  GGIFVAST  275



>ref|XP_005536724.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80688.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=441

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 112/187 (60%), Gaps = 22/187 (12%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGN-IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  179
            GFPGP+ EF ++Q + K   G N ++D SCGSGLF+R  A SG F  V+A+D+SE ML++
Sbjct  237  GFPGPDAEFRIVQSFFK---GANCVMDLSCGSGLFTRRLAASGDFDHVIAVDYSEAMLRE  293

Query  180  CYEFIKQEE-------NFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  335
              E  ++E         F ++ I  ++RAD+ RLPFA+ S+D +HAGAALHCWP     +
Sbjct  294  LVERAEREPLPERIGGGFVSDRITGIIRADVERLPFANESIDCIHAGAALHCWPCVQDGL  353

Query  336  AEISRVLRP-----GGVFVATTYIVDGIYSFTPFVRPLRE-NFAQISGSHIFLDEKELED  497
             E+ R+LRP      G F+ATT+    ++S +PF   +RE      S  + F D KELE 
Sbjct  354  HEVYRILRPSKGPGSGRFLATTF----LWSTSPFGLAVREGRLLSPSAGYRFFDAKELEW  409

Query  498  LCTTCGL  518
            L  + G 
Sbjct  410  LVKSAGF  416



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF + Q+ L+P  G  I+D SC  G  +R FA S  + LV+A D+SE ML + 
Sbjct  320  GFPGFDEEFTMAQEILRPCFGKAIMDLSCAGGTLTRKFAASNAYKLVIASDYSEAMLNES  379

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
            +  +  + +     ++LV+AD  RLPF SSS+ AVH  AA+HCWP P  AVAEI+R+L+P
Sbjct  380  FHLLAGDPDINVSKVVLVKADAGRLPFTSSSLAAVHTSAAIHCWPQPLHAVAEIARLLQP  439

Query  363  GGVFVATT  386
            GG+FVA+T
Sbjct  440  GGIFVAST  447


 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 101/173 (58%), Gaps = 14/173 (8%)
 Frame = +3

Query  27   FELMQDYLKPVMGG-NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE  203
            F + Q  ++PV  G  I+D SC  G F+R F  S  +  V+A D+S+ ML+QC  F++ +
Sbjct  12   FRMAQKLIEPVARGETIMDLSCAGGCFTRRFLASKSYKRVIAADYSQEMLEQCRGFLESD  71

Query  204  ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT  383
                    +L+RAD  RLP A+SSV AVH+GAA+HCWP P  AVAEISRVLRP G+FV +
Sbjct  72   SFLDMSECVLLRADAGRLPLANSSVAAVHSGAAIHCWPEPIIAVAEISRVLRPQGLFVGS  131

Query  384  TYI-------VDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLV  521
            T++       +DGI      + P+RE   Q+        +KEL+ L    G+ 
Sbjct  132  TFVFPEPPPPIDGI------INPVREAIMQLQVPFKAWTQKELQQLVEAGGMA  178



>gb|EJK66010.1| hypothetical protein THAOC_13088 [Thalassiosira oceanica]
Length=446

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 91/141 (65%), Gaps = 11/141 (8%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGN---------IIDASCGSGLFSRLFAKSGLFSLVVALD  155
            GFPG + E+EL ++Y +PV+            ++D SC +GLF+R FAKSG ++ V+A D
Sbjct  240  GFPGADAEYELAKEYFEPVIASKRAKGDGTDVLVDMSCATGLFTRRFAKSGDYTRVIACD  299

Query  156  FSETMLQQCYEFIKQEENFPN--ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSA  329
            +SE+ML +    I+++ +  N    + LVR D+ R+P  S SVDA HAGAA+HCWP    
Sbjct  300  YSESMLNEARRRIREDADIANAPTKLDLVRCDVGRIPMKSDSVDAFHAGAAMHCWPEIEK  359

