BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN020C05

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083416.1|  PREDICTED: uncharacterized protein LOC105165954    207   2e-63   Sesamum indicum [beniseed]
gb|EYU36814.1|  hypothetical protein MIMGU_mgv1a013669mg                202   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_011074724.1|  PREDICTED: DNL-type zinc finger protein-like       202   4e-61   Sesamum indicum [beniseed]
ref|NP_001274971.1|  uncharacterized protein LOC102584137               200   1e-60   Solanum tuberosum [potatoes]
ref|NP_001266237.1|  Hop-interacting protein THI120                     200   1e-60   
emb|CDP07337.1|  unnamed protein product                                200   4e-60   Coffea canephora [robusta coffee]
ref|XP_009776939.1|  PREDICTED: uncharacterized protein LOC104226608    199   5e-60   Nicotiana sylvestris
ref|XP_009620058.1|  PREDICTED: uncharacterized protein LOC104111945    198   7e-60   Nicotiana tomentosiformis
ref|XP_006435267.1|  hypothetical protein CICLE_v10002475mg             194   2e-58   Citrus clementina [clementine]
gb|EPS65916.1|  hypothetical protein M569_08860                         192   3e-58   Genlisea aurea
ref|XP_010266915.1|  PREDICTED: uncharacterized protein LOC104604317    193   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010539089.1|  PREDICTED: uncharacterized protein LOC104813220    193   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_007017922.1|  Zim17-type zinc finger protein                     192   1e-57   
ref|XP_010664127.1|  PREDICTED: uncharacterized protein LOC100243759    191   5e-57   Vitis vinifera
ref|XP_002307755.2|  hypothetical protein POPTR_0005s26750g             191   7e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011003097.1|  PREDICTED: uncharacterized protein LOC105109924    191   7e-57   Populus euphratica
ref|XP_004144863.1|  PREDICTED: uncharacterized protein LOC101212325    190   1e-56   Cucumis sativus [cucumbers]
ref|XP_008447918.1|  PREDICTED: uncharacterized protein LOC103490262    189   2e-56   Cucumis melo [Oriental melon]
gb|KDP36867.1|  hypothetical protein JCGZ_08158                         189   2e-56   Jatropha curcas
ref|XP_010063286.1|  PREDICTED: uncharacterized protein LOC104450433    188   8e-56   
gb|KJB14347.1|  hypothetical protein B456_002G120700                    187   1e-55   Gossypium raimondii
gb|KHG11073.1|  Mitochondrial import protein ZIM17                      187   1e-55   Gossypium arboreum [tree cotton]
gb|AIA63975.1|  transcription factor ZFP130                             187   1e-55   Gossypium hirsutum [American cotton]
ref|XP_002510604.1|  conserved hypothetical protein                     186   4e-55   Ricinus communis
ref|XP_008806155.1|  PREDICTED: uncharacterized protein LOC103718920    185   7e-55   Phoenix dactylifera
ref|XP_008358361.1|  PREDICTED: uncharacterized protein LOC103422104    186   9e-55   
ref|XP_010086843.1|  Mitochondrial protein import protein ZIM17         184   2e-54   Morus notabilis
ref|XP_007200461.1|  hypothetical protein PRUPE_ppa011293mg             184   2e-54   Prunus persica
ref|XP_008236070.1|  PREDICTED: uncharacterized protein LOC103334867    185   5e-54   Prunus mume [ume]
ref|XP_011034950.1|  PREDICTED: uncharacterized protein LOC105132906    183   5e-54   Populus euphratica
ref|XP_002300678.2|  hypothetical protein POPTR_0002s01730g             183   6e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011458699.1|  PREDICTED: uncharacterized protein LOC105349780    181   3e-53   Fragaria vesca subsp. vesca
gb|KHN37381.1|  Hypothetical protein glysoja_013596                     180   1e-52   Glycine soja [wild soybean]
ref|NP_001235094.1|  uncharacterized protein LOC100527113               180   1e-52   Glycine max [soybeans]
ref|XP_006588421.1|  PREDICTED: uncharacterized protein LOC100527...    179   1e-52   Glycine max [soybeans]
ref|XP_010421645.1|  PREDICTED: uncharacterized protein LOC104707...    180   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002874388.1|  hypothetical protein ARALYDRAFT_489599             179   2e-52   
ref|XP_008811782.1|  PREDICTED: uncharacterized protein LOC103722...    178   2e-52   
ref|XP_006588420.1|  PREDICTED: uncharacterized protein LOC100527...    179   2e-52   
ref|XP_006288620.1|  hypothetical protein CARUB_v10001922mg             179   3e-52   Capsella rubella
ref|XP_006605315.1|  PREDICTED: uncharacterized protein LOC100527...    179   3e-52   Glycine max [soybeans]
ref|NP_198080.1|  Zim17-type zinc finger protein                        179   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421646.1|  PREDICTED: uncharacterized protein LOC104707...    179   3e-52   Camelina sativa [gold-of-pleasure]
gb|AAM64347.1|  unknown                                                 178   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935184.1|  PREDICTED: uncharacterized protein LOC105055145    178   4e-52   Elaeis guineensis
ref|NP_001236547.1|  uncharacterized protein LOC100527474               179   4e-52   
ref|XP_006405268.1|  hypothetical protein EUTSA_v10027929mg             178   5e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010494029.1|  PREDICTED: uncharacterized protein LOC104771232    179   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004497201.1|  PREDICTED: uncharacterized protein LOC101505438    179   5e-52   Cicer arietinum [garbanzo]
ref|XP_010941361.1|  PREDICTED: uncharacterized protein LOC105059672    178   6e-52   Elaeis guineensis
ref|XP_008811775.1|  PREDICTED: uncharacterized protein LOC103722...    178   6e-52   Phoenix dactylifera
emb|CDY12988.1|  BnaC02g29950D                                          178   6e-52   Brassica napus [oilseed rape]
gb|KFK32942.1|  hypothetical protein AALP_AA6G309400                    177   7e-52   Arabis alpina [alpine rockcress]
ref|XP_010455141.1|  PREDICTED: uncharacterized protein LOC104736...    178   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008348928.1|  PREDICTED: uncharacterized protein LOC103412108    177   1e-51   
ref|XP_010455142.1|  PREDICTED: uncharacterized protein LOC104736...    177   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009355592.1|  PREDICTED: uncharacterized protein LOC103946591    177   2e-51   Pyrus x bretschneideri [bai li]
gb|AFK34110.1|  unknown                                                 177   4e-51   Lotus japonicus
ref|XP_009391023.1|  PREDICTED: uncharacterized protein LOC103977...    176   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391022.1|  PREDICTED: uncharacterized protein LOC103977...    177   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391021.1|  PREDICTED: uncharacterized protein LOC103977...    177   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK48753.1|  unknown                                                 175   1e-50   Medicago truncatula
ref|XP_007142794.1|  hypothetical protein PHAVU_007G017400g             174   1e-50   Phaseolus vulgaris [French bean]
gb|KEH44399.1|  DNL zinc finger protein                                 175   2e-50   Medicago truncatula
ref|XP_009414426.1|  PREDICTED: uncharacterized protein LOC103995548    173   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418558.1|  PREDICTED: uncharacterized protein LOC103998726    173   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK39869.1|  unknown                                                 174   8e-50   Lotus japonicus
ref|XP_010690316.1|  PREDICTED: uncharacterized protein LOC104903883    173   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001058612.2|  Os06g0724400                                       171   2e-49   
gb|EAZ02398.1|  hypothetical protein OsI_24501                          171   2e-49   Oryza sativa Indica Group [Indian rice]
gb|EAZ38321.1|  hypothetical protein OsJ_22696                          171   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001131303.1|  uncharacterized protein LOC100192616               170   9e-49   Zea mays [maize]
ref|XP_010028773.1|  PREDICTED: uncharacterized protein LOC104418983    170   9e-49   Eucalyptus grandis [rose gum]
ref|XP_003563260.1|  PREDICTED: uncharacterized protein LOC100844750    169   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_008643737.1|  PREDICTED: LOC100283270 isoform X1                 169   1e-48   
ref|XP_002439041.1|  hypothetical protein SORBIDRAFT_10g030440          169   2e-48   Sorghum bicolor [broomcorn]
ref|NP_001149644.1|  LOC100283270                                       166   3e-48   
gb|ABK21254.1|  unknown                                                 169   3e-48   Picea sitchensis
ref|XP_006656504.1|  PREDICTED: uncharacterized protein LOC102700628    168   5e-48   
dbj|BAJ94825.1|  predicted protein                                      169   6e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004966483.1|  PREDICTED: uncharacterized protein LOC101768670    167   1e-47   Setaria italica
ref|XP_006828828.1|  hypothetical protein AMTR_s00001p00142230          165   4e-47   Amborella trichopoda
gb|EMS65438.1|  hypothetical protein TRIUR3_05242                       159   5e-42   Triticum urartu
gb|KJB14348.1|  hypothetical protein B456_002G120700                    139   2e-38   Gossypium raimondii
gb|EMT02176.1|  hypothetical protein F775_14553                         145   4e-37   
ref|XP_002977585.1|  hypothetical protein SELMODRAFT_58719              134   3e-36   
ref|XP_006386156.1|  hypothetical protein POPTR_0002s01730g             135   1e-35   
ref|XP_001760208.1|  predicted protein                                  135   1e-34   
emb|CAO02549.1|  putative zinc finger (DNL type) family protein       81.6    3e-16   Vigna unguiculata
ref|XP_004135125.1|  PREDICTED: uncharacterized protein LOC101206910  81.6    1e-15   Cucumis sativus [cucumbers]
ref|XP_005652036.1|  zf-DNL-domain-containing protein                 82.0    1e-15   Coccomyxa subellipsoidea C-169
ref|NP_001150527.1|  zinc ribbon 1                                    80.5    2e-15   
tpg|DAA58876.1|  TPA: etched1 isoform 1                               78.6    2e-15   
ref|XP_002458121.1|  hypothetical protein SORBIDRAFT_03g027210        80.1    4e-15   Sorghum bicolor [broomcorn]
ref|NP_001105722.1|  etched1                                          79.7    4e-15   
ref|NP_001043517.2|  Os01g0605200                                     79.3    5e-15   
tpg|DAA58878.1|  TPA: etched1                                         79.3    7e-15   
ref|XP_002438978.1|  hypothetical protein SORBIDRAFT_10g029320        79.3    7e-15   
ref|XP_004969096.1|  PREDICTED: DNL-type zinc finger protein-like     79.3    7e-15   Setaria italica
gb|ABK26747.1|  unknown                                               79.0    8e-15   Picea sitchensis
gb|EEC71043.1|  hypothetical protein OsI_02763                        79.0    8e-15   Oryza sativa Indica Group [Indian rice]
gb|KFK41298.1|  hypothetical protein AALP_AA2G112200                  78.6    1e-14   Arabis alpina [alpine rockcress]
ref|XP_002888678.1|  zinc finger family protein                       79.0    1e-14   Arabidopsis lyrata subsp. lyrata
gb|EPS62111.1|  hypothetical protein M569_12682                       76.3    1e-14   Genlisea aurea
ref|NP_001105159.1|  zinc ribbon 1                                    77.8    2e-14   Zea mays [maize]
ref|XP_008446529.1|  PREDICTED: uncharacterized protein C24H6.02c...  77.8    3e-14   Cucumis melo [Oriental melon]
ref|XP_009392908.1|  PREDICTED: uncharacterized protein LOC103978730  77.4    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010470860.1|  PREDICTED: uncharacterized protein LOC104750716  77.4    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010511887.1|  PREDICTED: uncharacterized protein LOC104787...  77.4    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010511888.1|  PREDICTED: uncharacterized protein LOC104787...  77.4    4e-14   
ref|XP_002314899.2|  zinc finger family protein                       77.0    4e-14   
ref|XP_006301666.1|  hypothetical protein CARUB_v10022115mg           77.4    4e-14   
ref|XP_001777870.1|  predicted protein                                77.4    4e-14   
ref|XP_010470865.1|  PREDICTED: uncharacterized protein LOC104750723  77.0    5e-14   Camelina sativa [gold-of-pleasure]
ref|NP_177040.2|  Zim17-type zinc finger protein                      76.6    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644344.1|  PREDICTED: uncharacterized protein C24H6.02c...  76.3    7e-14   
ref|XP_010066771.1|  PREDICTED: uncharacterized protein LOC104453...  75.9    1e-13   Eucalyptus grandis [rose gum]
ref|XP_011008859.1|  PREDICTED: mitochondrial protein import prot...  75.9    1e-13   Populus euphratica
ref|XP_010925233.1|  PREDICTED: uncharacterized protein LOC105047...  75.9    1e-13   Elaeis guineensis
ref|XP_010925248.1|  PREDICTED: uncharacterized protein LOC105047...  75.9    1e-13   Elaeis guineensis
ref|XP_008777543.1|  PREDICTED: uncharacterized protein LOC103697...  75.9    1e-13   Phoenix dactylifera
ref|XP_010925225.1|  PREDICTED: uncharacterized protein LOC105047...  75.9    1e-13   Elaeis guineensis
ref|XP_008777542.1|  PREDICTED: uncharacterized protein LOC103697...  75.9    1e-13   Phoenix dactylifera
ref|XP_010925241.1|  PREDICTED: uncharacterized protein LOC105047...  75.9    1e-13   Elaeis guineensis
ref|XP_010681378.1|  PREDICTED: DNL-type zinc finger protein isof...  75.1    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011070860.1|  PREDICTED: DNL-type zinc finger protein isof...  74.3    2e-13   
ref|XP_003518825.1|  PREDICTED: DNL-type zinc finger protein-like     74.7    2e-13   Glycine max [soybeans]
ref|XP_010262339.1|  PREDICTED: uncharacterized protein LOC104600...  74.7    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_007153312.1|  hypothetical protein PHAVU_003G024500g           74.3    3e-13   Phaseolus vulgaris [French bean]
gb|AFW81000.1|  putative tify domain/CCT motif transcription fact...  75.5    3e-13   
ref|XP_002280593.1|  PREDICTED: mitochondrial protein import prot...  74.3    4e-13   Vitis vinifera
ref|XP_006391103.1|  hypothetical protein EUTSA_v10019239mg           74.3    4e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006348591.1|  PREDICTED: uncharacterized protein C24H6.02c...  74.3    5e-13   Solanum tuberosum [potatoes]
ref|XP_010523289.1|  PREDICTED: DNL-type zinc finger protein          73.9    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_004238981.1|  PREDICTED: uncharacterized protein C24H6.02c     74.3    5e-13   Solanum lycopersicum
ref|XP_009791194.1|  PREDICTED: uncharacterized protein C24H6.02c     73.9    6e-13   Nicotiana sylvestris
gb|KEH29577.1|  DNL zinc finger protein                               73.6    6e-13   Medicago truncatula
gb|KJB50817.1|  hypothetical protein B456_008G188300                  73.6    6e-13   Gossypium raimondii
ref|XP_008360068.1|  PREDICTED: uncharacterized protein LOC103423766  73.9    7e-13   
ref|XP_003569318.1|  PREDICTED: uncharacterized protein C24H6.02c...  73.2    7e-13   Brachypodium distachyon [annual false brome]
ref|XP_009356516.1|  PREDICTED: uncharacterized protein LOC103947335  73.9    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_009614441.1|  PREDICTED: uncharacterized protein C24H6.02c     73.6    9e-13   Nicotiana tomentosiformis
emb|CDM83104.1|  unnamed protein product                              73.2    9e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011070859.1|  PREDICTED: uncharacterized protein LOC105156...  73.6    9e-13   Sesamum indicum [beniseed]
ref|NP_001239683.1|  uncharacterized protein LOC100786955             72.8    1e-12   Glycine max [soybeans]
ref|XP_010425752.1|  PREDICTED: uncharacterized protein LOC104710796  73.2    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_004505313.1|  PREDICTED: mitochondrial protein import prot...  72.8    1e-12   
ref|XP_006437770.1|  hypothetical protein CICLE_v10032948mg           72.8    1e-12   
ref|XP_008339721.1|  PREDICTED: uncharacterized protein LOC103402741  72.8    2e-12   
ref|XP_008246043.1|  PREDICTED: mitochondrial protein import prot...  72.8    2e-12   Prunus mume [ume]
emb|CDP00540.1|  unnamed protein product                              72.8    2e-12   Coffea canephora [robusta coffee]
gb|KHG19418.1|  DNL-type zinc finger                                  72.0    2e-12   Gossypium arboreum [tree cotton]
ref|XP_008361865.1|  PREDICTED: uncharacterized protein LOC103425553  72.8    2e-12   
ref|XP_009355956.1|  PREDICTED: uncharacterized protein LOC103946868  72.8    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_010096705.1|  DNL-type zinc finger protein                     72.4    2e-12   Morus notabilis
dbj|BAJ89579.1|  predicted protein                                    72.0    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010227814.1|  PREDICTED: DNL-type zinc finger protein-like     72.0    2e-12   
gb|EMT29434.1|  hypothetical protein F775_05239                       72.0    2e-12   
ref|XP_005847953.1|  hypothetical protein CHLNCDRAFT_52093            73.6    2e-12   Chlorella variabilis
ref|XP_007046358.1|  Zim17-type zinc finger protein, putative iso...  71.2    3e-12   
ref|XP_006858707.1|  hypothetical protein AMTR_s00066p00105400        72.0    3e-12   Amborella trichopoda
ref|XP_009127663.1|  PREDICTED: uncharacterized protein LOC103852...  71.6    4e-12   Brassica rapa
ref|XP_009127664.1|  PREDICTED: uncharacterized protein LOC103852...  71.2    4e-12   
emb|CDY54500.1|  BnaA02g35640D                                        71.2    5e-12   Brassica napus [oilseed rape]
ref|XP_007223547.1|  hypothetical protein PRUPE_ppa012145mg           71.2    6e-12   Prunus persica
ref|XP_004297161.1|  PREDICTED: uncharacterized protein LOC101312048  70.9    6e-12   Fragaria vesca subsp. vesca
emb|CDX81538.1|  BnaC02g18420D                                        70.9    7e-12   
emb|CDY28109.1|  BnaC06g02900D                                        67.8    1e-11   Brassica napus [oilseed rape]
emb|CDX95993.1|  BnaA07g27380D                                        70.1    1e-11   
emb|CDY38613.1|  BnaC06g30360D                                        69.7    2e-11   Brassica napus [oilseed rape]
gb|EYU17552.1|  hypothetical protein MIMGU_mgv1a023730mg              68.6    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_009105422.1|  PREDICTED: mitochondrial protein import prot...  68.2    5e-11   Brassica rapa
ref|XP_003063279.1|  predicted protein                                67.8    1e-10   Micromonas pusilla CCMP1545
gb|KHJ41186.1|  ribosomal protein S15                                 66.2    8e-10   Trichuris suis
emb|CCK72609.1|  hypothetical protein KNAG_0K02460                    64.3    1e-09   Kazachstania naganishii CBS 8797
gb|EXX72907.1|  Zim17p                                                64.7    1e-09   Rhizophagus irregularis DAOM 197198w
gb|EIF45938.1|  zim17p                                                63.9    2e-09   Brettanomyces bruxellensis AWRI1499
emb|CDX97891.1|  BnaC04g40480D                                        60.8    3e-09   
emb|CEG63113.1|  Putative Zf-DNL-domain-containing protein            63.2    3e-09   Rhizopus microsporus
emb|CEI97298.1|  Putative Zf-DNL-domain-containing protein            63.2    4e-09   Rhizopus microsporus
dbj|BAJ23062.1|  hypothetical protein                                 63.2    4e-09   Pseudocentrotus depressus
emb|CEG80750.1|  hypothetical protein RMATCC62417_15046               62.8    4e-09   Rhizopus microsporus
emb|CEI95525.1|  Putative Piso0_002320 protein                        62.8    4e-09   Rhizopus microsporus
ref|XP_005844772.1|  hypothetical protein CHLNCDRAFT_138626           62.0    5e-09   Chlorella variabilis
dbj|GAN02263.1|  conserved hypothetical protein                       62.4    7e-09   Mucor ambiguus
ref|XP_011397348.1|  Fructose-1-phosphate phosphatase YqaB            63.9    8e-09   Auxenochlorella protothecoides
ref|XP_005083712.1|  PREDICTED: DNL-type zinc finger protein          61.2    1e-08   Mesocricetus auratus [Syrian golden hamster]
gb|EPB86614.1|  hypothetical protein HMPREF1544_06590                 61.2    2e-08   Mucor circinelloides f. circinelloides 1006PhL
emb|CDW52158.1|  Coq4 and Ribosomal S13 N and Ribosomal S15 and z...  63.5    2e-08   Trichuris trichiura
ref|XP_007637235.1|  PREDICTED: LOW QUALITY PROTEIN: DNL-type zin...  60.5    2e-08   
ref|NP_081104.1|  DNL-type zinc finger protein isoform 1              60.8    2e-08   Mus musculus [mouse]
gb|ERE70542.1|  DNL-type zinc finger protein                          61.2    2e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_008191756.1|  PREDICTED: DNL-type zinc finger protein-like     60.5    2e-08   Tribolium castaneum [rust-red flour beetle]
ref|XP_001421744.1|  predicted protein                                60.8    2e-08   Ostreococcus lucimarinus CCE9901
emb|CDY36477.1|  BnaC03g48360D                                        60.1    2e-08   Brassica napus [oilseed rape]
emb|CEP08401.1|  hypothetical protein                                 60.1    5e-08   Parasitella parasitica
ref|XP_006687723.1|  zf-DNL-domain-containing protein                 59.7    5e-08   Yamadazyma tenuis ATCC 10573
ref|XP_002495780.1|  ZYRO0C02882p                                     58.9    6e-08   Zygosaccharomyces rouxii
ref|XP_003083615.1|  ETCHED1 protein (ISS)                            59.7    7e-08   Ostreococcus tauri
emb|CDH58781.1|  hypothetical protein RO3G_11646                      59.7    7e-08   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEP62412.1|  LALA0S05e05072g1_1                                   59.3    7e-08   Lachancea lanzarotensis
emb|CDS07381.1|  hypothetical protein LRAMOSA01330                    59.3    8e-08   Lichtheimia ramosa
ref|XP_520365.2|  PREDICTED: DNL-type zinc finger protein             59.3    8e-08   Pan troglodytes
ref|XP_002555014.1|  KLTH0F19052p                                     59.3    9e-08   Lachancea thermotolerans CBS 6340
gb|AGO11609.1|  AaceriADL173Cp                                        59.3    9e-08   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_005408560.1|  PREDICTED: DNL-type zinc finger protein-like     58.9    9e-08   
gb|EIE86935.1|  hypothetical protein RO3G_11646                       59.3    9e-08   Rhizopus delemar RA 99-880
ref|XP_004199776.1|  Piso0_002320                                     59.3    9e-08   
ref|XP_004198925.1|  Piso0_002320                                     59.3    9e-08   
ref|XP_003510907.1|  PREDICTED: DNL-type zinc finger protein isof...  58.9    1e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_003688733.1|  hypothetical protein TPHA_0P01410                58.9    1e-07   Tetrapisispora phaffii CBS 4417
ref|XP_002614239.1|  hypothetical protein CLUG_05725                  58.5    1e-07   Clavispora lusitaniae ATCC 42720
ref|XP_003725494.1|  PREDICTED: DNL-type zinc finger protein-like     58.9    1e-07   Strongylocentrotus purpuratus [purple urchin]
ref|NP_983923.1|  ADL173Cp                                            58.9    1e-07   Eremothecium gossypii ATCC 10895
gb|EGW12770.1|  DNL-type zinc finger protein                          58.5    1e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_002493869.1|  Heat shock protein with a zinc finger motif      58.5    1e-07   Komagataella phaffii GS115
ref|XP_003644612.1|  hypothetical protein Ecym_2037                   58.9    1e-07   Eremothecium cymbalariae DBVPG#7215
ref|XP_008482374.1|  PREDICTED: DNL-type zinc finger protein-like     58.9    1e-07   
ref|NP_001074318.1|  DNL-type zinc finger protein                     58.5    1e-07   Homo sapiens [man]
pdb|2E2Z|A  Chain A, Solution Nmr Structure Of Yeast Tim15, Co-Ch...  57.0    1e-07   Saccharomyces cerevisiae [brewer's yeast]
emb|CBK20169.2|  Zim17                                                57.8    2e-07   Blastocystis hominis
emb|CDH12975.1|  related to Mitochondrial protein import protein ...  58.2    2e-07   Zygosaccharomyces bailii ISA1307
ref|XP_004207823.1|  PREDICTED: DNL-type zinc finger protein-like     58.5    2e-07   
gb|ABK24010.1|  unknown                                               58.9    2e-07   Picea sitchensis
ref|NP_001124462.1|  DNL-type zinc finger protein                     58.2    2e-07   Rattus norvegicus [brown rat]
ref|XP_315385.4|  AGAP005377-PA                                       57.4    2e-07   Anopheles gambiae str. PEST
ref|XP_002010480.1|  GI14660                                          58.2    2e-07   Drosophila mojavensis
gb|ETN66741.1|  hypothetical protein AND_001480                       57.4    2e-07   Anopheles darlingi [American malaria mosquito]
gb|AJT21325.1|  Zim17p                                                58.2    2e-07   Saccharomyces cerevisiae YJM1341