Query  330  AVAEISRVLRPGGVFVATTYI  392
            ++ EI RVL PGG + ATT++
Sbjct  360  SLQEIHRVLVPGGRYFATTFL  380



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 95/155 (61%), Gaps = 24/155 (15%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVAL---DFSETML  173
            GFPG E+E +++  Y           A   +  FS   A+  LF+  + L   DFSE ML
Sbjct  168  GFPGLERERDMINIY-----------AQMFTQPFSLRQARKVLFASKLGLAQSDFSENML  216

Query  174  QQCYEFIKQEE-------NFPNEN---IILVRADISRLPFASSSVDAVHAGAALHCWPSP  323
            +QC E++KQE         FPN     + L RADISRLPF S S+DAVHA AA+HCWPSP
Sbjct  217  KQCNEYVKQENISDKYGPQFPNHQHLTLALARADISRLPFVSGSIDAVHAAAAIHCWPSP  276

Query  324  SAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  428
            + AVAEISRVLRPGGVFVA+T++ D +    P +R
Sbjct  277  ACAVAEISRVLRPGGVFVASTFVADILPPAVPVLR  311



>ref|XP_005824779.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
 gb|EKX37799.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
Length=365

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 108/197 (55%), Gaps = 14/197 (7%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFS-------LVVALDFS  161
            GFPG EKE+EL+ D+ +      ++D SCGSGL  R  AKS  +S        V+A+D+S
Sbjct  171  GFPGIEKEYELVMDFFQEARNKTVVDLSCGSGLMVRRLAKSRAYSKAMGERLQVIAVDYS  230

Query  162  ETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAE  341
            E ML +  +  K+EEN P+ +II  RAD++ LPF   S+DA+H+GAALHCWP     + E
Sbjct  231  ENMLGEVIQR-KKEENCPDFDII--RADVASLPFVDGSLDAIHSGAALHCWPYVQDGLKE  287

Query  342  ISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLV  521
            + RVL+PGG F A+T+    ++     V  L+ N       + F   +ELE L    G  
Sbjct  288  VHRVLKPGGRFFASTF----LWGVPDEVISLQANLGPRQRQYRFFSVEELEWLMRGAGFK  343

Query  522  GFKCIRNRRFIMLTAMK  572
                 R  R  ++   K
Sbjct  344  DVNVERRDRCALIRCRK  360



>ref|XP_010534072.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=283

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGPE+EFE+ +DYLKP +GG IIDASCGSG+FSRLFA+SGLFS V+ALD+SE ML+QC
Sbjct  166  GFPGPEREFEMAKDYLKPALGGKIIDASCGSGMFSRLFARSGLFSQVIALDYSENMLRQC  225

Query  183  YEFIKQEENFPNE  221
            YEF+ QEENFP +
Sbjct  226  YEFVNQEENFPKD  238



>ref|XP_005713645.1| unnamed protein product [Chondrus crispus]
 emb|CDF33826.1| unnamed protein product [Chondrus crispus]
Length=298

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG EKE +L  D+  P     ++D SCGSGL +R  A SG F  VVA D+S+ ML+Q 
Sbjct  101  GFPGIEKERDLFLDFAAPAAA--VLDMSCGSGLMARRLASSGRFGRVVAADYSDAMLRQT  158

Query  183  YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP  362
             E+  ++   P  ++  VRAD++RLPF   +  AVH+GAALHCWP+    +AEI RVL+P
Sbjct  159  VEYKNKDATAPEFDV--VRADVARLPFVEGAFGAVHSGAALHCWPNVQDGLAEIQRVLQP  216

Query  363  GGVFVATTY  389
            GG F ATT+
Sbjct  217  GGRFFATTF  225



>gb|AAD12007.1| hypothetical protein [Arabidopsis thaliana]
Length=262

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 15/113 (13%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF + ++Y K   GG ++D              SG +S V+ALD+SE ML+QC
Sbjct  163  GFPGPDEEFRMAEEYFKEAEGGLLVD--------------SGKYSGVIALDYSENMLRQC  208