gb|EEH05800.1|  DNL zinc finger domain-containing protein             58.5    2e-07   Histoplasma capsulatum G186AR
ref|XP_001992524.1|  GH24157                                          58.2    2e-07   Drosophila grimshawi
ref|XP_002626197.1|  DNL zinc finger domain-containing protein        58.9    2e-07   Blastomyces gilchristii SLH14081
ref|XP_461045.2|  DEHA2F15774p                                        58.2    2e-07   Debaryomyces hansenii CBS767
gb|EEQ92563.1|  DNL zinc finger domain-containing protein             58.9    2e-07   Blastomyces dermatitidis ER-3
ref|XP_002908206.1|  conserved hypothetical protein                   57.8    2e-07   Phytophthora infestans T30-4
ref|XP_008890456.1|  hypothetical protein PPTG_00743                  58.2    2e-07   Phytophthora parasitica INRA-310
gb|AJT03343.1|  Zim17p                                                57.8    2e-07   Saccharomyces cerevisiae YJM270
gb|AJT02226.1|  Zim17p                                                57.8    2e-07   Saccharomyces cerevisiae YJM195
gb|AJT30888.1|  Zim17p                                                57.8    2e-07   Saccharomyces cerevisiae YJM1463
gb|AJT21703.1|  Zim17p                                                57.8    2e-07   Saccharomyces cerevisiae YJM1342
ref|NP_014089.2|  Zim17p                                              57.8    2e-07   Saccharomyces cerevisiae S288C
emb|CDF87706.1|  BN860_12596g1_1                                      57.8    3e-07   Zygosaccharomyces bailii CLIB 213
gb|AJT25380.1|  Zim17p                                                57.8    3e-07   Saccharomyces cerevisiae YJM1399
gb|AJT18360.1|  Zim17p                                                57.8    3e-07   Saccharomyces cerevisiae YJM1273
ref|XP_001691699.1|  Hsp70 escorting protein 2                        58.2    3e-07   Chlamydomonas reinhardtii
gb|AJT26115.1|  Zim17p                                                57.8    3e-07   Saccharomyces cerevisiae YJM1401
ref|XP_010736167.1|  PREDICTED: DNL-type zinc finger protein          57.8    3e-07   
gb|AJT05212.1|  Zim17p                                                57.8    3e-07   Saccharomyces cerevisiae YJM450
gb|EJT44486.1|  ZIM17-like protein                                    57.8    3e-07   Saccharomyces kudriavzevii IFO 1802
emb|CDK25150.1|  unnamed protein product                              58.5    3e-07   Kuraishia capsulata CBS 1993
gb|EGA73237.1|  Zim17p                                                56.2    3e-07   Saccharomyces cerevisiae AWRI796
emb|CCC46977.1|  conserved hypothetical protein                       57.8    3e-07   Trypanosoma vivax Y486
ref|XP_004346924.1|  hypothetical protein CAOG_05239                  58.5    3e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_001483464.1|  hypothetical protein PGUG_04193                  57.4    3e-07   Meyerozyma guilliermondii ATCC 6260
ref|XP_002059602.1|  GJ14731                                          57.4    4e-07   Drosophila virilis
gb|EHN00667.1|  Zim17p                                                56.2    4e-07   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_001354904.1|  GA20897                                          57.4    4e-07   Drosophila pseudoobscura pseudoobscura
gb|KGK37232.1|  hypothetical protein JL09_g3628                       57.8    4e-07   Pichia kudriavzevii
ref|XP_010607176.1|  PREDICTED: DNL-type zinc finger protein          57.4    4e-07   Fukomys damarensis [Damara mole rat]
ref|XP_002024413.1|  GL15020                                          57.4    4e-07   Drosophila persimilis
ref|XP_001385314.1|  hypothetical protein PICST_59964                 56.2    4e-07   Scheffersomyces stipitis CBS 6054
ref|XP_004640585.1|  PREDICTED: DNL-type zinc finger protein          57.0    5e-07   Octodon degus
emb|CAA86385.1|  NO381                                                57.4    5e-07   Saccharomyces cerevisiae [brewer's yeast]
gb|EGA81223.1|  Zim17p                                                57.4    5e-07   Saccharomyces cerevisiae Lalvin QA23
emb|CAY82303.1|  Zim17p                                               57.4    5e-07   Saccharomyces cerevisiae EC1118
ref|XP_003473033.1|  PREDICTED: DNL-type zinc finger protein isof...  57.0    5e-07   Cavia porcellus [guinea pig]
ref|XP_004593704.1|  PREDICTED: DNL-type zinc finger protein          56.2    6e-07   Ochotona princeps [southern American pika]
dbj|GAA84039.1|  mitochondrial import protein Zim17                   57.0    6e-07   Aspergillus kawachii IFO 4308
ref|XP_008840170.1|  PREDICTED: DNL-type zinc finger protein isof...  57.4    6e-07   
ref|XP_454278.1|  hypothetical protein                                57.0    6e-07   Kluyveromyces lactis
ref|XP_001394190.1|  DNL zinc finger domain protein                   57.0    7e-07   Aspergillus niger CBS 513.88
ref|XP_003673948.1|  hypothetical protein NCAS_0A10090                57.0    7e-07   Naumovozyma castellii CBS 4309
ref|XP_003911135.1|  PREDICTED: DNL-type zinc finger protein          56.6    7e-07   Papio anubis [baboon]
ref|NP_001181664.1|  DNL-type zinc finger protein                     56.6    8e-07   Macaca mulatta [rhesus macaque]
ref|XP_449518.1|  hypothetical protein                                56.6    8e-07   [Candida] glabrata
ref|XP_008003840.1|  PREDICTED: DNL-type zinc finger protein isof...  56.2    8e-07   Chlorocebus sabaeus
gb|ETE59988.1|  DNL-type zinc finger protein                          55.5    9e-07   Ophiophagus hannah
ref|XP_010371036.1|  PREDICTED: DNL-type zinc finger protein          56.2    9e-07   Rhinopithecus roxellana
gb|EER41665.1|  DNL zinc finger protein                               57.0    9e-07   Histoplasma capsulatum H143
gb|AFW71389.1|  hypothetical protein ZEAMMB73_297185                  58.2    1e-06   
ref|XP_003941416.1|  PREDICTED: DNL-type zinc finger protein          56.2    1e-06   
ref|XP_003965336.1|  PREDICTED: DNL-type zinc finger protein-like     55.5    1e-06   
gb|EGC49531.1|  DNL zinc finger domain-containing protein             57.0    1e-06   
ref|XP_011122970.1|  hypothetical protein AOL_s00080g293              56.6    1e-06   
gb|AAO64784.1|  At3g54830                                             56.2    1e-06   
gb|AJT25018.1|  Zim17p                                                56.2    1e-06   
ref|XP_001642186.1|  hypothetical protein Kpol_167p1                  56.2    1e-06   
dbj|BAE99394.1|  hypothetical protein                                 56.6    1e-06   
gb|AJT23159.1|  Zim17p                                                55.8    1e-06   
ref|XP_009523416.1|  hypothetical protein PHYSODRAFT_259700           56.2    1e-06   
ref|XP_007521583.1|  PREDICTED: DNL-type zinc finger protein          55.8    1e-06   
ref|XP_003668024.1|  hypothetical protein NDAI_0A06270                56.2    1e-06   
ref|XP_006863874.1|  PREDICTED: DNL-type zinc finger protein          55.8    2e-06   
ref|XP_008003839.1|  PREDICTED: DNL-type zinc finger protein isof...  55.8    2e-06   
ref|NP_974434.2|  protein ZINC RIBBON 3                               56.6    2e-06   
ref|XP_002175448.1|  TIM23 translocase complex subunit Tim15          55.5    2e-06   
ref|XP_008840169.1|  PREDICTED: DNL-type zinc finger protein isof...  57.0    2e-06   
ref|XP_002107042.1|  GD17233                                          55.8    2e-06   
ref|XP_002071136.1|  GK25634                                          55.8    2e-06   
ref|XP_002100710.1|  GE17213                                          55.8    2e-06   
ref|NP_573064.1|  CG8206, isoform A                                   55.8    2e-06   
ref|XP_001978045.1|  GG17905                                          55.8    2e-06   
dbj|BAO40425.1|  DNL zinc finger domain-containing protein            55.8    2e-06   
ref|XP_006062284.1|  PREDICTED: DNL-type zinc finger protein-like     55.1    2e-06   
ref|XP_011109584.1|  hypothetical protein H072_3614                   57.0    2e-06   
ref|XP_007945125.1|  PREDICTED: DNL-type zinc finger protein          55.5    2e-06   
ref|XP_004799780.1|  PREDICTED: DNL-type zinc finger protein          55.1    2e-06   
emb|CDO94518.1|  unnamed protein product                              57.4    2e-06   
ref|XP_006674935.1|  hypothetical protein BATDEDRAFT_7290             53.1    2e-06   
ref|XP_849286.1|  PREDICTED: DNL-type zinc finger protein             55.1    3e-06   
ref|XP_003582892.1|  PREDICTED: DNL-type zinc finger protein          55.1    3e-06   
ref|XP_002594862.1|  hypothetical protein BRAFLDRAFT_86030            55.1    3e-06   
gb|EFX88143.1|  hypothetical protein DAPPUDRAFT_221352                54.7    3e-06   
ref|XP_002057102.1|  GJ16534                                          54.7    3e-06   
ref|XP_003795003.1|  PREDICTED: DNL-type zinc finger protein          55.1    3e-06   
ref|XP_006918169.1|  PREDICTED: DNL-type zinc finger protein          54.7    3e-06   
ref|XP_007901068.1|  PREDICTED: DNL-type zinc finger protein isof...  55.1    3e-06   
ref|XP_004285091.1|  PREDICTED: DNL-type zinc finger protein          54.7    3e-06   
ref|XP_011368287.1|  PREDICTED: DNL-type zinc finger protein          53.9    3e-06   
ref|XP_002797301.1|  DNL zinc finger domain-containing protein        55.5    3e-06   
ref|XP_004459655.1|  PREDICTED: DNL-type zinc finger protein          54.7    3e-06   
ref|XP_002311410.2|  hypothetical protein POPTR_0008s11030g           53.9    3e-06   
gb|EEH19415.1|  hypothetical protein PABG_01734                       55.5    3e-06   
gb|EFB22703.1|  hypothetical protein PANDA_014080                     53.9    4e-06   
ref|XP_009862369.1|  PREDICTED: DNL-type zinc finger protein-like     54.7    4e-06   
ref|XP_011229908.1|  PREDICTED: DNL-type zinc finger protein          53.9    4e-06   
ref|XP_004714568.1|  PREDICTED: caspase recruitment domain-contai...  56.6    4e-06   
ref|XP_004613455.1|  PREDICTED: DNL-type zinc finger protein          54.3    4e-06   
ref|XP_001992035.1|  GH24435                                          54.3    4e-06   
ref|XP_004410770.1|  PREDICTED: DNL-type zinc finger protein          54.3    4e-06   
ref|XP_010759549.1|  hypothetical protein PADG_03669                  55.5    4e-06   
dbj|BAP71913.1|  DNL zinc finger domain-containing protein            54.7    4e-06   
ref|XP_009003700.1|  PREDICTED: DNL-type zinc finger protein          54.7    4e-06   
gb|EHB04827.1|  DNL-type zinc finger protein                          54.3    4e-06   
ref|XP_007901069.1|  PREDICTED: DNL-type zinc finger protein isof...  54.3    4e-06   
ref|XP_006981043.1|  PREDICTED: DNL-type zinc finger protein isof...  54.3    4e-06   
gb|EDL08302.1|  mCG128376                                             56.2    4e-06   
ref|XP_005336996.1|  PREDICTED: DNL-type zinc finger protein          54.3    5e-06   
ref|XP_006403530.1|  hypothetical protein EUTSA_v10010741mg           54.7    5e-06   
ref|XP_004178081.1|  hypothetical protein TBLA_0A07730                54.7    5e-06   
gb|KFM78808.1|  DNL-type zinc finger protein                          53.9    6e-06   
ref|XP_003230644.1|  PREDICTED: DNL-type zinc finger protein          53.5    6e-06   
ref|XP_009308557.1|  zf-DNL-domain-containing protein                 54.3    6e-06   
ref|XP_001966034.1|  GF19477                                          54.3    6e-06   
ref|XP_008495513.1|  PREDICTED: DNL-type zinc finger protein          53.1    6e-06   
ref|XP_820850.1|  hypothetical protein                                54.3    7e-06   
ref|XP_010954228.1|  PREDICTED: DNL-type zinc finger protein          53.9    7e-06   
ref|XP_004388748.1|  PREDICTED: DNL-type zinc finger protein          53.9    7e-06   
gb|EYE95089.1|  DNL zinc finger domain protein                        53.9    8e-06   
gb|EYU22609.1|  hypothetical protein MIMGU_mgv1a026408mg              52.4    8e-06   
ref|XP_001978049.1|  GG19380                                          52.8    8e-06   
tpg|DAA51711.1|  TPA: hypothetical protein ZEAMMB73_994626            55.5    8e-06   
ref|XP_008150888.1|  PREDICTED: DNL-type zinc finger protein          53.5    8e-06   
ref|XP_003955415.1|  hypothetical protein KAFR_0A08460                53.5    9e-06   
ref|XP_005189472.1|  PREDICTED: DNL-type zinc finger protein          53.5    9e-06   
ref|XP_001267979.1|  DNL zinc finger domain protein                   53.9    1e-05   
ref|XP_005107608.1|  PREDICTED: DNL-type zinc finger protein-like     53.5    1e-05   
ref|XP_010112217.1|  DNL-type zinc finger protein                     53.9    1e-05   
ref|XP_001652366.1|  AAEL006952-PA                                    52.8    1e-05   
ref|XP_006218420.1|  PREDICTED: DNL-type zinc finger protein-like     54.3    1e-05   
ref|XP_002820433.1|  PREDICTED: DNL-type zinc finger protein          53.5    1e-05   
gb|ACN37055.1|  unknown                                               53.5    1e-05   
ref|NP_001150499.1|  LOC100284130                                     53.5    1e-05   
ref|XP_001235328.1|  PREDICTED: DNL-type zinc finger protein          52.8    1e-05   
ref|XP_843824.1|  hypothetical protein                                53.5    1e-05   
emb|CBH09890.1|  hypothetical protein, conserved                      53.5    1e-05   
gb|KIY70132.1|  zf-DNL-domain-containing protein                      53.5    1e-05   
ref|XP_008324040.1|  PREDICTED: DNL-type zinc finger protein          53.5    1e-05   
gb|EIT72832.1|  DNL zinc finger domain protein                        53.5    1e-05   
ref|XP_001819335.1|  DNL zinc finger domain protein                   53.5    1e-05   
ref|XP_006675484.1|  hypothetical protein BATDEDRAFT_22160            54.3    1e-05   
ref|XP_006163455.1|  PREDICTED: DNL-type zinc finger protein-like     52.0    1e-05   
ref|XP_002541557.1|  predicted protein                                53.1    1e-05   
ref|XP_005760580.1|  DNL zinc finger protein                          54.3    1e-05   
ref|XP_004307372.1|  PREDICTED: uncharacterized protein LOC101291376  53.9    2e-05   
ref|XP_002100706.1|  GE16027                                          53.1    2e-05   
ref|XP_002044172.1|  GM22535                                          52.0    2e-05   
gb|KFH66652.1|  hypothetical protein MVEG_07177                       53.9    2e-05   
ref|XP_010569399.1|  PREDICTED: DNL-type zinc finger protein          52.0    2e-05   
ref|XP_010681379.1|  PREDICTED: uncharacterized protein LOC104896...  52.0    2e-05   
ref|XP_007095644.1|  PREDICTED: uncharacterized protein LOC102959539  54.3    2e-05   
ref|XP_002107038.1|  GD15783                                          52.0    2e-05   
ref|XP_011442194.1|  PREDICTED: DNL-type zinc finger protein-like     52.8    2e-05   
gb|EFW21924.1|  TIM23 translocase complex subunit Tim15               53.1    2e-05   
ref|XP_003066019.1|  DNL zinc finger family protein                   53.1    2e-05   
ref|XP_009278935.1|  PREDICTED: DNL-type zinc finger protein          51.6    2e-05   
ref|XP_001247362.1|  hypothetical protein CIMG_01133                  53.1    2e-05   
ref|XP_750712.1|  mitochondrial import protein Zim17                  53.1    2e-05   
ref|XP_002064300.1|  GK20094                                          51.2    2e-05   
ref|XP_006824976.1|  PREDICTED: DNL-type zinc finger protein-like     52.8    2e-05   
ref|XP_009475380.1|  PREDICTED: DNL-type zinc finger protein          51.6    2e-05   
gb|KFM08448.1|  DNL-type zinc finger protein                          51.6    2e-05   
ref|XP_001257939.1|  DNL zinc finger domain protein                   53.1    2e-05   
ref|NP_001090392.1|  DNL-type zinc finger protein                     52.8    2e-05   
ref|XP_005825125.1|  hypothetical protein GUITHDRAFT_77430            50.4    2e-05   
ref|XP_008539605.1|  PREDICTED: caspase recruitment domain-contai...  54.3    2e-05   
ref|XP_009173620.1|  hypothetical protein T265_09323                  53.9    2e-05   
ref|XP_005055719.1|  PREDICTED: DNL-type zinc finger protein          51.2    2e-05   
gb|EKG17804.1|  Signal recognition particle SRP14 subunit             51.2    3e-05   
gb|EKC36353.1|  DNL-type zinc finger protein                          50.8    3e-05   
tpg|DAA34189.1|  TPA: hypothetical secreted protein 1840              52.0    3e-05   
emb|CCE41063.1|  hypothetical protein CPAR2_300520                    52.4    3e-05   
ref|NP_573061.2|  CG12379                                             52.4    3e-05   
emb|CEL61778.1|  DNL-type zinc finger protein OS=Mus musculus GN=...  52.0    3e-05   
emb|CCW63414.1|  unnamed protein product                              52.8    3e-05   
gb|AAS15675.1|  LP13032p                                              52.4    3e-05   
ref|XP_009020084.1|  hypothetical protein HELRODRAFT_128195           50.4    3e-05   
ref|XP_001609028.1|  DNL zinc finger domain containing protein        51.6    3e-05   
ref|XP_002011097.1|  GI16194                                          50.8    3e-05   
ref|XP_007508671.1|  predicted protein                                52.4    3e-05   
gb|KGO65606.1|  Zinc finger, DNL-type                                 52.4    3e-05   
dbj|GAM35847.1|  mitochondrial import protein                         52.4    3e-05   
ref|XP_002454792.1|  hypothetical protein SORBIDRAFT_04g037475        53.1    3e-05   
gb|AAI23014.1|  LOC779561 protein                                     52.0    3e-05   
ref|XP_006292193.1|  hypothetical protein CARUB_v10018399mg           52.4    4e-05   
ref|XP_002146741.1|  mitochondrial import protein Zim17, putative     52.4    4e-05   
ref|XP_002022881.1|  GL16522                                          52.0    4e-05   
gb|EJK52589.1|  hypothetical protein THAOC_28119                      52.8    4e-05   
gb|KFP83013.1|  DNL-type zinc finger protein                          50.8    4e-05   
ref|XP_010203637.1|  PREDICTED: DNL-type zinc finger protein          50.8    4e-05   
ref|XP_010765447.1|  PREDICTED: DNL-type zinc finger protein          52.0    4e-05   
ref|XP_003426587.1|  PREDICTED: DNL-type zinc finger protein-like     52.4    4e-05   
ref|XP_005299581.1|  PREDICTED: DNL-type zinc finger protein          51.6    4e-05   
gb|KFP33127.1|  DNL-type zinc finger protein                          50.8    4e-05   
ref|XP_002935266.1|  PREDICTED: DNL-type zinc finger protein          52.0    4e-05   
ref|XP_001966562.1|  GF22240                                          51.6    4e-05   
ref|XP_004921710.1|  PREDICTED: mitochondrial protein import prot...  51.2    5e-05   
gb|EPX74981.1|  TIM23 translocase complex subunit Tim15               51.6    5e-05   
ref|XP_006827446.1|  hypothetical protein AMTR_s00009p00104670        52.0    5e-05   
gb|EYU39859.1|  hypothetical protein MIMGU_mgv1a014657mg              51.6    5e-05   
ref|XP_001636345.1|  predicted protein                                50.1    5e-05   
ref|XP_003678598.1|  hypothetical protein TDEL_0A00550                51.6    5e-05   
gb|ENN77479.1|  hypothetical protein YQE_06007                        50.8    5e-05   
gb|EJK62092.1|  hypothetical protein THAOC_17311                      52.4    5e-05   
ref|XP_009979529.1|  PREDICTED: DNL-type zinc finger protein          50.1    5e-05   
gb|EPY24030.1|  hypothetical protein AGDE_12563                       52.0    6e-05   
gb|KDN36909.1|  hypothetical protein RSAG8_10528                      51.6    6e-05   
ref|XP_003871301.1|  Zim17 protein                                    51.2    6e-05   
ref|XP_008446530.1|  PREDICTED: uncharacterized protein LOC103489...  51.2    6e-05   
ref|XP_008446528.1|  PREDICTED: uncharacterized protein LOC103489...  51.2    6e-05   
gb|EUC59744.1|  DNL zinc finger protein                               51.2    7e-05   
ref|XP_007127321.1|  PREDICTED: DNL-type zinc finger protein          51.2    7e-05   
ref|XP_010262345.1|  PREDICTED: uncharacterized protein LOC104600...  50.4    7e-05   
ref|XP_002431123.1|  conserved hypothetical protein                   50.8    7e-05   
ref|XP_006900698.1|  PREDICTED: DNL-type zinc finger protein          52.4    7e-05   
emb|CAF97135.1|  unnamed protein product                              49.7    7e-05   
ref|XP_004536771.1|  PREDICTED: DNL-type zinc finger protein-like     50.4    7e-05   
emb|CDI50951.1|  related to ZIM17-Zinc finger Motif protein, mito...  51.6    8e-05   
ref|XP_011166011.1|  PREDICTED: DNL-type zinc finger protein-like     50.8    8e-05   
gb|KIY98188.1|  Hsp70 escorting protein 2                             51.6    8e-05   
ref|XP_005987447.1|  PREDICTED: uncharacterized protein LOC102356071  52.0    8e-05   
emb|CCW70893.1|  unnamed protein product                              51.6    8e-05   
gb|EMT16528.1|  hypothetical protein F775_30154                       51.2    8e-05   
ref|XP_003757539.1|  PREDICTED: DNL-type zinc finger protein          51.2    8e-05   
ref|XP_006955786.1|  zf-DNL-domain-containing protein                 50.4    8e-05   
gb|EMG47278.1|  hypothetical protein G210_2410                        50.8    8e-05   
gb|EAY88046.1|  hypothetical protein OsI_09474                        51.2    8e-05   
emb|CDY07518.1|  BnaC06g15460D                                        51.2    8e-05   
dbj|GAD93662.1|  mitochondrial import protein Zim17                   51.2    8e-05   
dbj|GAC73252.1|  uncharacterized conserved protein                    51.2    9e-05   
gb|EMS46743.1|  hypothetical protein TRIUR3_16284                     51.2    9e-05   
ref|NP_001048537.1|  Os02g0819700                                     51.2    9e-05   
ref|XP_007875933.1|  hypothetical protein PFL1_00245                  50.8    9e-05   
emb|CDM36204.1|  Zinc finger, DNL-type                                51.2    9e-05   
ref|XP_001863982.1|  conserved hypothetical protein                   50.4    9e-05   
ref|XP_006796841.1|  PREDICTED: DNL-type zinc finger protein-like     51.2    1e-04   
gb|KIK18148.1|  hypothetical protein PISMIDRAFT_109939                50.4    1e-04   
ref|XP_007256624.1|  PREDICTED: DNL-type zinc finger protein-like     50.8    1e-04   
ref|XP_005529316.1|  PREDICTED: DNL-type zinc finger protein-like     51.2    1e-04   
gb|EWM23067.1|  zinc finger protein                                   51.6    1e-04   
ref|XP_009116160.1|  PREDICTED: uncharacterized protein LOC103841...  50.8    1e-04   
ref|XP_001215012.1|  predicted protein                                51.2    1e-04   
ref|XP_002421339.1|  heat shock protein, mitochondrial protein im...  50.8    1e-04   
gb|KIO03392.1|  hypothetical protein M404DRAFT_1001310                50.4    1e-04   
ref|XP_009116161.1|  PREDICTED: uncharacterized protein LOC103841...  50.8    1e-04   
ref|XP_009075802.1|  PREDICTED: DNL-type zinc finger protein          51.2    1e-04   
ref|XP_005720307.1|  PREDICTED: DNL-type zinc finger protein-like     50.8    1e-04   
ref|XP_005792601.1|  DNL zinc finger protein                          50.8    1e-04   
ref|NP_001074117.1|  DNL-type zinc finger protein                     50.8    1e-04   
ref|XP_004549840.1|  PREDICTED: DNL-type zinc finger protein-like     50.8    1e-04   
ref|XP_009790582.1|  PREDICTED: uncharacterized protein LOC104238023  50.8    1e-04   
ref|XP_009103937.1|  PREDICTED: uncharacterized protein LOC103829...  50.8    1e-04   
ref|XP_009103936.1|  PREDICTED: uncharacterized protein LOC103829...  50.8    1e-04   
emb|CDX78266.1|  BnaA09g34610D                                        51.2    1e-04   
gb|KJB50818.1|  hypothetical protein B456_008G188300                  49.7    1e-04   
ref|XP_010925256.1|  PREDICTED: uncharacterized protein LOC105047...  49.7    1e-04   
gb|EKV04099.1|  Mitochondrial import protein Zim17, putative          50.8    1e-04   
gb|EEQ46935.1|  conserved hypothetical protein                        50.4    1e-04   
ref|XP_006485642.1|  PREDICTED: DNL-type zinc finger protein-like     50.4    1e-04   
ref|XP_712488.1|  potential mitochondrial zinc finger protein Fmp28   50.4    1e-04   
gb|KHC45981.1|  hypothetical protein MEW_05039                        50.4    1e-04   
gb|KGQ86723.1|  hypothetical protein MG1_05095                        50.4    1e-04   
gb|KGU23610.1|  hypothetical protein MGK_05083                        50.4    1e-04   
gb|KGU20502.1|  hypothetical protein MG7_05086                        50.4    1e-04   
gb|KGO43691.1|  Zinc finger, DNL-type                                 50.8    1e-04   
ref|XP_008546021.1|  PREDICTED: DNL-type zinc finger protein-like     50.1    2e-04   
emb|CCD13482.1|  unnamed protein product                              50.4    2e-04   
ref|XP_009620945.1|  PREDICTED: uncharacterized protein LOC104112666  50.8    2e-04   
ref|XP_003745047.1|  PREDICTED: DNL-type zinc finger protein-like     49.3    2e-04   
ref|XP_009350751.1|  PREDICTED: uncharacterized protein C24H6.02c...  49.7    2e-04   



>ref|XP_011083416.1| PREDICTED: uncharacterized protein LOC105165954 [Sesamum indicum]
Length=212

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGPSVPAGS+ ++GMEQ+STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  79   LSAANVRGWTTGSGMEGPSVPAGSDSDSGMEQVSTFPWSLFTKSPRRRMRVAFTCNVCGQ  138

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  139  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  180


 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 67/114 (59%), Gaps = 22/114 (19%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRL-SSKRILRFSASPRGNGNE-----PDLRSNSN  286
            MEAL ++TT A+   SLPIFSP+KS    SS+RILRFS SPR + N       DL+S+S+
Sbjct  1    MEAL-TTTTGAV---SLPIFSPMKSKDASSSRRILRFSTSPRNDHNSNNDSGNDLKSDSS  56

Query  287  DSSLVPI-----LSQDAAMGLVERGERSRMDYRVGDGRAIGSGGFEPGNRNGAD  433
            DS+LVP+     LS+DAAMGLV      R       G   GSG   P    G+D
Sbjct  57   DSALVPVLRHQTLSKDAAMGLVLSAANVR-------GWTTGSGMEGPSVPAGSD  103



>gb|EYU36814.1| hypothetical protein MIMGU_mgv1a013669mg [Erythranthe guttata]
Length=213

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGPS+PAGS+P +GM+++STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  79   LSAANVRGWTTGSGMEGPSMPAGSDPNSGMDRVSTFPWSLFTKSPRRRMRVAFTCNVCGQ  138

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  139  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  180


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 66/114 (58%), Gaps = 22/114 (19%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGN------EPDLRSNSN  286
            MEAL ++TT A+   SLPIFSP KS   SS+R+LRFS SP+ + N      EPD + +S+
Sbjct  1    MEAL-TTTTGAV---SLPIFSPNKSREPSSRRLLRFSTSPKNDANRSNSGGEPDFKPDSS  56

Query  287  DSSLVPI-----LSQDAAMGLVERGERSRMDYRVGDGRAIGSGGFEPGNRNGAD  433
            +SSLVPI     +SQDAAMGLV      R       G   GSG   P    G+D
Sbjct  57   ESSLVPINRNRFISQDAAMGLVLSAANVR-------GWTTGSGMEGPSMPAGSD  103



>ref|XP_011074724.1| PREDICTED: DNL-type zinc finger protein-like [Sesamum indicum]
Length=213

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGPS+PAGS+P+ G E++STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  80   LSAANVRGWTTGSGMEGPSMPAGSDPDPGTERVSTFPWSLFTKSPRRRMRVAFTCNVCGQ  139

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  140  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  181


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 21/114 (18%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGN------EPDLRSNSN  286
            MEAL +++  A+   SLP+FS  KS   SS+  LR S SP+ + +      EPD++ +S+
Sbjct  1    MEALTATSAGAV---SLPMFSANKSRGPSSRPRLRCSPSPKNDSDNINTNSEPDIKPDSS  57

Query  287  DSSLVPI-----LSQDAAMGLVERGERSRMDYRVGDGRAIGSGGFEPGNRNGAD  433
             S L P+     LS+DAAMGLV      R       G   GSG   P    G+D
Sbjct  58   HSRLAPVLRNRTLSKDAAMGLVLSAANVR-------GWTTGSGMEGPSMPAGSD  104



>ref|NP_001274971.1| uncharacterized protein LOC102584137 [Solanum tuberosum]
 gb|AFX67003.1| hypothetical protein [Solanum tuberosum]
Length=206

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGP VPAGS+ E+  EQISTFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  74   LSAANVRGWTTGSGMEGPPVPAGSDSESSTEQISTFPWSLFTKSPRRRMRVAFTCNVCGQ  133

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  134  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  175


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 61/98 (62%), Gaps = 17/98 (17%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSND-SSLV  301
            ME L SS TT   +PSL +F+P KS  LSS++ ++FS S + NGNEPDL+S+ N+ +S+V
Sbjct  1    METLTSSATT---TPSLSVFAP-KSKHLSSRKFVKFSVSRKNNGNEPDLQSDGNEGTSIV  56

Query  302  PI-----LSQDAAMGLVERGERSRMDYRVGDGRAIGSG  400
            PI     LS+DAAMGLV      R       G   GSG
Sbjct  57   PIFNNPTLSKDAAMGLVLSAANVR-------GWTTGSG  87



>ref|NP_001266237.1| Hop-interacting protein THI120 [Solanum lycopersicum]
 gb|AEW69817.1| Hop-interacting protein THI120 [Solanum lycopersicum]
Length=206

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGP VPAGS+ E+  +QISTFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  74   LSAANVRGWTTGSGMEGPPVPAGSDSESNTDQISTFPWSLFTKSPRRRMRVAFTCNVCGQ  133

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  134  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  175


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 62/98 (63%), Gaps = 17/98 (17%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSND-SSLV  301
            ME L SS TT   +PSL +F+P KS  LSS++I++FS S + NGNE DL+S++ND +S+V
Sbjct  1    METLTSSATT---TPSLSVFAP-KSKHLSSRKIVKFSVSRKNNGNESDLQSDANDNTSIV  56

Query  302  PI-----LSQDAAMGLVERGERSRMDYRVGDGRAIGSG  400
            PI     LS+DAAMGLV      R       G   GSG
Sbjct  57   PIFNNPTLSKDAAMGLVLSAANVR-------GWTTGSG  87



>emb|CDP07337.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 98/104 (94%), Gaps = 2/104 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAG--SNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVC  509
            LSAANVRGWTTGSGMEGPSVPAG  S+ E+G E+ISTFPWSLFTKSPRRRM VAFTC VC
Sbjct  94   LSAANVRGWTTGSGMEGPSVPAGAGSDSESGTERISTFPWSLFTKSPRRRMRVAFTCSVC  153

Query  510  GQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            GQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFHDMKCY
Sbjct  154  GQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHDMKCY  197


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 14/69 (20%)
 Frame = +2

Query  215  KRILRFSASPRGNGNEPDLRSNSNDS--SLVPI-----LSQDAAMGLVERGERSRMDYRV  373
            +R+LRFS SP+ NGN+ D++S+SNDS  SLVP+     LS+DAAMGLV      R     
Sbjct  46   RRLLRFSTSPKNNGNQRDIQSDSNDSSTSLVPMLRNHTLSKDAAMGLVLSAANVR-----  100

Query  374  GDGRAIGSG  400
              G   GSG
Sbjct  101  --GWTTGSG  107



>ref|XP_009776939.1| PREDICTED: uncharacterized protein LOC104226608 [Nicotiana sylvestris]
Length=207

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGP VPAGS+ E+  +QISTFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  74   LSAANVRGWTTGSGMEGPPVPAGSDSESNTDQISTFPWSLFTKSPRRRMRVAFTCNVCGQ  133

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  134  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  175


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 17/93 (18%)
 Frame = +2

Query  149  TTAILSPSLPIFSPLKSNRL---SSKRILRFSASPRGNGNEPDLRSNSND-SSLVPI---  307
            T    SPSL IFSP KS  L    S++ ++FS S + NGNEPD +S++ D +S+VPI   
Sbjct  3    TLTAYSPSLSIFSP-KSKDLPSSVSRKFVKFSVSRKNNGNEPDFQSDAIDCTSIVPILNN  61

Query  308  --LSQDAAMGLVERGERSRMDYRVGDGRAIGSG  400
              LS+DAAMGLV      R       G   GSG
Sbjct  62   PTLSKDAAMGLVLSAANVR-------GWTTGSG  87



>ref|XP_009620058.1| PREDICTED: uncharacterized protein LOC104111945 [Nicotiana tomentosiformis]
Length=208

 Score =   198 bits (504),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGP VPAGS+ E+  +QISTFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  75   LSAANVRGWTTGSGMEGPPVPAGSDSESSTDQISTFPWSLFTKSPRRRMRVAFTCNVCGQ  134

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  135  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  176


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 24/102 (24%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRL----SSKRILRFSASPRGNGNEPDLRSNSND-  289
            ME L S       SPSL IFSP KS  L    SS++ ++FS S + NGNEPD +S++ND 
Sbjct  1    METLTS------YSPSLSIFSP-KSKDLPSSSSSRKFVKFSVSRKNNGNEPDFQSDANDC  53

Query  290  SSLVPI-----LSQDAAMGLVERGERSRMDYRVGDGRAIGSG  400
            +S+VPI     LS+D AMGLV      R       G   GSG
Sbjct  54   TSIVPILNNPTLSKDDAMGLVLSAANVR-------GWTTGSG  88



>ref|XP_006435267.1| hypothetical protein CICLE_v10002475mg [Citrus clementina]
 ref|XP_006473726.1| PREDICTED: uncharacterized protein LOC102623239 [Citrus sinensis]
 gb|ESR48507.1| hypothetical protein CICLE_v10002475mg [Citrus clementina]
 gb|KDO84977.1| hypothetical protein CISIN_1g028299mg [Citrus sinensis]
Length=211

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSVPAG+   +  E++STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  76   LSAASVRGWTTGSGMEGPSVPAGAEEGSSTEKVSTFPWSLFTKSPRRRMRVAFTCNVCGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  136  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  177


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 60/111 (54%), Gaps = 19/111 (17%)
 Frame = +2

Query  125  MEALASSTTTAILSPS---LPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSS  295
            ME L+SS T  I+SPS   L IFS    N  S  R++RF A  + NGN+ DL+SNS ++S
Sbjct  1    METLSSSAT--IVSPSSSPLTIFSIKSKN--SPARLVRFPAPSKKNGNDSDLQSNSKETS  56