Query  183  YEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVA  338
             EFIK +  F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ AV+
Sbjct  209  KEFIKNDNTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAVS  261



>ref|XP_002185698.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65168.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=412

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 87/137 (64%), Gaps = 7/137 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG----GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETM  170
            GFPG + E +L  DY  PVM       ++D SC +GLF+R FAKSG ++ V+  D+S +M
Sbjct  212  GFPGADDEAQLAMDYFAPVMAMSDTKTLVDMSCATGLFTRRFAKSGKYARVLGCDYSASM  271

Query  171  LQQCYEFIKQEENFP---NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAE  341
            L + +  I+         N  + L+R D+ ++P  ++SVD +HAGAA+HCWP   AA AE
Sbjct  272  LNEAHTRIQANPRLNGNRNTQLDLIRLDVGQIPMKNASVDCLHAGAAMHCWPDLPAAAAE  331

Query  342  ISRVLRPGGVFVATTYI  392
            I RVL+PGG + ATT++
Sbjct  332  IYRVLKPGGRYFATTFL  348



>gb|KCW45297.1| hypothetical protein EUGRSUZ_L01041 [Eucalyptus grandis]
Length=239

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC
Sbjct  150  GFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDYSENMLRQC  209

Query  183  YEFIKQEENFPNENIILVRADISRLPFASS  272
            Y+FIKQ++     N+ LVRAD+SRLPF+S+
Sbjct  210  YDFIKQDDAVLKANLALVRADVSRLPFSST  239



>gb|KIY98469.1| putative methyltransferase [Monoraphidium neglectum]
Length=249

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 18/131 (14%)
 Frame = +3

Query  225  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI  404
            I+ VRADI+RLPFA+ SVDA+HAGAA+HCWP+P AA+AEISRVLRPGGVFVA+T++    
Sbjct  53   IVCVRADIARLPFATGSVDAIHAGAAIHCWPNPQAALAEISRVLRPGGVFVASTFLT---  109

Query  405  YSFTPF--------VRPLRENFAQI------SGSHIFLDEKELEDLCTTCGLVGFKCIRN  542
              F P         VRP+ +   +       + ++   ++ EL +L    GL    C+R 
Sbjct  110  -PFAPIGELLGDDTVRPISQALERTPWARGRAATYRQWEQAELRELAGQVGLAWRGCVRA  168

Query  543  RRFIMLTAMKP  575
             RFI+  A KP
Sbjct  169  NRFILFAADKP  179



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 88/150 (59%), Gaps = 22/150 (15%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG-----------------GNIIDASCGSGLFSRLFAKSGL  131
            GFPG ++EF  ++ +  P+                   G +ID SCGSGL +R   +S  
Sbjct  190  GFPGIDEEFRDLEAFFAPLSDAGSESEREGEQQRRSGRGTVIDLSCGSGLMARRLCRSRK  249

Query  132  FSLVVALDFSETMLQQCYE-FIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALH  308
            +  V+A DFSE+ML++    F++++   P     LVRAD SR PF +SSVDA+HAGAALH
Sbjct  250  WKRVIAADFSESMLRETRRRFLEEKLPVPE----LVRADASRQPFQTSSVDAIHAGAALH  305

Query  309  CWPSPSAAVAEISRVLRPGGVFVATTYIVD  398
            CWP    ++ E  RVL+PGG   A+T+ V+
Sbjct  306  CWPRLEESLRECLRVLKPGGRMYASTFEVN  335



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 88/150 (59%), Gaps = 22/150 (15%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG-----------------GNIIDASCGSGLFSRLFAKSGL  131
            GFPG ++EF  ++ +  P+                   G +ID SCGSGL +R   +S  
Sbjct  190  GFPGIDEEFRDLEAFFAPLSDAGSESEREGEQQRRSGRGTVIDLSCGSGLTARRLCRSRK  249