Query  296  LVPI-----LSQDAAMGLVERGERSRMDYRVGDGRAIGSGGFEPGNRNGAD  433
            +VP+     LS+D AMGLV      R       G   GSG   P    GA+
Sbjct  57   IVPLFGNQTLSKDEAMGLVLSAASVR-------GWTTGSGMEGPSVPAGAE  100



>gb|EPS65916.1| hypothetical protein M569_08860, partial [Genlisea aurea]
Length=166

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAANVRGWTTGSGMEGPS+P G +P +  E  STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  45   LSAANVRGWTTGSGMEGPSIPLGPDPNSITETASTFPWSLFTKSPRRRMRVAFTCNVCGQ  104

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFH+MKCY
Sbjct  105  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHEMKCY  146



>ref|XP_010266915.1| PREDICTED: uncharacterized protein LOC104604317 [Nelumbo nucifera]
Length=210

 Score =   193 bits (490),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGPSVPAG+  E+  E+ISTFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  77   LSAAAGRGWTTGSGMEGPSVPAGAESESSTEKISTFPWSLFTKSPRRRMRVAFTCNVCGQ  136

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  137  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  178



>ref|XP_010539089.1| PREDICTED: uncharacterized protein LOC104813220 [Tarenaya hassleriana]
Length=209

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +3

Query  300  YRSFPRMRRWDW-LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRR  476
            YR+  R       LS+A+VRGWTTGSGMEGPSVPAG+   +  E +STFPWSLFTKSPRR
Sbjct  64   YRTLSRDEAMGLVLSSASVRGWTTGSGMEGPSVPAGAEERSVTENVSTFPWSLFTKSPRR  123

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  124  RMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  178



>ref|XP_007017922.1| Zim17-type zinc finger protein [Theobroma cacao]
 gb|EOY15147.1| Zim17-type zinc finger protein [Theobroma cacao]
Length=214

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSVPA ++ ++  E++STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  77   LSAASVRGWTTGSGMEGPSVPARTDDQSNTEKVSTFPWSLFTKSPRRRMRVAFTCNVCGQ  136

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  137  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  178



>ref|XP_010664127.1| PREDICTED: uncharacterized protein LOC100243759 [Vitis vinifera]
 emb|CBI18909.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTT SGMEGPSVPA +   +  E+ISTFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  75   LSAASVRGWTTDSGMEGPSVPAAAEARSSTERISTFPWSLFTKSPRRRMRVAFTCNVCGQ  134

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  135  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  176


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  304
            MEAL+SS T    S S P     +  +  S R LR + SP+ NGN+ D+RS S++SSLVP
Sbjct  1    MEALSSSATIIAASSSSPSIFSPR--KRDSPRFLRVNVSPKDNGNDSDVRSESDESSLVP  58

Query  305  I-----LSQDAAMGLV  337
            I     LS+DAAMGLV
Sbjct  59   ILTNRTLSKDAAMGLV  74



>ref|XP_002307755.2| hypothetical protein POPTR_0005s26750g [Populus trichocarpa]
 gb|EEE94751.2| hypothetical protein POPTR_0005s26750g [Populus trichocarpa]
Length=218

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSVPAG+   +  E++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  78   LSAASVRGWTTGSGMEGPSVPAGAEDGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  137

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  138  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  179


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 5/45 (11%)
 Frame = +2

Query  218  RILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLV  337
            R+LRF  S + +  + DL+SNSNDSS+VP+     LS+DAAMGLV
Sbjct  33   RLLRFHTSSKKDNKDSDLQSNSNDSSIVPLFSNPTLSKDAAMGLV  77



>ref|XP_011003097.1| PREDICTED: uncharacterized protein LOC105109924 [Populus euphratica]
Length=219

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSVPAG+   +  E++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  78   LSAASVRGWTTGSGMEGPSVPAGAEDGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  137

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  138  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  179


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 5/45 (11%)
 Frame = +2

Query  218  RILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLV  337
            R+LRF  S + +  + DL+SNSNDSS+VP+     LS+DAAMGLV
Sbjct  33   RLLRFHTSSKKDNKDSDLQSNSNDSSIVPLFNNPTLSKDAAMGLV  77



>ref|XP_004144863.1| PREDICTED: uncharacterized protein LOC101212325 [Cucumis sativus]
 ref|XP_004167745.1| PREDICTED: uncharacterized LOC101212325 [Cucumis sativus]
 gb|KGN43276.1| hypothetical protein Csa_7G016610 [Cucumis sativus]
Length=216

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP  PAG   ++G E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  81   LSAATGRGWTTGSGMEGPPAPAGMEAKSGTENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  140

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN YHKLVDNLNLFH+MKCY
Sbjct  141  RTTRAINPHAYTDGTVFVQCCGCNAYHKLVDNLNLFHEMKCY  182



>ref|XP_008447918.1| PREDICTED: uncharacterized protein LOC103490262 [Cucumis melo]
Length=216

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP  PAG   ++G E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  81   LSAATGRGWTTGSGMEGPPAPAGLEAKSGTENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  140

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN YHKLVDNLNLFH+MKCY
Sbjct  141  RTTRAINPHAYTDGTVFVQCCGCNAYHKLVDNLNLFHEMKCY  182



>gb|KDP36867.1| hypothetical protein JCGZ_08158 [Jatropha curcas]
Length=213

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGP VPAG++  +  E++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  76   LSAASVRGWTTGSGMEGPPVPAGADEGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  136  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  177


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 41/80 (51%), Gaps = 12/80 (15%)
 Frame = +2

Query  209  SSKRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVERGERSRMDYRV  373
            S  R LRF  S + N +E DLRS SNDSS+VP      LS+DAAMGLV      R     
Sbjct  28   SPARFLRFHTSSKKNESESDLRSESNDSSIVPFFNNPTLSKDAAMGLVLSAASVR-----  82

Query  374  GDGRAIGSGGFEPGNRNGAD  433
              G   GSG   P    GAD
Sbjct  83   --GWTTGSGMEGPPVPAGAD  100



>ref|XP_010063286.1| PREDICTED: uncharacterized protein LOC104450433 [Eucalyptus grandis]
 gb|KCW70496.1| hypothetical protein EUGRSUZ_F03705 [Eucalyptus grandis]
Length=222

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTT SGMEGP  PAG+   +G E++STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  87   LSAASVRGWTTDSGMEGPVAPAGAEGGSGTERVSTFPWSLFTKSPRRRMRVAFTCNVCGQ  146

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  147  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  188



>gb|KJB14347.1| hypothetical protein B456_002G120700 [Gossypium raimondii]
Length=206

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPE-TGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA+VRGWTTGSGMEGPSVPA ++ + +  EQ+STFPWSLFTKSPRRRM VAFTC VCG
Sbjct  70   LSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCG  129

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH MKCY
Sbjct  130  QRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHGMKCY  172



>gb|KHG11073.1| Mitochondrial import protein ZIM17 [Gossypium arboreum]
Length=206

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPE-TGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA+VRGWTTGSGMEGPSVPA ++ + +  EQ+STFPWSLFTKSPRRRM VAFTC VCG
Sbjct  70   LSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCG  129

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH MKCY
Sbjct  130  QRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHGMKCY  172



>gb|AIA63975.1| transcription factor ZFP130 [Gossypium hirsutum]
Length=206

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPE-TGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA+VRGWTTGSGMEGPSVPA ++ + +  EQ+STFPWSLFTKSPRRRM VAFTC VCG
Sbjct  70   LSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCG  129

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH MKCY
Sbjct  130  QRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHGMKCY  172



>ref|XP_002510604.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52791.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 94/102 (92%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSVPAG++  +  E +ST PWSLFTKSPRRRM VAFTC +CGQ
Sbjct  76   LSAASVRGWTTGSGMEGPSVPAGTD-GSNTENVSTLPWSLFTKSPRRRMRVAFTCNICGQ  134

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  135  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  176



>ref|XP_008806155.1| PREDICTED: uncharacterized protein LOC103718920 [Phoenix dactylifera]
Length=209

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP +PA S+ ++    +STFPWSLFTKSPRRRMLVAFTC VCGQ
Sbjct  78   LSAAAGRGWTTGSGMEGPPIPAESDSDSTDRTVSTFPWSLFTKSPRRRMLVAFTCNVCGQ  137

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  138  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  179



>ref|XP_008358361.1| PREDICTED: uncharacterized protein LOC103422104 [Malus domestica]
Length=217

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            + AA  RGWTTGSGMEGP  PAG   E+  E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  81   MGAATGRGWTTGSGMEGPPAPAGVQTESSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  140

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN +HKLVDNLNLFH+MKCY
Sbjct  141  RTTRAINPHAYTDGTVFVQCCGCNAFHKLVDNLNLFHEMKCY  182



>ref|XP_010086843.1| Mitochondrial protein import protein ZIM17 [Morus notabilis]
 gb|EXB24041.1| Mitochondrial protein import protein ZIM17 [Morus notabilis]
Length=211

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP VP GS  ++  E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  78   LSAAAGRGWTTGSGMEGPPVPDGSEAKSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  137

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGC+ +HKLVDNLNLFH+M CY
Sbjct  138  RTTRAINPHAYTDGTVFVQCCGCSAFHKLVDNLNLFHEMNCY  179



>ref|XP_007200461.1| hypothetical protein PRUPE_ppa011293mg [Prunus persica]
 gb|EMJ01660.1| hypothetical protein PRUPE_ppa011293mg [Prunus persica]
Length=216

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA  RGWTTGSGMEGP  PAG +  +  E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  81   MSAATGRGWTTGSGMEGPPAPAGIHTHSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  140

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN +HKLVDNLNLFH+MKCY
Sbjct  141  RTTRAINPHAYTDGTVFVQCCGCNAFHKLVDNLNLFHEMKCY  182



>ref|XP_008236070.1| PREDICTED: uncharacterized protein LOC103334867 [Prunus mume]
Length=254

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA  RGWTTGSGMEGP  PAG +  +  E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  119  MSAATGRGWTTGSGMEGPPAPAGIHTHSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  178

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN +HKLVDNLNLFH+MKCY
Sbjct  179  RTTRAINPHAYTDGTVFVQCCGCNAFHKLVDNLNLFHEMKCY  220



>ref|XP_011034950.1| PREDICTED: uncharacterized protein LOC105132906 [Populus euphratica]
Length=206

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSV A S      E++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  74   LSAASVRGWTTGSGMEGPSVTAVSEDGFNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  133

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  134  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  175



>ref|XP_002300678.2| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 ref|XP_006386157.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|EEE79951.2| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|ERP63954.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
Length=210

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSV A S      E++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  74   LSAASVRGWTTGSGMEGPSVTAVSEDGFNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  133

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  134  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  175



>ref|XP_011458699.1| PREDICTED: uncharacterized protein LOC105349780 [Fragaria vesca 
subsp. vesca]
Length=211

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            + AA  RGWTTGSGMEGP  PAG +  +  E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  76   MGAATGRGWTTGSGMEGPPTPAGIDSRSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHA+TDGTVFVQCCGCN +HKLVDNLNLFH+MKCY
Sbjct  136  RTTRAINPHAFTDGTVFVQCCGCNAFHKLVDNLNLFHEMKCY  177



>gb|KHN37381.1| Hypothetical protein glysoja_013596 [Glycine soja]
Length=217

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  82   LSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICG  141

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  142  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  184



>ref|NP_001235094.1| uncharacterized protein LOC100527113 [Glycine max]
 gb|ACU16158.1| unknown [Glycine max]
 gb|KHN11510.1| Hypothetical protein glysoja_015405 [Glycine soja]
Length=215

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  81   LSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICG  140

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  141  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  183



>ref|XP_006588421.1| PREDICTED: uncharacterized protein LOC100527474 isoform X2 [Glycine 
max]
Length=210

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  75   LSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICG  134

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  135  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  177



>ref|XP_010421645.1| PREDICTED: uncharacterized protein LOC104707070 isoform X1 [Camelina 
sativa]
Length=234

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA  + ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  92   LSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  147

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  148  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  189



>ref|XP_002874388.1| hypothetical protein ARALYDRAFT_489599 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50647.1| hypothetical protein ARALYDRAFT_489599 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA  + ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  80   LSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  136  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  177



>ref|XP_008811782.1| PREDICTED: uncharacterized protein LOC103722853 isoform X2 [Phoenix 
dactylifera]
Length=181

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L+A   RGWTTGSGMEGPS+PA  +PE+    +ST PWSLFTKSPRRRMLVAFTC VCGQ
Sbjct  52   LNAVAGRGWTTGSGMEGPSMPA--DPESPDRTVSTVPWSLFTKSPRRRMLVAFTCNVCGQ  109

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH MKCY
Sbjct  110  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHGMKCY  151



>ref|XP_006588420.1| PREDICTED: uncharacterized protein LOC100527474 isoform X1 [Glycine 
max]
Length=222

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  87   LSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICG  146

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  147  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  189



>ref|XP_006288620.1| hypothetical protein CARUB_v10001922mg [Capsella rubella]
 gb|EOA21518.1| hypothetical protein CARUB_v10001922mg [Capsella rubella]
Length=220

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA  +   G E +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  81   LSAASVKGWTTGSGMEGPSLPAKPD---GTETVSTFPWSLFTKSPRRRMRVAFTCNVCGQ  137

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  138  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  179



>ref|XP_006605315.1| PREDICTED: uncharacterized protein LOC100527113 isoform X1 [Glycine 
max]
Length=220

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  86   LSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICG  145

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  146  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  188



>ref|NP_198080.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
 gb|AAB61076.1| A_TM021B04.14 gene product [Arabidopsis thaliana]
 gb|AAL24413.1| unknown protein [Arabidopsis thaliana]
 gb|AAM10131.1| unknown protein [Arabidopsis thaliana]
 gb|AED93666.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
Length=212

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA ++ +T    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  77   LSAASVKGWTTGSGMEGPSLPAKTDTDT----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  132

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  133  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  174



>ref|XP_010421646.1| PREDICTED: uncharacterized protein LOC104707070 isoform X2 [Camelina 
sativa]
Length=223

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA  + ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  81   LSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  136

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  137  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  178



>gb|AAM64347.1| unknown [Arabidopsis thaliana]
Length=212

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA ++ +T    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  77   LSAASVKGWTTGSGMEGPSLPAKTDTDT----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  132

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  133  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  174



>ref|XP_010935184.1| PREDICTED: uncharacterized protein LOC105055145 [Elaeis guineensis]
Length=207

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L+AA  RGWTTGSGMEGP +PA S  ++    +STFPWSLFTKSPRRRMLVAFTC VCGQ
Sbjct  78   LNAAAGRGWTTGSGMEGPPIPADS--DSTNRTVSTFPWSLFTKSPRRRMLVAFTCNVCGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++KCY
Sbjct  136  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEIKCY  177



>ref|NP_001236547.1| uncharacterized protein LOC100527474 [Glycine max]
 gb|ACU16568.1| unknown [Glycine max]
Length=217

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA G + E+G   ISTFPWSLFTKSPRRRML+AFTC +CG
Sbjct  82   LSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLMAFTCTICG  141

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  142  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  184



>ref|XP_006405268.1| hypothetical protein EUTSA_v10027929mg [Eutrema salsugineum]
 gb|ESQ46721.1| hypothetical protein EUTSA_v10027929mg [Eutrema salsugineum]
Length=215

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L+AA+VRGWTTGSGMEGPS+PA ++ ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  77   LNAASVRGWTTGSGMEGPSLPAKADTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  132

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAY+DGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  133  RTTRAINPHAYSDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  174



>ref|XP_010494029.1| PREDICTED: uncharacterized protein LOC104771232 [Camelina sativa]
Length=223

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA  + ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  81   LSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  136

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K Y
Sbjct  137  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKYY  178



>ref|XP_004497201.1| PREDICTED: uncharacterized protein LOC101505438 [Cicer arietinum]
Length=231

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA GS+ + G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  88   LSAATGRGWTTGSGMEGPSVPAVGSDDQLGTGNISTFPWSLFTKSPRRRMLVAFTCTICG  147

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  148  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  190



>ref|XP_010941361.1| PREDICTED: uncharacterized protein LOC105059672 [Elaeis guineensis]
Length=207

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L+AA  RGWTTGSGMEGPS+PA  + E+    +STFP SLFTKSPRRRMLVAFTC VCGQ
Sbjct  78   LNAAAGRGWTTGSGMEGPSMPA--DLESPDRTVSTFPLSLFTKSPRRRMLVAFTCNVCGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  136  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  177



>ref|XP_008811775.1| PREDICTED: uncharacterized protein LOC103722853 isoform X1 [Phoenix 
dactylifera]
Length=210

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L+A   RGWTTGSGMEGPS+PA  +PE+    +ST PWSLFTKSPRRRMLVAFTC VCGQ
Sbjct  81   LNAVAGRGWTTGSGMEGPSMPA--DPESPDRTVSTVPWSLFTKSPRRRMLVAFTCNVCGQ  138

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH MKCY
Sbjct  139  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHGMKCY  180



>emb|CDY12988.1| BnaC02g29950D [Brassica napus]
Length=214

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPS+PA ++ ET    ISTFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  77   LSAASVRGWTTGSGMEGPSLPAKADAET----ISTFPWSLFTKSPRRRMRVAFTCNVCGQ  132

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGC ++HKLVDNLNLFH++K Y
Sbjct  133  RTTRAINPHAYTDGTVFVQCCGCYVFHKLVDNLNLFHEVKYY  174



>gb|KFK32942.1| hypothetical protein AALP_AA6G309400 [Arabis alpina]
Length=207

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPS+PA S+ ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  75   LSAASVRGWTTGSGMEGPSLPAKSDSET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  130

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGC ++HKLVDNL+LFH++K Y
Sbjct  131  RTTRAINPHAYTDGTVFVQCCGCYVFHKLVDNLDLFHEVKYY  172



>ref|XP_010455141.1| PREDICTED: uncharacterized protein LOC104736783 isoform X1 [Camelina 
sativa]
Length=229

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 4/100 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA  + ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  92   LSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  147

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K
Sbjct  148  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVK  187



>ref|XP_008348928.1| PREDICTED: uncharacterized protein LOC103412108 [Malus domestica]
 ref|XP_008365921.1| PREDICTED: uncharacterized protein LOC103429551 [Malus domestica]
Length=216

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            + AA  RGWTTGSGMEGP  PAG   ++  E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  81   MGAATGRGWTTGSGMEGPPAPAGVQTQS-TENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  139

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN +HKLVD+LNLFH+MKCY
Sbjct  140  RTTRAINPHAYTDGTVFVQCCGCNAFHKLVDHLNLFHEMKCY  181



>ref|XP_010455142.1| PREDICTED: uncharacterized protein LOC104736783 isoform X2 [Camelina 
sativa]
Length=218

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 4/100 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+V+GWTTGSGMEGPS+PA  + ET    +STFPWSLFTKSPRRRM VAFTC VCGQ
Sbjct  81   LSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQ  136

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K
Sbjct  137  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVK  176



>ref|XP_009355592.1| PREDICTED: uncharacterized protein LOC103946591 [Pyrus x bretschneideri]
Length=216

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            + AA  RGWTTGSGMEGP  PAG   ++  E +STFPWSLFTKSPRRRMLVAFTC +CGQ
Sbjct  81   MGAATGRGWTTGSGMEGPPAPAGVQTQS-TENVSTFPWSLFTKSPRRRMLVAFTCNICGQ  139

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN +HKLVD+LNLFH+MKCY
Sbjct  140  RTTRAINPHAYTDGTVFVQCCGCNAFHKLVDHLNLFHEMKCY  181



>gb|AFK34110.1| unknown [Lotus japonicus]
Length=244

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPS PA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  104  LSAAMGRGWTTGSGMEGPSAPAAGRDNESGTGNISTFPWSLFTKSPRRRMLVAFTCTICG  163

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  164  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  206



>ref|XP_009391023.1| PREDICTED: uncharacterized protein LOC103977279 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP +PA S  ++  + + TFPWSL+T+SPRRRM VAFTC VCGQ
Sbjct  80   LSAAAGRGWTTGSGMEGPRIPAYS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQ  137

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  138  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  179



>ref|XP_009391022.1| PREDICTED: uncharacterized protein LOC103977279 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=245

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP +PA S  ++  + + TFPWSL+T+SPRRRM VAFTC VCGQ
Sbjct  118  LSAAAGRGWTTGSGMEGPRIPAYS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQ  175

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  176  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  217



>ref|XP_009391021.1| PREDICTED: uncharacterized protein LOC103977279 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP +PA S  ++  + + TFPWSL+T+SPRRRM VAFTC VCGQ
Sbjct  119  LSAAAGRGWTTGSGMEGPRIPAYS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQ  176

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  177  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  218



>gb|AFK48753.1| unknown [Medicago truncatula]
Length=230

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGP VPA G + ++G E ISTFPWSLFTKSPRRRML+AFTC +CG
Sbjct  95   LSAATGRGWTTGSGMEGPPVPAVGKDGQSGTENISTFPWSLFTKSPRRRMLIAFTCTICG  154

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCC CN YHKLVD+LNLF +  CY
Sbjct  155  QRTTRAINPHAYTDGTVFVQCCECNAYHKLVDHLNLFQETNCY  197



>ref|XP_007142794.1| hypothetical protein PHAVU_007G017400g [Phaseolus vulgaris]
 gb|ESW14788.1| hypothetical protein PHAVU_007G017400g [Phaseolus vulgaris]
Length=214

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 3/103 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGPSVPA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  82   LSAAVGRGWTTGSGMEGPSVPAVGRDNESG--NISTFPWSLFTKSPRRRMLVAFTCTICG  139

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  140  QRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  182



>gb|KEH44399.1| DNL zinc finger protein [Medicago truncatula]
Length=231

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSGMEGP VPA G + ++G E ISTFPWSLFTKSPRRRML+AFTC +CG
Sbjct  95   LSAATGRGWTTGSGMEGPPVPAVGKDGQSGTENISTFPWSLFTKSPRRRMLIAFTCTICG  154

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCC CN YHKLVD+LNLF +  CY
Sbjct  155  QRTTRAINPHAYTDGTVFVQCCECNAYHKLVDHLNLFQETNCY  197



>ref|XP_009414426.1| PREDICTED: uncharacterized protein LOC103995548 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP VPA +  ++  + + TFPWSL+T+SPRRRM V FTC VCGQ
Sbjct  78   LSAATGRGWTTGSGMEGPPVPADT--DSADQAVLTFPWSLYTRSPRRRMRVVFTCNVCGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH MKCY
Sbjct  136  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHGMKCY  177



>ref|XP_009418558.1| PREDICTED: uncharacterized protein LOC103998726 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP +PA S  ++    + TFPWSL+T+SPRRRM VAFTC +CGQ
Sbjct  78   LSAAAGRGWTTGSGMEGPPIPADS--DSADRTVLTFPWSLYTRSPRRRMRVAFTCNICGQ  135

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  136  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  177



>gb|AFK39869.1| unknown [Lotus japonicus]
Length=243

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA  RGWTTGSG+EGPS PA G + E+G   ISTFPWSLFTKSPRRRMLVAFTC +CG
Sbjct  103  LSAAMGRGWTTGSGVEGPSAPAAGRDNESGTGDISTFPWSLFTKSPRRRMLVAFTCTICG  162

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTT+AINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY
Sbjct  163  QRTTQAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCY  205



>ref|XP_010690316.1| PREDICTED: uncharacterized protein LOC104903883 [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L+AA  +GWTTGSGMEGP   AG + E+   +ISTFPWSLFTKSPRRRML+AFTC +C Q
Sbjct  106  LNAATGKGWTTGSGMEGPPESAG-DAESSNAKISTFPWSLFTKSPRRRMLIAFTCNICSQ  164

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN YHKLVDNLNLF  MKCY
Sbjct  165  RTTRAINPHAYTDGTVFVQCCGCNAYHKLVDNLNLFDGMKCY  206


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 55/112 (49%), Gaps = 26/112 (23%)
 Frame = +2

Query  113  LLSTMEALASSTTTAILSPS------LPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLR  274
            L STME L  S+ TA L  S      L IFSP + +R     ILRFS S +G  +E  ++
Sbjct  18   LRSTMETLTMSSATATLKSSSSSSSPLSIFSPKQPSR---PNILRFSLSSKGRDDESHIQ  74

Query  275  SNSNDSSLVPI----------LSQDAAMGLVERGERSRMDYRVGDGRAIGSG  400
            S S D  +VP+          LS+D AMGLV       ++   G G   GSG
Sbjct  75   SESKDMRIVPLADNQRLSLSPLSKDCAMGLV-------LNAATGKGWTTGSG  119



>ref|NP_001058612.2| Os06g0724400 [Oryza sativa Japonica Group]
 dbj|BAD61688.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD62532.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20526.2| Os06g0724400 [Oryza sativa Japonica Group]
Length=205

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA  RGWTTGSGMEGP   AG        ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  78   VSAATGRGWTTGSGMEGPPKAAGGGDR---PEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  134

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  135  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  176



>gb|EAZ02398.1| hypothetical protein OsI_24501 [Oryza sativa Indica Group]
Length=205

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA  RGWTTGSGMEGP   AG        ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  78   VSAATGRGWTTGSGMEGPPKAAGGGDR---PEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  134

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  135  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  176



>gb|EAZ38321.1| hypothetical protein OsJ_22696 [Oryza sativa Japonica Group]
Length=205

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA  RGWTTGSGMEGP   AG        ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  78   VSAATGRGWTTGSGMEGPPKAAGGGDR---PEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  134

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  135  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  176



>ref|NP_001131303.1| uncharacterized protein LOC100192616 [Zea mays]
 gb|ACF79647.1| unknown [Zea mays]
Length=211

 Score =   170 bits (430),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP   A      G  ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  83   VSAATGSGWTTGSGMEGPPT-ASKAGGAGRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  141

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  142  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  183



>ref|XP_010028773.1| PREDICTED: uncharacterized protein LOC104418983 [Eucalyptus grandis]
 gb|KCW55588.1| hypothetical protein EUGRSUZ_I01459 [Eucalyptus grandis]
Length=220

 Score =   170 bits (430),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L+AA  RGWTTGSG+EGP VPA +  E+  E  ST P+SLFTKSPRRRMLVAFTC +C Q
Sbjct  90   LNAAVGRGWTTGSGLEGPPVPAET--ESSSEDTSTLPFSLFTKSPRRRMLVAFTCNICRQ  147

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN YHKLVDNLNLFH+M CY
Sbjct  148  RTTRAINPHAYTDGTVFVQCCGCNAYHKLVDNLNLFHEMNCY  189



>ref|XP_003563260.1| PREDICTED: uncharacterized protein LOC100844750 [Brachypodium 
distachyon]
Length=210

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP     +N      ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  83   MSAATGSGWTTGSGMEGPPTAGAAN----RPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  138

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  139  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  180



>ref|XP_008643737.1| PREDICTED: LOC100283270 isoform X1 [Zea mays]
 gb|AFW69541.1| DNL zinc finger family protein [Zea mays]
Length=208

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP   A      G  ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  80   VSAATGSGWTTGSGMEGPPT-ASKAGGAGRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  138

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  139  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  180



>ref|XP_002439041.1| hypothetical protein SORBIDRAFT_10g030440 [Sorghum bicolor]
 gb|EER90408.1| hypothetical protein SORBIDRAFT_10g030440 [Sorghum bicolor]
Length=214

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP   A      G  ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  86   VSAATGSGWTTGSGMEGPPT-ASKAGGAGRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  144

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  145  RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  186



>ref|NP_001149644.1| LOC100283270 [Zea mays]
 gb|ACG36220.1| DNL zinc finger family protein [Zea mays]
 gb|AFW69540.1| DNL zinc finger family protein [Zea mays]
Length=133

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP   A      G  ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  5    VSAATGSGWTTGSGMEGPPT-ASKAGGAGRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  63

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCY
Sbjct  64   RTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCY  105



>gb|ABK21254.1| unknown [Picea sitchensis]
Length=214

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L AA  RGWTTGSGMEGP+V AG    T M + S +PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  86   LKAAGGRGWTTGSGMEGPAVSAGPKENTEMAEKSIYPWSLFTKSPRRRMRVAFTCGVCGQ  145

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            RTTRAINPHAYTDGTVFVQC GC+++HKLVDNLNLFH++K
Sbjct  146  RTTRAINPHAYTDGTVFVQCAGCDVFHKLVDNLNLFHELK  185



>ref|XP_006656504.1| PREDICTED: uncharacterized protein LOC102700628 [Oryza brachyantha]
Length=205

 Score =   168 bits (425),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 85/102 (83%), Gaps = 3/102 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP   AG        ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  78   VSAATGSGWTTGSGMEGPPKAAGG---ADRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  134

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  135  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  176



>dbj|BAJ94825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 3/102 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP    G+       ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  116  MSAATGSGWTTGSGMEGPPTAGGA---ANRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  172

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  173  RTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  214



>ref|XP_004966483.1| PREDICTED: uncharacterized protein LOC101768670 [Setaria italica]
Length=209

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 86/103 (83%), Gaps = 3/103 (3%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPE-TGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            +SAA   GWTTGSGMEGP  PA S        ++ST PWSLFTKSPRRRM VAFTC VCG
Sbjct  81   VSAATGSGWTTGSGMEGP--PAASRAGGADRPEVSTLPWSLFTKSPRRRMRVAFTCNVCG  138

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            QRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCY
Sbjct  139  QRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCY  181



>ref|XP_006828828.1| hypothetical protein AMTR_s00001p00142230 [Amborella trichopoda]
 gb|ERM96244.1| hypothetical protein AMTR_s00001p00142230 [Amborella trichopoda]
Length=201

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA  RGWTTGSGMEGP V + ++     + +STFPWSLFT+SPRRRM VAFTC VCGQ
Sbjct  74   LSAATGRGWTTGSGMEGPPV-SEADVSNAQQPVSTFPWSLFTRSPRRRMRVAFTCNVCGQ  132

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQC GCNI+HKLVDNLNLFH+M  Y
Sbjct  133  RTTRAINPHAYTDGTVFVQCAGCNIFHKLVDNLNLFHEMTGY  174



>gb|EMS65438.1| hypothetical protein TRIUR3_05242 [Triticum urartu]
Length=543

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 86/116 (74%), Gaps = 17/116 (15%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            +SAA   GWTTGSGMEGP +  G+       ++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  5    MSAATGSGWTTGSGMEGPPMAGGA---ANRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  61

Query  516  RTTRAINPHAYTDGTVFVQ--------------CCGCNIYHKLVDNLNLFHDMKCY  641
            RTTRAINPHAYTDGTVFVQ              CCGCNI+HKLVDNLNLFH+MKCY
Sbjct  62   RTTRAINPHAYTDGTVFVQNLPFHISVALNLKKCCGCNIFHKLVDNLNLFHEMKCY  117



>gb|KJB14348.1| hypothetical protein B456_002G120700 [Gossypium raimondii]
Length=154

 Score =   139 bits (349),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNP-ETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAA+VRGWTTGSGMEGPSVPA ++  ++  EQ+STFPWSLFTKSPRRRM VAFTC VCG
Sbjct  70   LSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCG  129

Query  513  QRTTRAINPHAYTDGTVFVQC  575
            QRTTRAINPHAYTDGTVFVQ 
Sbjct  130  QRTTRAINPHAYTDGTVFVQV  150


 Score = 47.8 bits (112),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 12/76 (16%)
 Frame = +2

Query  125  MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  304
            MEAL SS   A+LS    IFSP + +     RI+RF    + +GN+ D++ + N++S+VP
Sbjct  1    MEAL-SSQPLALLS----IFSPKRKD--FPARIIRFPTHSKKDGNDSDIQYDPNNTSIVP  53

Query  305  IL-----SQDAAMGLV  337
            ++     SQDAAMGLV
Sbjct  54   LVGNQTFSQDAAMGLV  69



>gb|EMT02176.1| hypothetical protein F775_14553 [Aegilops tauschii]
Length=564

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  429  QISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  608
            ++ST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVD
Sbjct  10   EVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVD  69

Query  609  NLNLFHDMKCY  641
            NLNLFH+MKCY
Sbjct  70   NLNLFHEMKCY  80



>ref|XP_002977585.1| hypothetical protein SELMODRAFT_58719, partial [Selaginella moellendorffii]
 gb|EFJ21589.1| hypothetical protein SELMODRAFT_58719, partial [Selaginella moellendorffii]
Length=105

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            L AA+ +GWTT SG+EGP+  +  N     E      W L +KSPRRRM VAFTC VCG 
Sbjct  12   LQAASGKGWTTDSGLEGPAFTSKENSSLSEEN----QWPLLSKSPRRRMRVAFTCNVCGA  67

Query  516  RTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            RT RAINPHAYTDGTVFVQC GCN++HKLVDNLNLF++
Sbjct  68   RTMRAINPHAYTDGTVFVQCKGCNVFHKLVDNLNLFYE  105



>ref|XP_006386156.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|ERP63953.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
Length=189

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQ  515
            LSAA+VRGWTTGSGMEGPSV A S      E++ST PWSLFTKSPRRRM VAFTC VCGQ
Sbjct  74   LSAASVRGWTTGSGMEGPSVTAVSEDGFNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQ  133

Query  516  RTTRAINPHAYTDGTVFVQC  575
            RTTRAINPHAYTDGTVFVQC
Sbjct  134  RTTRAINPHAYTDGTVFVQC  153



>ref|XP_001760208.1| predicted protein [Physcomitrella patens]
 gb|EDQ74964.1| predicted protein [Physcomitrella patens]
Length=283

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 74/99 (75%), Gaps = 7/99 (7%)
 Frame = +3

Query  339  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQR  518
            +A +  GWTTGSG+EGPS P         E  +  P  +F+KSPRRRM VAFTC VCG R
Sbjct  170  AAGSTAGWTTGSGLEGPSYPM-------EEAANEMPGPIFSKSPRRRMRVAFTCNVCGHR  222

Query  519  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            + RAINPHAYTDGTVFVQC GC+++HKLVDNL LFH++K
Sbjct  223  SIRAINPHAYTDGTVFVQCEGCDVFHKLVDNLKLFHELK  261



>emb|CAO02549.1| putative zinc finger (DNL type) family protein [Vigna unguiculata]
Length=113

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = -2

Query  538  GLMARVVRCPQTLQVKATSIRRRGDFVKRDQGKVDIC--SIPVSGFEPAGTDGPSIPDPV  365
            GL+ARVVR PQ +QVKATSI   GDFVKRD GKV++   S+P+     AGT+GPSIP+PV
Sbjct  2    GLIARVVRWPQMVQVKATSILLLGDFVKRDHGKVEMFPDSLPLPT---AGTEGPSIPEPV  58

Query  364  VHPRTFAALNQS  329
            VHP   AAL+ S
Sbjct  59   VHPLPTAALSTS  70



>ref|XP_004135125.1| PREDICTED: uncharacterized protein LOC101206910 [Cucumis sativus]
 gb|KGN52030.1| hypothetical protein Csa_5G608180 [Cucumis sativus]
Length=173

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 56/103 (54%), Gaps = 12/103 (12%)
 Frame = +3

Query  315  RMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAF  494
            R RR+  L+ +++    TG   E    P+  N +TG         ++  K PRR ++V F
Sbjct  64   RERRYKVLTVSSLVDGYTGDDDE----PSQRNSDTG--------AAIDIKLPRRSLMVTF  111

Query  495  TCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            TC  C +RT R IN  AY  G VFVQC GC  YHKLVDNL L 
Sbjct  112  TCNQCSERTKRLINRLAYERGLVFVQCAGCQKYHKLVDNLGLI  154



>ref|XP_005652036.1| zf-DNL-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27492.1| zf-DNL-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=208

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  459  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
             K+PRR   V FTC +CG+ TT+ +NPHA+ +GTVF +C GC + HKL+DNL LFH+++
Sbjct  109  NKNPRRTRKVQFTCNLCGETTTKRVNPHAWENGTVFAECSGCRVKHKLIDNLKLFHELR  167



>ref|NP_001150527.1| zinc ribbon 1 [Zea mays]
 gb|ACG39419.1| zinc ribbon 1 [Zea mays]
Length=161

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = +3

Query  393  VPAGSNPETGMEQI-STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  569
            V A S+ E   + + S    ++  K PRR +LV FTC  CG+RT R IN  AY  GTVF+
Sbjct  61   VSASSSGEANSDAVPSPAEAAIDIKLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFL  120

Query  570  QCCGCNIYHKLVDNLNLF--HDMK  635
            QC GC +YHK VDNL L   +D++
Sbjct  121  QCAGCQVYHKFVDNLGLVVEYDLR  144



>tpg|DAA58876.1| TPA: etched1 isoform 1 [Zea mays]
 tpg|DAA58877.1| TPA: etched1 isoform 2 [Zea mays]
Length=86

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  10   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  62



>ref|XP_002458121.1| hypothetical protein SORBIDRAFT_03g027210 [Sorghum bicolor]
 gb|EES03241.1| hypothetical protein SORBIDRAFT_03g027210 [Sorghum bicolor]
Length=163

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = +3

Query  393  VPAGSNPETGMEQI-STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  569
            V A S+ E   + + S    ++  K PRR +LV FTC  CG+RT R IN  AY  GTVF+
Sbjct  63   VSASSSGEANSDAVPSPTEATIDIKLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFL  122

Query  570  QCCGCNIYHKLVDNLNLF--HDMK  635
            QC GC +YHK VDNL L   +D++
Sbjct  123  QCAGCQVYHKFVDNLGLVVEYDLR  146



>ref|NP_001105722.1| etched1 [Zea mays]
 emb|CAD45038.1| ETCHED1 protein [Zea mays]
 emb|CAD45039.1| ETCHED1 protein [Zea mays]
Length=163

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = +3

Query  393  VPAGSNPETGMEQI-STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  569
            V A S+ E   + + S    ++  K PRR +LV FTC  CG+RT R IN  AY  GTVF+
Sbjct  63   VSASSSGEANSDAVPSPTEAAIDIKLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFL  122

Query  570  QCCGCNIYHKLVDNLNLF--HDMK  635
            QC GC +YHK VDNL L   +D++
Sbjct  123  QCAGCQVYHKFVDNLGLVVEYDLR  146



>ref|NP_001043517.2| Os01g0605200 [Oryza sativa Japonica Group]
 dbj|BAD52669.1| putative zinc ribbon 1 [Oryza sativa Japonica Group]
 gb|EAZ12620.1| hypothetical protein OsJ_02531 [Oryza sativa Japonica Group]
 dbj|BAF05431.2| Os01g0605200 [Oryza sativa Japonica Group]
Length=154

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 11/81 (14%)
 Frame = +3

Query  399  AGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  578
            AGS P       STF  +L    PRR +LV FTC  CG+RT R IN  AY  GT+F+QC 
Sbjct  72   AGSAPAE-----STFDLNL----PRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCA  122

Query  579  GCNIYHKLVDNLNLF--HDMK  635
            GC +YHK VDNL L   +D++
Sbjct  123  GCQVYHKFVDNLGLVVEYDLR  143



>tpg|DAA58878.1| TPA: etched1 [Zea mays]
Length=166

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  635
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  90   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLVVEYDLR  149



>ref|XP_002438978.1| hypothetical protein SORBIDRAFT_10g029320 [Sorghum bicolor]
 gb|EER90345.1| hypothetical protein SORBIDRAFT_10g029320 [Sorghum bicolor]
Length=164

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 63/132 (48%), Gaps = 30/132 (23%)
 Frame = +3

Query  249  VTGTSPISDPIPMTRAWYRSFPRMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGME  428
            V  +S +  P P  RA YR                           P   A S+ +   +
Sbjct  43   VASSSKLKAPAPRLRASYR---------------------------PRCLASSSGQVNSD  75

Query  429  QI-STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLV  605
             + S+   ++  K PRR +LV FTC  CG+RT R IN  AY  G++F+QC GC +YHK V
Sbjct  76   AVLSSTEATIDIKLPRRSLLVQFTCNACGERTKRLINRVAYERGSIFLQCAGCQVYHKFV  135

Query  606  DNLNLF--HDMK  635
            DNL L   +D++
Sbjct  136  DNLGLVVEYDLR  147



>ref|XP_004969096.1| PREDICTED: DNL-type zinc finger protein-like [Setaria italica]
Length=162

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL+L 
Sbjct  86   KLPRRSLLVQFTCNKCGERTQRLINRLAYERGTVFLQCAGCQVYHKFVDNLDLV  139



>gb|ABK26747.1| unknown [Picea sitchensis]
Length=156

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            PRR ++V+F C  CG RT R +N HAY  GTVFVQC GC  YHKLVDNL L 
Sbjct  86   PRRSLMVSFNCDACGTRTKRIVNRHAYERGTVFVQCAGCEAYHKLVDNLGLI  137



>gb|EEC71043.1| hypothetical protein OsI_02763 [Oryza sativa Indica Group]
Length=154

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = +3

Query  435  STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  614
            STF  +L    PRR +LV FTC  CG+RT R IN  AY  GT+F+QC GC +YHK VDNL
Sbjct  79   STFDLNL----PRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCAGCQVYHKFVDNL  134

Query  615  NLF--HDMK  635
             L   +D++
Sbjct  135  GLVVEYDLR  143



>gb|KFK41298.1| hypothetical protein AALP_AA2G112200 [Arabis alpina]
Length=167

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 11/104 (11%)
 Frame = +3

Query  312  PRMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVA  491
            P+   W +  + ++   T GSG+     P   + ++   Q++    S+  K PRR +LV 
Sbjct  58   PKQNNWLFSVSGSL---TDGSGLN----PEEESKDSSEGQVA----SVDIKLPRRSLLVE  106

Query  492  FTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            F+C  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL L 
Sbjct  107  FSCNSCGERTKRLINRHAYERGLVFVQCGGCLQHHKLVDNLGLI  150



>ref|XP_002888678.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64937.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=171

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR +LV F+C  CG+RT R IN HAY +G VFVQC GC  +HKLVDNL L 
Sbjct  97   SIDIKLPRRSLLVEFSCDSCGERTKRLINRHAYENGLVFVQCAGCLQHHKLVDNLGLI  154



>gb|EPS62111.1| hypothetical protein M569_12682, partial [Genlisea aurea]
Length=70

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +LV+FTC  CG R+ R IN  AY  G V+VQC GC+ YHKLVDNL L
Sbjct  7    KFPRRNLLVSFTCNACGARSQRLINRLAYERGLVYVQCSGCSRYHKLVDNLGL  59



>ref|NP_001105159.1| zinc ribbon 1 [Zea mays]
 emb|CAD45040.1| zinc ribbon 1 [Zea mays]
 gb|ACN34374.1| unknown [Zea mays]
 gb|AFW69400.1| Zinc ribbon 1 [Zea mays]
Length=162

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +3

Query  384  GPSVPAGSNPETGMEQI-STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  560
            GP   A S+ +   + + S    ++  K PRR +LV FTC  CG+RT R IN  AY  GT
Sbjct  59   GPRRLASSSGKANSDAVPSPTEATIDIKLPRRSLLVQFTCNACGERTKRLINRVAYERGT  118

Query  561  VFVQCCGCNIYHKLVDNLNLF--HDMK  635
            +F+QC GC +YHK VDNL L   +D++
Sbjct  119  IFLQCAGCQVYHKFVDNLGLVVEYDLR  145



>ref|XP_008446529.1| PREDICTED: uncharacterized protein C24H6.02c isoform X2 [Cucumis 
melo]
Length=170

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 55/103 (53%), Gaps = 12/103 (12%)
 Frame = +3

Query  315  RMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAF  494
            R RR+  L+ +++    TG   E     +  N +TG         ++  K PRR ++V F
Sbjct  61   RGRRYKVLTVSSLVDGYTGDDDES----SQRNSDTG--------AAIDIKLPRRSLMVTF  108

Query  495  TCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            TC  C +RT R IN  AY  G VFVQC GC  YHKLVDNL L 
Sbjct  109  TCNQCSERTKRLINRLAYERGLVFVQCAGCQKYHKLVDNLGLI  151



>ref|XP_009392908.1| PREDICTED: uncharacterized protein LOC103978730 [Musa acuminata 
subsp. malaccensis]
Length=159

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +LV FTC +CG+RT R IN  AY  GT+F+QC GC +YHK VDNL L
Sbjct  85   KLPRRNLLVEFTCDLCGERTKRLINRVAYEKGTIFLQCAGCQVYHKFVDNLGL  137



>ref|XP_010470860.1| PREDICTED: uncharacterized protein LOC104750716 [Camelina sativa]
Length=174

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  408  NPETGMEQISTFP-WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  584
            NPE   E  +     S+ TK PRR + V FTC  CG+RT R IN HAY  G VFVQC GC
Sbjct  85   NPEEESEDSAEGQVASVDTKLPRRSLQVEFTCDSCGERTKRLINRHAYERGLVFVQCAGC  144

Query  585  NIYHKLVDNL  614
              +HKLVDNL
Sbjct  145  LQHHKLVDNL  154



>ref|XP_010511887.1| PREDICTED: uncharacterized protein LOC104787925 isoform X1 [Camelina 
sativa]
Length=176

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  614
            S+ TK PRR + + FTC  CG+RT R IN HAY  G VFVQC GC  YHKLVDNL
Sbjct  102  SVDTKLPRRSLQLEFTCNSCGERTKRLINRHAYERGLVFVQCAGCLQYHKLVDNL  156



>ref|XP_010511888.1| PREDICTED: uncharacterized protein LOC104787925 isoform X2 [Camelina 
sativa]
Length=174

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  614
            S+ TK PRR + + FTC  CG+RT R IN HAY  G VFVQC GC  YHKLVDNL
Sbjct  100  SVDTKLPRRSLQLEFTCNSCGERTKRLINRHAYERGLVFVQCAGCLQYHKLVDNL  154



>ref|XP_002314899.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF01070.2| zinc finger family protein [Populus trichocarpa]
Length=169

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = +3

Query  312  PRMR--RWDWLSAANVRGWTTGSGM-EGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRM  482
            PR+R    + +     RG    SG+ +G S    + PE     ++    ++  K PRR +
Sbjct  48   PRLRISHTEAILPKRSRGLFVVSGLVDGNS---ETYPEVESNDLNEESATIDIKLPRRSL  104

Query  483  LVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  635
            LV FTC  CG+R+ R IN  AY  G VFVQC GC  YHKL DNL L   +D++
Sbjct  105  LVQFTCNECGERSQRLINRLAYERGLVFVQCAGCERYHKLADNLGLIVEYDLR  157



>ref|XP_006301666.1| hypothetical protein CARUB_v10022115mg [Capsella rubella]
 gb|EOA34564.1| hypothetical protein CARUB_v10022115mg [Capsella rubella]
Length=184

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  408  NPET-GMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  584
            NPE    + +     S+  K PRRR+ V FTC  CG+RT R IN HAY  G VFVQC GC
Sbjct  95   NPEEESNDSVEGQVASVDIKLPRRRLQVEFTCNSCGERTKRLINRHAYERGLVFVQCAGC  154

Query  585  NIYHKLVDNL  614
              +HKLVDNL
Sbjct  155  LQHHKLVDNL  164



>ref|XP_001777870.1| predicted protein [Physcomitrella patens]
 gb|EDQ57298.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            PRR  L+ FTC VC  RT R INP A+  GTV+VQC GC  YH+LVDNLNL  +
Sbjct  120  PRRSALLEFTCNVCKARTQRMINPEAFRRGTVYVQCGGCQAYHQLVDNLNLVKE  173



>ref|XP_010470865.1| PREDICTED: uncharacterized protein LOC104750723 [Camelina sativa]
Length=176

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  399  AGSNPETGMEQ-ISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  575
            A  NPE   +  +     S+ TK PRR + V FTC  CG+RT R IN HAY  G VFVQC
Sbjct  84   AKLNPEEESDDSVEGQVASVDTKLPRRSLQVEFTCDSCGERTKRLINRHAYERGLVFVQC  143

Query  576  CGCNIYHKLVDNL  614
             GC  +HKLVDNL
Sbjct  144  AGCLQHHKLVDNL  156



>ref|NP_177040.2| Zim17-type zinc finger protein [Arabidopsis thaliana]
 gb|AAD49972.1|AC008075_5 F24J5.3 [Arabidopsis thaliana]
 gb|AAG52044.1|AC011914_14 putative transcription factor; 86360-87167 [Arabidopsis thaliana]
 dbj|BAH30365.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34833.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
Length=170

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR + V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL L 
Sbjct  96   SIDIKLPRRSLQVEFTCNSCGERTKRLINRHAYEKGLVFVQCAGCLKHHKLVDNLGLI  153



>ref|XP_006644344.1| PREDICTED: uncharacterized protein C24H6.02c-like [Oryza brachyantha]
Length=151

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  438  TFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  617
            TF  +L    PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL 
Sbjct  77   TFDLNL----PRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCGGCQVYHKFVDNLG  132

Query  618  LF--HDMK  635
            L   +D++
Sbjct  133  LVVEYDLR  140



>ref|XP_010066771.1| PREDICTED: uncharacterized protein LOC104453845 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64808.1| hypothetical protein EUGRSUZ_G02379 [Eucalyptus grandis]
Length=166

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = +3

Query  375  GMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTD  554
             +EG S    ++P +     ST    L  + PRRR+LV FTC  CG+RT R +N  AY  
Sbjct  75   SLEGQSETDQASPPSD----STARLHLNLEHPRRRLLVQFTCNECGERTQRLVNKLAYER  130

Query  555  GTVFVQCCGCNIYHKLVDNLNLF  623
            G +FVQC GC  +HKLVDNL L 
Sbjct  131  GLIFVQCAGCLRHHKLVDNLGLV  153



>ref|XP_011008859.1| PREDICTED: mitochondrial protein import protein ZIM17 [Populus 
euphratica]
Length=171

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = +3

Query  411  PETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNI  590
            PE     ++    ++  K PRR +LV FTC  CG+R+ R IN  AY  G VFVQC GC  
Sbjct  83   PEVESNDLNEESATIDIKLPRRSLLVQFTCNECGERSQRLINRLAYERGLVFVQCAGCER  142

Query  591  YHKLVDNLNLF--HDMK  635
            YHKL DNL L   +D++
Sbjct  143  YHKLADNLGLIVEYDLR  159



>ref|XP_010925233.1| PREDICTED: uncharacterized protein LOC105047826 isoform X2 [Elaeis 
guineensis]
Length=170

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010925248.1| PREDICTED: uncharacterized protein LOC105047826 isoform X4 [Elaeis 
guineensis]
Length=168

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_008777543.1| PREDICTED: uncharacterized protein LOC103697463 isoform X2 [Phoenix 
dactylifera]
Length=179

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  105  PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  155



>ref|XP_010925225.1| PREDICTED: uncharacterized protein LOC105047826 isoform X1 [Elaeis 
guineensis]
Length=171

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_008777542.1| PREDICTED: uncharacterized protein LOC103697463 isoform X1 [Phoenix 
dactylifera]
Length=180

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  105  PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  155



>ref|XP_010925241.1| PREDICTED: uncharacterized protein LOC105047826 isoform X3 [Elaeis 
guineensis]
Length=169

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010681378.1| PREDICTED: DNL-type zinc finger protein isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  459  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            T+ PRR +LV FTC  CG+RT R IN  AY  GTVFVQC GC  +HKLVDNL L
Sbjct  84   TQLPRRSLLVQFTCDACGERTKRLINRLAYERGTVFVQCAGCLQHHKLVDNLGL  137



>ref|XP_011070860.1| PREDICTED: DNL-type zinc finger protein isoform X2 [Sesamum indicum]
Length=128

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  SGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  551
            S +   S       E  + + S    ++  K PRR +LV FTC  CG R+ R IN  AY 
Sbjct  27   SSLLEDSYEEYQETEQSVSKNSQQEAAIDLKLPRRSLLVTFTCGACGVRSQRLINRLAYE  86

Query  552  DGTVFVQCCGCNIYHKLVDNLNL  620
             G V+VQC GC+ YHKLVDNL L
Sbjct  87   RGLVYVQCSGCSKYHKLVDNLGL  109



>ref|XP_003518825.1| PREDICTED: DNL-type zinc finger protein-like [Glycine max]
 gb|KHN07723.1| DNL-type zinc finger protein [Glycine soja]
Length=161

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = +3

Query  375  GMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTD  554
            G+ G        PET   +  T   S+    PRR +LV FTC +CG+RT R +N  AY  
Sbjct  64   GLLGHDSGTAPQPETPNSEAGT---SIDLNLPRRSLLVQFTCNLCGERTERLVNRLAYER  120

Query  555  GTVFVQCCGCNIYHKLVDNLNLF  623
            G VFVQC GC  +HKLVDNL L 
Sbjct  121  GAVFVQCAGCLQHHKLVDNLGLI  143



>ref|XP_010262339.1| PREDICTED: uncharacterized protein LOC104600883 isoform X1 [Nelumbo 
nucifera]
Length=165

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  414  ETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIY  593
            E  ++  S    ++  K PRR +LV FTC  CG+R+ R +N  AY  GTVFVQC GC  +
Sbjct  78   ENYIDDTSLREPTIDIKLPRRSLLVQFTCNACGERSQRLVNRLAYERGTVFVQCAGCLQH  137

Query  594  HKLVDNLNLF  623
            HKLVDNL L 
Sbjct  138  HKLVDNLGLV  147



>ref|XP_007153312.1| hypothetical protein PHAVU_003G024500g [Phaseolus vulgaris]
 gb|ESW25306.1| hypothetical protein PHAVU_003G024500g [Phaseolus vulgaris]
Length=155

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = +3

Query  369  GSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAY  548
            G   E    P   N E G    +T   +L    PRR +LV FTC VCG+RT R +N  AY
Sbjct  61   GDDSETAPEPESPNSEAG----ATIDLNL----PRRSLLVQFTCGVCGERTKRLVNRLAY  112

Query  549  TDGTVFVQCCGCNIYHKLVDNLNLF  623
              G VFVQC GC  +HKLVDNL L 
Sbjct  113  ERGAVFVQCAGCLRHHKLVDNLGLI  137



>gb|AFW81000.1| putative tify domain/CCT motif transcription factor family protein 
[Zea mays]
Length=253

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  405  SNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  572
             +P   M  + T PWSL TKSPR  M VAF C VCGQ TTRAINPHAYT+ TVFVQ
Sbjct  152  KSPRWHMRVVLTLPWSLLTKSPRWHMRVAFACSVCGQCTTRAINPHAYTNETVFVQ  207



>ref|XP_002280593.1| PREDICTED: mitochondrial protein import protein ZIM17 [Vitis 
vinifera]
 emb|CBI27106.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            S+  K PRR ++V FTC  CG+RT R IN  A+  GTVFVQC GC  +HKLVDNL L
Sbjct  98   SIDIKLPRRSLIVQFTCDACGERTERLINRLAFERGTVFVQCAGCLQHHKLVDNLGL  154



>ref|XP_006391103.1| hypothetical protein EUTSA_v10019239mg [Eutrema salsugineum]
 gb|ESQ28389.1| hypothetical protein EUTSA_v10019239mg [Eutrema salsugineum]
Length=166

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AGSNPET-GMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  575
            +G NPE    +       S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC
Sbjct  74   SGLNPEEESKDSAEGQVASIDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQC  133

Query  576  CGCNIYHKLVDNLNLF  623
             GC  +HKLVDNL L 
Sbjct  134  AGCLRHHKLVDNLGLI  149



>ref|XP_006348591.1| PREDICTED: uncharacterized protein C24H6.02c-like [Solanum tuberosum]
Length=177

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +L  FTC  CG R+ R IN  AY  GTVF+QC GC+ YHKLVDNL L
Sbjct  106  KLPRRSLLATFTCNACGARSQRLINRLAYERGTVFIQCSGCSQYHKLVDNLGL  158



>ref|XP_010523289.1| PREDICTED: DNL-type zinc finger protein [Tarenaya hassleriana]
Length=170

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +3

Query  399  AGSNPETGME-----QISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  563
            +G NPE   E     QI++    L    PRR +LV FTC  CG+RT R +N  AY  G V
Sbjct  78   SGPNPEEESEDPKEGQIASTDIKL----PRRSLLVQFTCNSCGERTNRLVNRLAYERGLV  133

Query  564  FVQCCGCNIYHKLVDNLNLF  623
            FVQC GC  +HKLVDNL L 
Sbjct  134  FVQCGGCLRHHKLVDNLGLI  153



>ref|XP_004238981.1| PREDICTED: uncharacterized protein C24H6.02c [Solanum lycopersicum]
Length=177

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +L  FTC  CG R+ R IN  AY  GTVF+QC GC+ YHKLVDNL L
Sbjct  106  KLPRRSLLATFTCNACGARSQRLINRLAYERGTVFIQCSGCSQYHKLVDNLGL  158



>ref|XP_009791194.1| PREDICTED: uncharacterized protein C24H6.02c [Nicotiana sylvestris]
Length=178

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +LV FTC  CG R+ R IN  AY  GTVF+QC GC+ YHK VDNL L
Sbjct  107  KLPRRSLLVTFTCNACGVRSQRLINRLAYERGTVFIQCSGCSQYHKFVDNLGL  159



>gb|KEH29577.1| DNL zinc finger protein [Medicago truncatula]
Length=158

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 49/91 (54%), Gaps = 9/91 (10%)
 Frame = +3

Query  351  VRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRA  530
            V G      +  P +P  +N + G         S+    PRR +LV FTC +CG+RT R 
Sbjct  59   VHGLLGDDSVTSP-LPESNNSQPG--------ASIDLNLPRRSLLVQFTCDLCGERTERL  109

Query  531  INPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            +N  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  110  VNRLAYERGAVFVQCAGCQRHHKLVDNLGLI  140



>gb|KJB50817.1| hypothetical protein B456_008G188300 [Gossypium raimondii]
Length=148

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  459  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            TK PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  YHKL DNL L
Sbjct  85   TKLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCLQYHKLADNLGL  138



>ref|XP_008360068.1| PREDICTED: uncharacterized protein LOC103423766 [Malus domestica]
 ref|XP_008360187.1| PREDICTED: uncharacterized protein LOC103423888 [Malus domestica]
Length=177

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKLVDNL L
Sbjct  108  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLVDNLGL  158



>ref|XP_003569318.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
 ref|XP_010231998.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
 ref|XP_010231999.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
Length=148

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  635
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  78   KLPRRSLLVQFTCNKCDARTNRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLIVEYDLR  137



>ref|XP_009356516.1| PREDICTED: uncharacterized protein LOC103947335 [Pyrus x bretschneideri]
 ref|XP_009356525.1| PREDICTED: uncharacterized protein LOC103947342 [Pyrus x bretschneideri]
Length=177

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKLVDNL L
Sbjct  108  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLVDNLGL  158



>ref|XP_009614441.1| PREDICTED: uncharacterized protein C24H6.02c [Nicotiana tomentosiformis]
Length=173

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +LV FTC  CG R+ R IN  AY  GTVF+QC GC+ YHK VDNL L
Sbjct  102  KLPRRSLLVTFTCNACGVRSQRFINRLAYERGTVFIQCSGCSQYHKFVDNLGL  154



>emb|CDM83104.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  635
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  83   KLPRRSLLVQFTCNKCDARTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLIVEYDLR  142



>ref|XP_011070859.1| PREDICTED: uncharacterized protein LOC105156436 isoform X1 [Sesamum 
indicum]
Length=188

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  414  ETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIY  593
            E  + + S    ++  K PRR +LV FTC  CG R+ R IN  AY  G V+VQC GC+ Y
Sbjct  101  EQSVSKNSQQEAAIDLKLPRRSLLVTFTCGACGVRSQRLINRLAYERGLVYVQCSGCSKY  160

Query  594  HKLVDNLNL  620
            HKLVDNL L
Sbjct  161  HKLVDNLGL  169



>ref|NP_001239683.1| uncharacterized protein LOC100786955 [Glycine max]
 gb|ACU19834.1| unknown [Glycine max]
 gb|KHM98964.1| DNL-type zinc finger protein [Glycine soja]
Length=159

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            PRR +LV FTC +CG+RT R +N  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  90   PRRSLLVQFTCNLCGERTKRLVNRLAYERGAVFVQCAGCLRHHKLVDNLGLI  141



>ref|XP_010425752.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
 ref|XP_010425753.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
 ref|XP_010425754.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
Length=177

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  459  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
             K PRR + V FTC +CG+RT R IN HA+  G VFVQC GC  YHKL DNL +
Sbjct  106  IKLPRRSLQVEFTCNLCGERTKRLINRHAHERGLVFVQCAGCLQYHKLFDNLGV  159



>ref|XP_004505313.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X1 [Cicer arietinum]
 ref|XP_004505314.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X2 [Cicer arietinum]
 ref|XP_004505315.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X3 [Cicer arietinum]
Length=157

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            PRR +LV FTC +CG+RT + +N  AY  GT+F+QC GC  +HKLVDNL L 
Sbjct  86   PRRSLLVQFTCDLCGERTKKLVNRLAYERGTIFIQCAGCKRHHKLVDNLGLI  137



>ref|XP_006437770.1| hypothetical protein CICLE_v10032948mg [Citrus clementina]
 ref|XP_006484383.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Citrus 
sinensis]
 gb|ESR51010.1| hypothetical protein CICLE_v10032948mg [Citrus clementina]
 gb|KDO70144.1| hypothetical protein CISIN_1g031397mg [Citrus sinensis]
Length=160

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +3

Query  405  SNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  584
            SN E  +   S    ++  K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC
Sbjct  71   SNSEAELSD-SNKDATIDIKLPRRSLLVQFTCDGCGERTQRLINRLAYERGLVYVQCAGC  129