Query  132  FSLVVALDFSETMLQQCYE-FIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALH  308
            +  V+A DFSE+ML++    F++++   P     LVRAD SR PF +SSVDA+HAGAALH
Sbjct  250  WKRVIAADFSESMLRETRRRFLEEKLPVPE----LVRADASRQPFQTSSVDAIHAGAALH  305

Query  309  CWPSPSAAVAEISRVLRPGGVFVATTYIVD  398
            CWP    ++ E  RVL+PGG   A+T+ V+
Sbjct  306  CWPRLEESLRECLRVLKPGGRMYASTFEVN  335



>emb|CBJ26935.1| S-adenosyl-L-methionine-dependent methyltransferases-like [Ectocarpus 
siliculosus]
Length=471

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 95/188 (51%), Gaps = 16/188 (9%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVM--GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ  176
            GFPG ++EF L  +Y       G  +ID SCGSGL  R    SG +S V+  D S TML 
Sbjct  282  GFPGIDEEFRLASEYFSSTGADGKAVIDLSCGSGLMMRRLVSSGRYSRVIGGDLSPTMLA  341

Query  177  QCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVL  356
            +     ++E+    E   L+R D+SRLP  + S+D VHAGAALHCW     +++E+ RVL
Sbjct  342  ETARRFREEDLGAPE---LIRCDVSRLPLKTESLDGVHAGAALHCWSKLEESLSEVHRVL  398

Query  357  RPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVG  524
            +PG  F ATT++   +   T          R+ F        F +  ELE L    G   
Sbjct  399  KPGRGFFATTFLNSAVLGNTAGNTVGNSRRRDGFK-------FFELAELEQLMRNAGFED  451

Query  525  FKCIRNRR  548
             K ++  R
Sbjct  452  VKVVKEGR  459



>ref|XP_002503324.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
 gb|ACO64582.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
Length=903

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 80/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVM------GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSE  164
            GFPGP+ E  +    L+P           +++ SCG G+F+ +FA+   F  +VA D++E
Sbjct  158  GFPGPDAEHLMALSQLRPARTALDEADATLLELSCGPGMFAEMFARGSEFPRIVATDYAE  217

Query  165  TMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEI  344
             M  +  E I    N   ++  +VRAD+  LPF   +  AVH+ A +HCWP P+  + E+
Sbjct  218  AMCARTLERIASSPNARAKDTAVVRADVGNLPFDDDAFAAVHSAAGIHCWPEPARGLEEV  277

Query  345  SRVLRPGGVFVATTYIV  395
            SRVL+PGG FVA+T ++
Sbjct  278  SRVLKPGGTFVASTVVL  294



>ref|XP_005781281.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
 gb|EOD28852.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
Length=459

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 95/177 (54%), Gaps = 9/177 (5%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG---GNIIDASCGSGLFSR--LFAKSGLFSLVVALDFSET  167
            GFPG EKE++ +  + +PV     G ++D SCGSGL  R  L  + G     +A D+SE 
Sbjct  131  GFPGIEKEYDEVSAFFEPVAAQGRGVVVDMSCGSGLMYRRLLAGRIGGSGRTLACDYSEV  190

Query  168  MLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEIS  347
            ML++       E+      + L+R D+++LP    +VDA+HAGAALH WP+    ++EI 
Sbjct  191  MLKETRRRA-LEQGLAPAALELLRCDVAQLPMRDGAVDAMHAGAALHSWPNLEKGLSEIR  249

Query  348  RVLRP-GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCG  515
            RVLRP GG F ATT++  G Y  T    P +      S    F  E+EL  L    G
Sbjct  250  RVLRPDGGRFFATTFL-RGAYPGTTSATPGQSGGGGGS-FRFFESEEELRQLLIAAG  304



>gb|KIE07218.1| hypothetical protein DA73_0239355 [Tolypothrix bouteillei VB521301]
Length=263

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 79/127 (62%), Gaps = 2/127 (2%)
 Frame = +3

Query  12   GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF  191
            G + EF L  ++      G + D SCG+G+ +R  AK G    ++ALD+SETML +  + 
Sbjct  94   GIDAEFRLCTEFFGQ-NPGIVADVSCGTGIMARRLAKWGKCEQILALDYSETMLSELQQQ  152

Query  192  IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV  371
            ++ E   P+E I + RAD+  LP A +S+DA++AGAA+HCW   +  +  I + LRPGG 
Sbjct  153  MQLEGISPSE-IAIARADVEALPLAPNSIDAIYAGAAMHCWNDATEGIRNIYQALRPGGK  211

Query  372  FVATTYI  392
             +ATT++
Sbjct  212  LLATTFL  218



>ref|XP_002992310.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
 gb|EFJ06586.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
Length=212

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 103/204 (50%), Gaps = 41/204 (20%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPG   + ++  +YL+P  GG I+D SCGS               V+ALDFSE+MLQQC
Sbjct  35   GFPG---QLKMALEYLRPAFGGVIVDVSCGSA--------------VIALDFSESMLQQC  77

Query  183  YEFIKQEE--------NFPNENIILVRADIS----RLPFA--SSSVDAVHAGAALHCWPS  320
             EF+KQ++        N     ++  + +IS    R+ F         +     LHC   
Sbjct  78   AEFVKQDKSLRTAYDSNHLWSVVLFGQNEISPWFERMLFVFLLRPEPFLLFMLVLHCIAG  137

Query  321  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  500
                  ++ + L+PGGVFVATT++ + I+SF P  R         S S  +  EKELE+L
Sbjct  138  HLFHPQDM-QSLKPGGVFVATTFLSNSIFSFLPKRR---------SSSLRYWTEKELEEL  187

Query  501  CTTCGLVGFKCIRNRRFIMLTAMK  572
            C  CGLV ++      +IML+A K
Sbjct  188  CKLCGLVDYQKKMKGNYIMLSARK  211



>emb|CEF97980.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=273

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 96/193 (50%), Gaps = 19/193 (10%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQ  179
            G+PGP+ E E     L P     ++DASCG GL +   AK+ G F+ V+A+D+SE M+++
Sbjct  97   GYPGPDAEAECAATVLAP--SKRLLDASCGPGLITEKLAKAPGSFTSVIAIDYSEAMVKE  154

Query  180  CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
              E +        ++ +   AD+S LPFA    DAVH+ A  HCW  P     E+ R LR
Sbjct  155  ARERL-------GDDALACCADVSDLPFADEVFDAVHSSAGAHCWDDPVKGFVELHRTLR  207

Query  360  PGG-VFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCI  536
            PGG   V+T  ++    S   + R  + N         F +E+ +  +  + G    + +
Sbjct  208  PGGKALVSTVVLLKTTGSEEDYTRKRKSNTP-------FWNERAVCRMMESVGFRNVEVV  260

Query  537  RNRR-FIMLTAMK  572
            R  + F+ + A K
Sbjct  261  RKDKCFVAIKATK  273



>ref|XP_002502147.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63405.1| predicted protein [Micromonas sp. RCC299]
Length=373

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 105/223 (47%), Gaps = 42/223 (19%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMG----GNI-IDASCGSGLFSRLFAKSGL--FSLVVALDFS  161
            G+PG + E  L    +    G    G I +D SCG G+ +   A SGL  + ++VA D S
Sbjct  161  GYPGADAEAALALVKINRPAGDSSEGRICLDLSCGPGIITTRLA-SGLRGYEILVASDVS  219

Query  162  ETMLQQCYE---------FIKQEENF-PNENIILVRADISRLPFASSSVDAVHAGAALHC  311
            E M ++  E          I+ E    P  N   VRAD++ +PF  SSVDAVH  A  HC
Sbjct  220  EAMTRRAAEQLDAVSARSTIRPEPGAAPLPNFAAVRADVASMPFGDSSVDAVHCSAGAHC  279