Query  585  NIYHKLVDNLNLF  623
              +HKLVDNL L 
Sbjct  130  LRHHKLVDNLGLV  142



>ref|XP_008339721.1| PREDICTED: uncharacterized protein LOC103402741 [Malus domestica]
Length=176

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  635
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L   +D++
Sbjct  107  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGLVVEYDLR  164



>ref|XP_008246043.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Prunus 
mume]
Length=182

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +3

Query  408  NPETGMEQISTFP---WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  578
            N ET  E     P    ++  K PRR +LV FTC +CG+RT R +N  AY  G ++VQC 
Sbjct  90   NFETDGELEQNIPNTDATIDIKIPRRSLLVKFTCDLCGERTDRLVNRLAYERGLIYVQCA  149

Query  579  GCNIYHKLVDNLNLF  623
            GC  +HKLVDNL L 
Sbjct  150  GCLKHHKLVDNLGLV  164



>emb|CDP00540.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +LV FTC +CG R+ + +N  AY  GTVFVQC GC  +HKLVDNL L
Sbjct  103  KLPRRSLLVKFTCNLCGSRSEKLVNRLAYERGTVFVQCSGCRQHHKLVDNLGL  155



>gb|KHG19418.1| DNL-type zinc finger [Gossypium arboreum]
Length=149

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  YHKL DNL L
Sbjct  87   KLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCLQYHKLADNLGL  139



>ref|XP_008361865.1| PREDICTED: uncharacterized protein LOC103425553 [Malus domestica]
Length=199

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L
Sbjct  130  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGL  180



>ref|XP_009355956.1| PREDICTED: uncharacterized protein LOC103946868 [Pyrus x bretschneideri]
Length=176

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  635
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L   +D++
Sbjct  107  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGLVVEYDLR  164



>ref|XP_010096705.1| DNL-type zinc finger protein [Morus notabilis]
 gb|EXB65557.1| DNL-type zinc finger protein [Morus notabilis]
Length=173

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 10/78 (13%)
 Frame = +3

Query  390  SVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  569
            S P  SN E  ++           K PRR +LV FTC +CG+RT R +N  AY  G ++V
Sbjct  88   SEPNDSNSEATVD----------IKLPRRSLLVQFTCDLCGERTQRLVNRLAYERGLIYV  137

Query  570  QCCGCNIYHKLVDNLNLF  623
            QC GC  +HKLVDNL L 
Sbjct  138  QCAGCLQHHKLVDNLGLV  155



>dbj|BAJ89579.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=158

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  635
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  88   KLPRRSLLVQFTCNKCDARTERLINRVAYERGTVFLQCAGCQVYHKFVDNLGLIVEYDLR  147



>ref|XP_010227814.1| PREDICTED: DNL-type zinc finger protein-like [Brachypodium distachyon]
Length=148

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            K PRR +LV FTC  C  RT R IN  A+  GTVF+QC GC +YHK VDNL L 
Sbjct  78   KLPRRSLLVQFTCNKCDARTKRLINRVAHERGTVFLQCAGCQVYHKFVDNLGLI  131



>gb|EMT29434.1| hypothetical protein F775_05239 [Aegilops tauschii]
Length=149

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--  623
            S   K PRR +LV FTC  C  RT R IN   Y  GTVF+QC GC +YHK VDNL L   
Sbjct  75   SFDIKLPRRSLLVQFTCNKCDARTKRLINRVGYERGTVFLQCAGCQVYHKFVDNLGLIVE  134

Query  624  HDMK  635
            +D++
Sbjct  135  YDLR  138



>ref|XP_005847953.1| hypothetical protein CHLNCDRAFT_52093 [Chlorella variabilis]
 gb|EFN55851.1| hypothetical protein CHLNCDRAFT_52093 [Chlorella variabilis]
Length=288

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  459  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  632
            +K PRR   + FTC +CG+    A+NPHA+  G+VF +C GC   HKL DNLN+FH++
Sbjct  202  SKHPRRTQQLRFTCNLCGEVNDAAVNPHAWKAGSVFARCQGCTAVHKLKDNLNIFHEL  259



>ref|XP_007046358.1| Zim17-type zinc finger protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02190.1| Zim17-type zinc finger protein, putative isoform 1 [Theobroma 
cacao]
Length=143

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  408  NPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  587
            +P   M+  S    ++  K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC 
Sbjct  64   DPHENMKN-SNSDATIDIKLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCL  122

Query  588  IYHKLVDNLNL  620
             YHKL DNL L
Sbjct  123  QYHKLADNLGL  133



>ref|XP_006858707.1| hypothetical protein AMTR_s00066p00105400 [Amborella trichopoda]
 gb|ERN20174.1| hypothetical protein AMTR_s00066p00105400 [Amborella trichopoda]
Length=186

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR ++V FTC  CG R+ R IN  AY  GTVF+QC GC  YHK VDNL L
Sbjct  119  PRRSLMVQFTCDACGVRSQRIINRVAYERGTVFLQCSGCEQYHKFVDNLGL  169



>ref|XP_009127663.1| PREDICTED: uncharacterized protein LOC103852518 isoform X1 [Brassica 
rapa]
Length=160

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L 
Sbjct  85   SVDIKLPRRSLLVEFSCNSCGERTKRLINQLAYERGLVFVQCGGCLQHHQLVDNLGLI  142



>ref|XP_009127664.1| PREDICTED: uncharacterized protein LOC103852518 isoform X2 [Brassica 
rapa]
Length=158

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L 
Sbjct  83   SVDIKLPRRSLLVEFSCNSCGERTKRLINQLAYERGLVFVQCGGCLQHHQLVDNLGLI  140



>emb|CDY54500.1| BnaA02g35640D [Brassica napus]
Length=164

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L 
Sbjct  89   SVDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLQHHQLVDNLGLI  146



>ref|XP_007223547.1| hypothetical protein PRUPE_ppa012145mg [Prunus persica]
 gb|EMJ24746.1| hypothetical protein PRUPE_ppa012145mg [Prunus persica]
Length=182

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  +HKLVDNL L 
Sbjct  113  PRRSLLVKFTCDLCGERTDRLVNRLAYERGLIYVQCAGCLKHHKLVDNLGLV  164



>ref|XP_004297161.1| PREDICTED: uncharacterized protein LOC101312048 [Fragaria vesca 
subsp. vesca]
Length=166

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  620
            PRR +LV FTC +C +RT++ +N  AY  G ++VQC GC  YHKLVDNL L
Sbjct  97   PRRSLLVKFTCDLCNERTSKLVNRLAYEKGLIYVQCAGCLKYHKLVDNLGL  147



>emb|CDX81538.1| BnaC02g18420D [Brassica napus]
Length=164

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L 
Sbjct  89   SVDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLQHHQLVDNLGLI  146



>emb|CDY28109.1| BnaC06g02900D [Brassica napus]
 emb|CDY08090.1| BnaA06g16360D [Brassica napus]
Length=65

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  462  KSPRRRML-VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  614
            K PRRR L V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL
Sbjct  11   KLPRRRSLQVEFSCNSCGERTKRLINRLAYERGIVFVQCGGCLKHHKLVDNL  62



>emb|CDX95993.1| BnaA07g27380D [Brassica napus]
Length=165

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR + V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  90   SVDIKLPRRSLQVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGLI  147



>emb|CDY38613.1| BnaC06g30360D [Brassica napus]
Length=164

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR + V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  89   SVDIKLPRRSLQVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGLI  146



>gb|EYU17552.1| hypothetical protein MIMGU_mgv1a023730mg [Erythranthe guttata]
Length=154

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 55/103 (53%), Gaps = 32/103 (31%)
 Frame = +3

Query  336  LSAANVRGWTTGSGMEG-PSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCG  512
            LSAANVRGWTTGSG+ G P+ PA +  + G                              
Sbjct  51   LSAANVRGWTTGSGIYGRPTCPAPAGSDMG------------------------------  80

Query  513  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  641
            +RTTRA+NPHAYTDGTVFVQ   C+    +++ L+L   MKCY
Sbjct  81   RRTTRAVNPHAYTDGTVFVQVRICHCVMCIIE-LHLLLRMKCY  122



>ref|XP_009105422.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Brassica 
rapa]
Length=165

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            S+  K PRR + V F+C  CG RT R IN  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  90   SVDIKLPRRSLQVEFSCNSCGVRTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGLI  147



>ref|XP_003063279.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52415.1| predicted protein [Micromonas pusilla CCMP1545]
Length=209

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  444  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            P ++    P+RR  + FTC  C  R+T+ +NP AY  GT+FVQC  C ++HK+VDNL + 
Sbjct  101  PDAIQIPMPKRRAQLTFTCDKCEARSTKMVNPDAYKRGTMFVQCPNCEVWHKIVDNLGMI  160



>gb|KHJ41186.1| ribosomal protein S15 [Trichuris suis]
Length=290

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  444  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            P +L T +   +ML+A+TCKVCG R ++ I+   Y +G V VQC GC  YH + DNL  F
Sbjct  35   PQALGTIASSGKMLLAYTCKVCGSRQSKLISKVGYREGVVLVQCSGCANYHIIADNLGWF  94

Query  624  HDM  632
             D+
Sbjct  95   SDL  97



>emb|CCK72609.1| hypothetical protein KNAG_0K02460 [Kazachstania naganishii CBS 
8797]
Length=176

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +3

Query  372  SGMEGPSVPAGSN-PETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAY  548
            +G + P+V + SN P    ++ S  P S      + ++++AFTCK C  R++  I+  AY
Sbjct  39   NGPDKPAVTSRSNTPAAADKKGSVGPSSAKLAMDKPQLMIAFTCKKCDTRSSHTISKQAY  98

Query  549  TDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            T GTV +QC GC   H + D+L +F D
Sbjct  99   TGGTVLIQCPGCQNRHLIADHLKIFAD  125



>gb|EXX72907.1| Zim17p [Rhizophagus irregularis DAOM 197198w]
Length=212

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            P  R+++AFTCKVC  R+T+ ++ HAY  G V +QC  CN +H + D+L  F D
Sbjct  89   PNTRLMIAFTCKVCSLRSTKTMSKHAYNHGVVIIQCSSCNNHHLIADHLGWFRD  142



>gb|EIF45938.1| zim17p [Brettanomyces bruxellensis AWRI1499]
Length=189

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  480  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            +L+AFTCK CG R++  I+  AY  G+V VQC GC   H + D+LN+FHD K
Sbjct  74   LLLAFTCKKCGTRSSHIISKQAYLTGSVLVQCPGCKNRHLIADHLNIFHDGK  125



>emb|CDX97891.1| BnaC04g40480D [Brassica napus]
Length=66

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +3

Query  462  KSPRRRML-VAFTCKVCGQR-TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  614
            K PRRR L V F+C  CG+R T R IN  AY  G VFVQC GC  +HKLV+NL
Sbjct  11   KLPRRRSLQVEFSCNSCGERRTKRLINRLAYERGLVFVQCGGCLKHHKLVENL  63



>emb|CEG63113.1| Putative Zf-DNL-domain-containing protein [Rhizopus microsporus]
Length=192

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSK  130



>emb|CEI97298.1| Putative Zf-DNL-domain-containing protein [Rhizopus microsporus]
Length=192

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSK  130



>dbj|BAJ23062.1| hypothetical protein [Pseudocentrotus depressus]
Length=196

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            ++ +AFTCKVCG RT R+I+ HAY  G V V+C GC+  H + DNL+ F
Sbjct  102  KLHLAFTCKVCGMRTARSISKHAYEKGVVIVKCSGCDNNHLIADNLDWF  150



>emb|CEG80750.1| hypothetical protein RMATCC62417_15046 [Rhizopus microsporus]
Length=181

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSK  130



>emb|CEI95525.1| Putative Piso0_002320 protein [Rhizopus microsporus]
Length=192

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSK  130



>ref|XP_005844772.1| hypothetical protein CHLNCDRAFT_138626 [Chlorella variabilis]
 gb|EFN52670.1| hypothetical protein CHLNCDRAFT_138626 [Chlorella variabilis]
Length=152

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            PRR +LV FTC +C  R+ R +NP A+  G V  QC  C  +HKL D  NL  +++
Sbjct  90   PRRSLLVKFTCNLCSGRSERLVNPVAWNKGMVIAQCQHCQAWHKLADAANLVEEIR  145



>dbj|GAN02263.1| conserved hypothetical protein [Mucor ambiguus]
Length=199

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            S + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL  F D
Sbjct  76   SKQHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNLGWFKD  130



>ref|XP_011397348.1| Fructose-1-phosphate phosphatase YqaB [Auxenochlorella protothecoides]
 gb|KFM24460.1| Fructose-1-phosphate phosphatase YqaB [Auxenochlorella protothecoides]
Length=326

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  459  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            T   RR   V FTC +CG + T+ +NPHA+  G+VF +C GC   HKL DNL +F +
Sbjct  236  TNHARRTRKVRFTCNLCGTQNTKRVNPHAWHAGSVFARCAGCQGVHKLQDNLEVFFE  292



>ref|XP_005083712.1| PREDICTED: DNL-type zinc finger protein [Mesocricetus auratus]
Length=173

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 52/116 (45%), Gaps = 24/116 (21%)
 Frame = +3

Query  288  TRAWYRSFPRMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKS  467
            + A  R+  R R W W       GW + S  +G      S P   + ++    + L    
Sbjct  29   SEARLRTAERRRGWAW-------GWRSSSSAQG------SGPGAALGRVEADRYQLV---  72

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
                    +TCKVCG R+++ I+  AY  G V V C GC  +H + DNL  F D+K
Sbjct  73   --------YTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLK  120



>gb|EPB86614.1| hypothetical protein HMPREF1544_06590 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=176

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            + + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL  F D
Sbjct  53   NSKHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNLGWFKD  107



>emb|CDW52158.1| Coq4 and Ribosomal S13 N and Ribosomal S15 and zf-DNL domain 
containing protein [Trichuris trichiura]
Length=488

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = +3

Query  456  FTKSPRR--------RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  611
            F  SP+R        +ML+A+TCKVCG R ++ I+   Y  G V VQC GC  YH + DN
Sbjct  31   FCSSPQRVGTIASSGKMLLAYTCKVCGSRQSKLISKVGYHQGVVLVQCSGCANYHIIADN  90

Query  612  LNLFHDM  632
            L  F D+
Sbjct  91   LGWFSDL  97



>ref|XP_007637235.1| PREDICTED: LOW QUALITY PROTEIN: DNL-type zinc finger protein 
isoform X2 [Cricetulus griseus]
Length=156

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (46%), Gaps = 24/116 (21%)
 Frame = +3

Query  288  TRAWYRSFPRMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKS  467
            + A  R+  R R W W       GW + S  +G      S P   + ++    + L    
Sbjct  29   SEARLRTAERRRGWAW-------GWRSSSTAQG------SGPVAALGRVEADRYQLV---  72

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
                    +TCKVCG R++++I+  AY  G V V C GC  +H + DNL  F D+K
Sbjct  73   --------YTCKVCGTRSSKSISKLAYHHGVVIVTCPGCQNHHIIADNLGWFSDLK  120



>ref|NP_081104.1| DNL-type zinc finger protein isoform 1 [Mus musculus]
 sp|Q9D113.1|DNLZ_MOUSE RecName: Full=DNL-type zinc finger protein; AltName: Full=Hsp70-escort 
protein 1; Short=HEP1; AltName: Full=mtHsp70-escort 
protein; Flags: Precursor [Mus musculus]
 dbj|BAB23162.1| unnamed protein product [Mus musculus]
 dbj|BAE24931.1| unnamed protein product [Mus musculus]
 gb|AAI39335.1| DNA segment, Chr 2, Brigham & Women's Genetics 1335 expressed 
[Mus musculus]
 gb|AAI39334.1| D2Bwg1335e protein [Mus musculus]
Length=177

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = +3

Query  306  SFPRMRRWDW----LSAANVRGWTTG--SGMEGPSVPAGSNPETGMEQISTFPWSLFTKS  467
            S PR R WD      +A  +RGW  G  SG    S   GS     + ++    + L    
Sbjct  21   SGPR-RLWDLGARLKTAERLRGWAWGWASGWRSSSSAPGSGRAAALGRVEADHYQLV---  76

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
                    +TCKVCG R+++ I+  AY  G V V C GC  +H + DNL+ F D+K
Sbjct  77   --------YTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLK  124



>gb|ERE70542.1| DNL-type zinc finger protein [Cricetulus griseus]
Length=198

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (46%), Gaps = 24/116 (21%)
 Frame = +3

Query  288  TRAWYRSFPRMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKS  467
            + A  R+  R R W W       GW + S  +G      S P   + ++    + L    
Sbjct  54   SEARLRTAERRRGWAW-------GWRSSSTAQG------SGPVAALGRVEADRYQLV---  97

Query  468  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
                    +TCKVCG R++++I+  AY  G V V C GC  +H + DNL  F D+K
Sbjct  98   --------YTCKVCGTRSSKSISKLAYHHGVVIVTCPGCQNHHIIADNLGWFSDLK  145



>ref|XP_008191756.1| PREDICTED: DNL-type zinc finger protein-like [Tribolium castaneum]
 gb|EFA01426.1| hypothetical protein TcasGA2_TC030565 [Tribolium castaneum]
Length=160

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  632
            ++++ FTCKVC  R T+ I+  AY  G V V+C GCN  H + DNLN F D+
Sbjct  72   KLMLGFTCKVCSARNTKFISKVAYQKGVVIVKCSGCNNNHLIADNLNWFTDL  123



>ref|XP_001421744.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00038.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=181

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  471  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            RRR+ + FTC  C  RT R INP     GT++VQC  C ++H++VDNL L  D
Sbjct  104  RRRVQMTFTCNKCEGRTMRMINPEVLERGTMWVQCGECEVWHQIVDNLGLIFD  156



>emb|CDY36477.1| BnaC03g48360D [Brassica napus]
Length=133

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +3

Query  450  SLFTKSPRRRML-VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  614
            S+  K PRRR L V F+   CG RT R IN  AY  G VFVQC GC  +HKLVDNL
Sbjct  75   SVDIKLPRRRSLQVEFSYNSCGDRTKRLINRLAYECGLVFVQCGGCLKHHKLVDNL  130



>emb|CEP08401.1| hypothetical protein [Parasitella parasitica]
Length=192

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            + + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL  F D
Sbjct  70   NSQHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNLGWFKD  124



>ref|XP_006687723.1| zf-DNL-domain-containing protein [Candida tenuis ATCC 10573]
 gb|EGV61553.1| zf-DNL-domain-containing protein [Candida tenuis ATCC 10573]
Length=178

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            ++++AFTCK C  R++   +  AYT GTV +QC GC   H + DNL +F D K
Sbjct  64   QLMIAFTCKKCDTRSSHTFSKQAYTKGTVAIQCPGCKNRHLIADNLKIFKDDK  116



>ref|XP_002495780.1| ZYRO0C02882p [Zygosaccharomyces rouxii]
 emb|CAR26847.1| ZYRO0C02882p [Zygosaccharomyces rouxii]
Length=152

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  480  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            M++AFTCK C  R++  ++  AYT GTV +QC  C + H + D+L +F D
Sbjct  55   MMIAFTCKKCNDRSSHTMSKQAYTKGTVLIQCPSCQVRHLIADHLKIFSD  104



>ref|XP_003083615.1| ETCHED1 protein (ISS) [Ostreococcus tauri]
 emb|CAL58164.1| Mitochondrial import protein TIM15 [Ostreococcus tauri]
Length=184

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  471  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            RRR+ + FTC  C  RT R INP     GT++VQC  C ++H++VDNL L  D
Sbjct  107  RRRVQMTFTCNKCEGRTMRMINPDVLERGTMWVQCGECEVWHQIVDNLGLIFD  159



>emb|CDH58781.1| hypothetical protein RO3G_11646 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=187

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
             P+++ML+ FTC+VC +R+   ++  AYT G V ++C GC   H + DNL  F D
Sbjct  65   DPKQQMLIGFTCEVCKERSHHVMSKLAYTKGVVLIECPGCKNRHLIADNLGWFRD  119



>emb|CEP62412.1| LALA0S05e05072g1_1 [Lachancea lanzarotensis]
Length=183

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K+ +  M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D
Sbjct  60   KTDKPAMMIAFTCKKCNTRSSHTMSKQAYTGGTVLIQCPGCKSRHLIADHLKIFSD  115



>emb|CDS07381.1| hypothetical protein LRAMOSA01330 [Absidia idahoensis var. thermophila]
Length=186

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
             P+++ML+ FTC+VC +R+   ++  AYT G V ++C GC   H + DNL  F D
Sbjct  64   DPKQQMLIGFTCEVCKERSHHVMSKLAYTKGVVLIECPGCKNRHLIADNLGWFRD  118