Query  312  WPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQ-------------  452
            WP P   + E+ R+L+PGGVFV +T +            P+RE +A+             
Sbjct  280  WPDPMDGLREVERILKPGGVFVTSTVV---------LAPPIREKYAKGGDCTDAQSYDDK  330

Query  453  -ISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR-FIMLTAMKP  575
              + +  F D   +  +    GL G + ++  + F+ML A KP
Sbjct  331  VRTMNTPFWDTASVVAMLQKAGLKGVEIVKEDKCFVMLAARKP  373



>ref|XP_010250394.1| PREDICTED: uncharacterized protein LOC104592660 [Nelumbo nucifera]
Length=795

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC  182
            GFPGP++EF++  +Y KP  GG ++D SCGSGLFSR FA+SG +S V+ALDFSE ML+QC
Sbjct  152  GFPGPDEEFKMALEYFKPAEGGLLVDVSCGSGLFSRKFAESGTYSGVIALDFSENMLRQC  211

Query  183  YEFIKQEENFPNENII  230
            Y+FIK+++N  N   I
Sbjct  212  YDFIKKDDNILNSGFI  227


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +3

Query  324  SAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQI-SGSHIFLDEKELEDL  500
            +  VAEI+R+LR GG+FV TT++         F   +  N  Q+ S  + +L EKE+EDL
Sbjct  713  TGVVAEITRILRSGGIFVGTTFLAPRFGD--SFRSEIYRNLRQLASNGYGYLTEKEIEDL  770

Query  501  CTTCGLVGFKCIRNRRFIMLTAMK  572
            C +CGL+ +     + FIM +A K
Sbjct  771  CISCGLINYTSKVQQSFIMFSAQK  794



>ref|XP_005705444.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
 gb|EME28924.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
Length=331

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 96/173 (55%), Gaps = 17/173 (10%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYLK--PVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ  176
            G+P  E E  L+ +Y +  P     ++D SCG+G  +R  AK+  +S +V +D SE+ML+
Sbjct  147  GYPLKE-EVRLVTEYFQTYPKEPEVLVDLSCGTGYVTRRLAKTRKYSRIVGIDLSESMLK  205

Query  177  QCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVL  356
            + Y  +  EE    +   L+RA++  LP   + VD ++ GAALHCWP     +AE+ R+L
Sbjct  206  EAYRRMLLEEGC--DPFTLIRANVDSLPLRDNVVDLIYCGAALHCWPKVQDGLAEMYRIL  263

Query  357  RPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCG  515
            +P  +  ATT+I +    ++P +   R N      ++ F  +KELE L  + G
Sbjct  264  KPDALVFATTFISN----YSPLIS--RWN------AYRFFTKKELEWLLKSRG  304



>ref|XP_003079346.1| non-transporter ABC protein (ISS) [Ostreococcus tauri]
Length=1835

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 96/193 (50%), Gaps = 19/193 (10%)
 Frame = +3

Query  3     GFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQ  179
             G+PGP+ E E     L P     ++DASCG GL +   AK+ G F+ V+A+D+SE M+++
Sbjct  1659  GYPGPDAEAECAATVLAP--SKRLLDASCGPGLITEKLAKAPGSFTSVIAIDYSEAMVKE  1716

Query  180   CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLR  359
               E +        ++ +   AD+S LPFA    DAVH+ A  HCW  P     E+ R LR
Sbjct  1717  ARERL-------GDDALACCADVSDLPFADEVFDAVHSSAGAHCWDDPVKGFVELHRTLR  1769

Query  360   PGG-VFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCI  536
             PGG   V+T  ++    S   + R  + N         F +E+ +  +  + G    + +
Sbjct  1770  PGGKALVSTVVLLKTTGSEEDYTRKRKSNTP-------FWNERAVCRMMESVGFRNVEVV  1822

Query  537   RNRR-FIMLTAMK  572
             R  + F+ + A K
Sbjct  1823  RKDKCFVAIKATK  1835



>ref|WP_037584032.1| hypothetical protein, partial [Stigmatella aurantiaca]
Length=252

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 96/190 (51%), Gaps = 18/190 (9%)
 Frame = +3

Query  15   PEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  194
            PE E   +Q +L+PV  G ++D +CG+G ++R  A       ++ALD S  ML+   E +
Sbjct  78   PELEDAYLQKFLRPV-DGPVLDLACGAGRWTRTLANLVGVERLIALDLSRAMLEAAKEVL  136

Query  195  KQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF  374
                     N+  VR +  +LP + +S+ AV    +L   P+PS A+ E+SR L+PGGVF
Sbjct  137  P--------NVFFVRGNAQQLPLSDASLGAVSCWNSLQLLPNPSEAIREVSRCLKPGGVF  188

Query  375  VATTY--IVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR  548
               TY    + +Y +       +  FA+  G   F DE+EL    T  GLV         
Sbjct  189  TCFTYRRAREPLYGY------FQSTFARNGGVRPF-DEEELRQWLTQAGLVVEDLGGPNL  241

Query  549  FIMLTAMKPS  578
             ++LTA KP+
Sbjct  242  ALLLTARKPT  251



>gb|ADO73882.1| Methyltransferase type 11 [Stigmatella aurantiaca DW4/3-1]
Length=265

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 96/190 (51%), Gaps = 18/190 (9%)
 Frame = +3

Query  15   PEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  194
            PE E   +Q +L+PV  G ++D +CG+G ++R  A       ++ALD S  ML+   E +
Sbjct  91   PELEDAYLQKFLRPV-DGPVLDLACGAGRWTRTLANLVGVERLIALDLSRAMLEAAKEVL  149

Query  195  KQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF  374
                     N+  VR +  +LP + +S+ AV    +L   P+PS A+ E+SR L+PGGVF
Sbjct  150  P--------NVFFVRGNAQQLPLSDASLGAVSCWNSLQLLPNPSEAIREVSRCLKPGGVF  201

Query  375  VATTY--IVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR  548
               TY    + +Y +       +  FA+  G   F DE+EL    T  GLV         
Sbjct  202  TCFTYRRAREPLYGY------FQSTFARNGGVRPF-DEEELRQWLTQAGLVVEDLGGPNL  254

Query  549  FIMLTAMKPS  578
             ++LTA KP+
Sbjct  255  ALLLTARKPT  264



>ref|XP_007514207.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15644.1| predicted protein [Bathycoccus prasinos]
Length=209

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 101/196 (52%), Gaps = 12/196 (6%)
 Frame = +3

Query  3    GFPGPEKEFELMQDYL--KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ  176
            G+PG EKE E +   L  +      ++D SCG G+ ++    S +F+ V ALDF E+M +
Sbjct  15   GYPGCEKEAEEVVSILASENERAMQLLDVSCGPGVVTKSIISSKMFAKVYALDFYESMCE  74

Query  177  QCYEFIKQEENFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV  353
            +  E  ++E    N N   +VR D+S LPFA+ + + V + A +HCWP+P   + EI RV
Sbjct  75   RAKETFERECTTGNNNSYEVVRGDVSDLPFANETFEKVSSTAGMHCWPNPVKGMKEIKRV  134

Query  354  LRPGGVFVATTYIVDGIYSFTPFVRPLRENFA----QISGSHIFLDEKELEDLCTTCGLV  521
            L+P     A +   D    F+  V P + N      +   +  FLD + + D+    G  
Sbjct  135  LKPS----ARSDEDDWGVLFSTVVLPRKGNETRETYKWETNKPFLDREAVLDIVRESGFD  190

Query  522  GFKCI-RNRRFIMLTA  566
             ++ +  ++ +I++ A
Sbjct  191  EYEVVMEDKAYILVKA  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380