>ref|XP_520365.2| PREDICTED: DNL-type zinc finger protein [Pan troglodytes]
Length=178

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 24/106 (23%)
 Frame = +3

Query  315  RMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAF  494
            R R W W       GW   S  +GP       P   + ++    + L            +
Sbjct  38   RRRAWAW-------GWRRSSSEQGP------GPAAALGRVEAAHYQLV-----------Y  73

Query  495  TCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  632
            TCKVCG R+++ I+  AY  G V V C GC  +H + DNL  F D+
Sbjct  74   TCKVCGSRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDL  119



>ref|XP_002555014.1| KLTH0F19052p [Lachancea thermotolerans]
 emb|CAR24577.1| KLTH0F19052p [Lachancea thermotolerans CBS 6340]
Length=180

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            ++++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D
Sbjct  64   QLMIAFTCKKCNNRSSHTMSKQAYTKGTVLIQCPGCKSRHLIADHLKIFSD  114



>gb|AGO11609.1| AaceriADL173Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=190

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  480  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D
Sbjct  71   MMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQCPGCKNRHLIADHLKIFRD  120



>ref|XP_005408560.1| PREDICTED: DNL-type zinc finger protein-like [Chinchilla lanigera]
Length=178

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 29/121 (24%)
 Frame = +3

Query  285  MTRAWY-RSFP----RMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPW  449
            + R W  RS P    R R W W     V+GW          + +G+   TG+ ++    +
Sbjct  23   LRRLWVPRSHPEVAERRRAWAW-----VQGWR--------HLSSGAEAATGLGRVEAAHY  69

Query  450  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
             L            +TCKVCG R+++ I+  AY  G V V C GC  +H + DNL  F D
Sbjct  70   QLV-----------YTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSD  118

Query  630  M  632
            +
Sbjct  119  L  119



>gb|EIE86935.1| hypothetical protein RO3G_11646 [Rhizopus delemar RA 99-880]
Length=188

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            +  +R+ML+ FTCKVC +R+   ++  AYT G V +QC  C   H + DNL  F D K
Sbjct  67   QESKRQMLIGFTCKVCEERSHHVMSRLAYTKGVVLIQCPSCKNRHLIADNLGWFKDSK  124



>ref|XP_004199776.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
 emb|CCE81657.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
Length=187

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            +M++AFTC VC  R++   +  AY  G+V +QC GC   H + DNL +F D K
Sbjct  67   QMMIAFTCTVCDTRSSHVFSKQAYQTGSVLIQCPGCKNRHLIADNLKIFKDNK  119



>ref|XP_004198925.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
 emb|CCE82588.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
Length=187

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            +M++AFTC VC  R++   +  AY  G+V +QC GC   H + DNL +F D K
Sbjct  67   QMMIAFTCTVCDTRSSHVFSKQAYQTGSVLIQCPGCKNRHLIADNLKIFKDNK  119



>ref|XP_003510907.1| PREDICTED: DNL-type zinc finger protein isoform X1 [Cricetulus 
griseus]
Length=188

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            P +   +    R  + +TCKVCG R++++I+  AY  G V V C GC  +H + DNL  F
Sbjct  72   PVAALGRVEADRYQLVYTCKVCGTRSSKSISKLAYHHGVVIVTCPGCQNHHIIADNLGWF  131

Query  624  HDMK  635
             D+K
Sbjct  132  SDLK  135



>ref|XP_003688733.1| hypothetical protein TPHA_0P01410 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE66299.1| hypothetical protein TPHA_0P01410 [Tetrapisispora phaffii CBS 
4417]
Length=182

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            K  ++++++AFTC  C  R++  I+  AYT GTV VQC GC   H + D+L +F D K
Sbjct  64   KVEQQKLMLAFTCNKCNTRSSHTISKQAYTSGTVMVQCPGCKNRHLIADHLKIFDDNK  121



>ref|XP_002614239.1| hypothetical protein CLUG_05725 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ41597.1| hypothetical protein CLUG_05725 [Clavispora lusitaniae ATCC 42720]
Length=172

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            ++++AFTCK C  R++   +  AYT G+V +QC GC   H + DNL +F D
Sbjct  58   QLMIAFTCKKCETRSSHVFSKQAYTKGSVLIQCPGCKGRHLIADNLKIFRD  108



>ref|XP_003725494.1| PREDICTED: DNL-type zinc finger protein-like [Strongylocentrotus 
purpuratus]
Length=196

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            ++ +AFTCKVCG RT R+I+  AY  G V V+C GC   H + DNL+ F
Sbjct  102  KLHLAFTCKVCGMRTARSISKQAYEKGVVIVKCGGCENNHLIADNLDWF  150



>ref|NP_983923.1| ADL173Cp [Ashbya gossypii ATCC 10895]
 gb|AAS51747.1| ADL173Cp [Ashbya gossypii ATCC 10895]
 gb|AEY96044.1| FADL173Cp [Ashbya gossypii FDAG1]
Length=190

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  480  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D
Sbjct  71   MMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQCPGCKNRHLIADHLKIFRD  120



>gb|EGW12770.1| DNL-type zinc finger protein [Cricetulus griseus]
Length=163

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (48%), Gaps = 13/94 (14%)
 Frame = +3

Query  354  RGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  533
            RGW  G      S   GS P   + ++    + L            +TCKVCG R++++I
Sbjct  30   RGWAWG--WRSSSTAQGSGPVAALGRVEADRYQLV-----------YTCKVCGTRSSKSI  76

Query  534  NPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            +  AY  G V V C GC  +H + DNL  F D+K
Sbjct  77   SKLAYHHGVVIVTCPGCQNHHIIADNLGWFSDLK  110



>ref|XP_002493869.1| Heat shock protein with a zinc finger motif [Komagataella pastoris 
GS115]
 emb|CAY71690.1| Heat shock protein with a zinc finger motif [Komagataella pastoris 
GS115]
 emb|CCA40707.1| DNL-type zinc finger protein [Komagataella pastoris CBS 7435]
Length=169

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            ++++AFTCK C  R++   +  AYT+GTV +QC GC   H + D+L +F D +
Sbjct  53   QLMIAFTCKKCDTRSSHTFSKQAYTNGTVLIQCPGCKNRHLIADHLKIFSDER  105



>ref|XP_003644612.1| hypothetical protein Ecym_2037 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET37795.1| Hypothetical protein Ecym_2037 [Eremothecium cymbalariae DBVPG#7215]
Length=193

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +3

Query  420  GMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHK  599
            G E+   F      K  +  +++AFTCK C  R++ +++  AYT GTV +QC GC   H 
Sbjct  52   GAEKRGDFKHVGSIKIDKPLLMIAFTCKKCNTRSSHSMSKQAYTKGTVLIQCPGCTNRHL  111

Query  600  LVDNLNLFHD  629
            + D+L +F+D
Sbjct  112  IADHLKIFND  121



>ref|XP_008482374.1| PREDICTED: DNL-type zinc finger protein-like [Diaphorina citri]
Length=198

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  471  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            + ++ +A+TCKVCG R +  I+ H+Y  G V V+C GC+  H + DNL  F D+K
Sbjct  107  KHKLKLAYTCKVCGTRNSHLISKHSYEKGVVIVKCEGCSNNHLIADNLKWFTDLK  161



>ref|NP_001074318.1| DNL-type zinc finger protein [Homo sapiens]
 sp|Q5SXM8.1|DNLZ_HUMAN RecName: Full=DNL-type zinc finger protein; AltName: Full=Hsp70-escort 
protein 1; Short=HEP1; AltName: Full=mtHsp70-escort 
protein; Flags: Precursor [Homo sapiens]
 gb|AAI46916.1| DNL-type zinc finger [Homo sapiens]
 gb|AAI46925.1| DNL-type zinc finger [Homo sapiens]
Length=178

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 24/106 (23%)
 Frame = +3

Query  315  RMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAF  494
            R R W W       GW   S  +GP       P   + ++    + L            +
Sbjct  38   RRRAWAW-------GWRRSSSEQGP------GPAAALGRVEAAHYQLV-----------Y  73

Query  495  TCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  632
            TCKVCG R+++ I+  AY  G V V C GC  +H + DNL  F D+
Sbjct  74   TCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDL  119



>pdb|2E2Z|A Chain A, Solution Nmr Structure Of Yeast Tim15, Co-Chaperone 
Of Mitochondrial Hsp70
Length=100

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  9    KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  59



>emb|CBK20169.2| Zim17 [Blastocystis hominis]
Length=136

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = +3

Query  390  SVPA-GSNPETGMEQI---STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDG  557
            SVP    NP++  E        P    +K+    M++ FTCKVC  R+ R ++  AY  G
Sbjct  19   SVPVPEKNPDSKEEDARSREVLPSIPGSKTTDDVMIIVFTCKVCNTRSARKMSKEAYNHG  78

Query  558  TVFVQCCGCNIYHKLVDNLNLFHD  629
             V ++C GCN  H + D+L  F D
Sbjct  79   VVLIRCPGCNNLHLIADHLGYFDD  102



>emb|CDH12975.1| related to Mitochondrial protein import protein ZIM17 [Zygosaccharomyces 
bailii ISA1307]
Length=163

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  480  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            +++AFTCK C  R++  ++  AYT+GTV +QC  C+  H + D+L +F+D
Sbjct  57   LMIAFTCKKCNHRSSHTMSKQAYTNGTVLIQCPTCHARHLIADHLKIFND  106



>ref|XP_004207823.1| PREDICTED: DNL-type zinc finger protein-like [Hydra vulgaris]
Length=181

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            ++ +++TCKVC  R+T+ IN  AY  G V ++C GC+  H + DNL  F+D K
Sbjct  78   KLSLSYTCKVCNTRSTKIINKQAYDTGVVLIKCDGCSNLHLIADNLGWFYDQK  130



>gb|ABK24010.1| unknown [Picea sitchensis]
Length=213

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = +3

Query  381  EGPSVPAGSNPETGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  560
            EG S    S P    + +    +S    S R  + +A+TC+VC  R+ + +N  +Y  G 
Sbjct  95   EGVSAMEISKPNAKNDSVEFTAFSNLNASKRHNLAMAYTCRVCETRSVKTMNRESYEKGV  154

Query  561  VFVQCCGCNIYHKLVDNLNLF  623
            V V+C GCN  H + D+L  F
Sbjct  155  VIVRCSGCNNLHLIADHLGWF  175



>ref|NP_001124462.1| DNL-type zinc finger protein [Rattus norvegicus]
 gb|EDL93510.1| rCG45717, isoform CRA_c [Rattus norvegicus]
Length=173

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 53/114 (46%), Gaps = 24/114 (21%)
 Frame = +3

Query  294  AWYRSFPRMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQISTFPWSLFTKSPR  473
            A  ++  R+R W W       GW + S     S P GS     + ++    + L      
Sbjct  31   ARLKTAKRLRGWAW-------GWRSSS-----SAP-GSEHAAALGRVKADHYQLV-----  72

Query  474  RRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
                  +TCKVCG R+++ I+  AY  G V V C GC  +H + DNL+ F D+K
Sbjct  73   ------YTCKVCGTRSSKHISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLK  120



>ref|XP_315385.4| AGAP005377-PA [Anopheles gambiae str. PEST]
 gb|EAA11296.4| AGAP005377-PA [Anopheles gambiae str. PEST]
Length=143

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = +3

Query  417  TGMEQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYH  596
            T +E   + P     +   R+M + +TCKVC  R    I+  AY  G V V C GC+ +H
Sbjct  49   TALEAQQSGPNEEVGRIQPRKMNLIYTCKVCNHRNMHMISKQAYEKGVVIVTCDGCSNHH  108

Query  597  KLVDNLNLFHDM  632
             + DNLN F D+
Sbjct  109  LIADNLNWFTDL  120



>ref|XP_002010480.1| GI14660 [Drosophila mojavensis]
 gb|EDW07797.1| GI14660 [Drosophila mojavensis]
Length=187

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  471  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL LF +
Sbjct  98   QRRMEIVYLCKLCNTRNTKTISEEAYNSGVVILQCDGCAVDHLIKDNLGLFSN  150



>gb|ETN66741.1| hypothetical protein AND_001480 [Anopheles darlingi]
Length=136

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  474  RRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  632
            R+M + +TCKVC  R T  I+  AY  G + V C GC  +H + DNLN F D+
Sbjct  57   RKMTLVYTCKVCQHRNTNTISKQAYEKGVIIVTCDGCRNHHLIADNLNWFTDL  109



>gb|AJT21325.1| Zim17p [Saccharomyces cerevisiae YJM1341]
Length=174

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>gb|EEH05800.1| DNL zinc finger domain-containing protein [Histoplasma capsulatum 
G186AR]
Length=219

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+F D K
Sbjct  81   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCRNRHVISDHLNIFMDKK  138



>ref|XP_001992524.1| GH24157 [Drosophila grimshawi]
 gb|EDV92231.1| GH24157 [Drosophila grimshawi]
Length=181

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  471  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  623
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL LF
Sbjct  102  QRRMEIVYMCKLCNTRNTKTISEEAYYSGVVILQCDGCAVQHLIKDNLGLF  152



>ref|XP_002626197.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76986.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
SLH14081]
Length=228

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+F D K
Sbjct  90   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCKNRHVISDHLNIFMDKK  147



>ref|XP_461045.2| DEHA2F15774p [Debaryomyces hansenii CBS767]
 emb|CAG89419.2| DEHA2F15774p [Debaryomyces hansenii CBS767]
Length=183

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            ++++AFTCK C  R++   +  +Y  GTV +QC GC   H + DNL +F D K
Sbjct  63   QLMIAFTCKKCDTRSSHTFSKQSYQKGTVLIQCPGCKNRHLIADNLKIFKDNK  115



>gb|EEQ92563.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
ER-3]
 gb|EGE86745.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL30397.1| hypothetical protein BDFG_07086 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30398.1| hypothetical protein, variant 1 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30399.1| hypothetical protein, variant 2 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30400.1| hypothetical protein, variant 3 [Blastomyces dermatitidis ATCC 
26199]
Length=228

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  635
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+F D K
Sbjct  90   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCKNRHVISDHLNIFMDKK  147



>ref|XP_002908206.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61289.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=178

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +3

Query  258  TSPISDPIPMTRAWYRSFPRMRRWDWLSAANVRGWTTGSGME--GPSVPAGSNPETG-ME  428
            +S  S P+ ++ A   SF  + R D       R + T SG +   P  PA S+  T    
Sbjct  26   SSSASPPLLISSA---SFQHLHRHD-------RCFVTESGNDDSAPVSPAISSESTASAT  75

Query  429  QISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  608
            + S+ P     +SP  + ++ +TC VC  R+ + I+ HAY +G V V+C GC   H + D
Sbjct  76   ECSSAPG---VESPGEKFVMIYTCSVCETRSAKTISKHAYYNGVVLVRCPGCENQHLVAD  132

Query  609  NLNLFHD  629
             L  F D
Sbjct  133  RLGWFED  139



>ref|XP_008890456.1| hypothetical protein PPTG_00743 [Phytophthora parasitica INRA-310]
 gb|ETI56701.1| hypothetical protein F443_00878 [Phytophthora parasitica P1569]
 gb|ETK96456.1| hypothetical protein L915_00819 [Phytophthora parasitica]
 gb|ETL49812.1| hypothetical protein L916_00809 [Phytophthora parasitica]
 gb|ETM02877.1| hypothetical protein L917_00777 [Phytophthora parasitica]
 gb|ETM56177.1| hypothetical protein L914_00807 [Phytophthora parasitica]
 gb|ETN24391.1| hypothetical protein PPTG_00743 [Phytophthora parasitica INRA-310]
 gb|ETO85366.1| hypothetical protein F444_00886 [Phytophthora parasitica P1976]
 gb|ETP26462.1| hypothetical protein F441_00854 [Phytophthora parasitica CJ01A1]
 gb|ETP54459.1| hypothetical protein F442_00832 [Phytophthora parasitica P10297]
Length=186

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 13/127 (10%)
 Frame = +3

Query  252  TGTSPISDPIPMTRAWYRSFPRMRRWDWLSAANVRGWTTGSG-MEGPSVPAGSNPETGME  428
            T +S  S  + ++RA   SFP +        ++ R + T SG +E P  P  S+  T   
Sbjct  33   TASSSASHLLHVSRA---SFPHLH-------SHSRCFATQSGDIEPPVSPTTSSESTV--  80

Query  429  QISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  608
              + +  +   +SP  + ++ +TC VC  R+ + I+ HAY +G V V+C GC   H + D
Sbjct  81   SATEYSGAPGVESPGEKFVMVYTCSVCETRSAKTISKHAYYNGVVLVRCPGCENLHLVAD  140

Query  609  NLNLFHD  629
             L  F D
Sbjct  141  RLGWFED  147



>gb|AJT03343.1| Zim17p [Saccharomyces cerevisiae YJM270]
Length=174

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>gb|AJT02226.1| Zim17p [Saccharomyces cerevisiae YJM195]
 gb|AJT17234.1| Zim17p [Saccharomyces cerevisiae YJM1248]
 gb|AJT28723.1| Zim17p [Saccharomyces cerevisiae YJM1439]
Length=174

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>gb|AJT30888.1| Zim17p [Saccharomyces cerevisiae YJM1463]
Length=174

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>gb|AJT21703.1| Zim17p [Saccharomyces cerevisiae YJM1342]
Length=174

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>ref|NP_014089.2| Zim17p [Saccharomyces cerevisiae S288c]
 sp|P42844.2|ZIM17_YEAST RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
S288c]
 sp|B3LPE4.2|ZIM17_YEAS1 RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
RM11-1a]
 sp|B5VQB0.2|ZIM17_YEAS6 RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
AWRI1631]
 sp|A6ZSH0.2|ZIM17_YEAS7 RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
YJM789]
 gb|EEU04769.1| Zim17p [Saccharomyces cerevisiae JAY291]
 tpg|DAA10251.1| TPA: Zim17p [Saccharomyces cerevisiae S288c]
 dbj|GAA25801.1| K7_Zim17p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EIW07985.1| Zim17p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG83568.1| Zim17p [Saccharomyces cerevisiae R008]
 gb|EWG88974.1| Zim17p [Saccharomyces cerevisiae P301]
 gb|EWG93872.1| Zim17p [Saccharomyces cerevisiae R103]
 gb|EWH16328.1| Zim17p [Saccharomyces cerevisiae P283]
 gb|AHY76803.1| Zim17p [Saccharomyces cerevisiae YJM993]
 gb|AJP41041.1| Zim17p [Saccharomyces cerevisiae YJM1078]
 gb|AJT01478.1| Zim17p [Saccharomyces cerevisiae YJM189]
 gb|AJT01848.1| Zim17p [Saccharomyces cerevisiae YJM193]
 gb|AJT02591.1| Zim17p [Saccharomyces cerevisiae YJM244]
 gb|AJT02972.1| Zim17p [Saccharomyces cerevisiae YJM248]
 gb|AJT03710.1| Zim17p [Saccharomyces cerevisiae YJM271]
 gb|AJT04464.1| Zim17p [Saccharomyces cerevisiae YJM326]
 gb|AJT04835.1| Zim17p [Saccharomyces cerevisiae YJM428]
 gb|AJT05588.1| Zim17p [Saccharomyces cerevisiae YJM451]
 gb|AJT05953.1| Zim17p [Saccharomyces cerevisiae YJM453]
 gb|AJT06333.1| Zim17p [Saccharomyces cerevisiae YJM456]
 gb|AJT06706.1| Zim17p [Saccharomyces cerevisiae YJM470]
 gb|AJT07073.1| Zim17p [Saccharomyces cerevisiae YJM541]
 gb|AJT07442.1| Zim17p [Saccharomyces cerevisiae YJM554]
 gb|AJT07816.1| Zim17p [Saccharomyces cerevisiae YJM555]
 gb|AJT08189.1| Zim17p [Saccharomyces cerevisiae YJM627]
 gb|AJT04088.1| Zim17p [Saccharomyces cerevisiae YJM320]
 gb|AJT08560.1| Zim17p [Saccharomyces cerevisiae YJM681]
 gb|AJT08936.1| Zim17p [Saccharomyces cerevisiae YJM682]
 gb|AJT09307.1| Zim17p [Saccharomyces cerevisiae YJM683]
 gb|AJT09680.1| Zim17p [Saccharomyces cerevisiae YJM689]
 gb|AJT10055.1| Zim17p [Saccharomyces cerevisiae YJM693]
 gb|AJT10436.1| Zim17p [Saccharomyces cerevisiae YJM969]
 gb|AJT10815.1| Zim17p [Saccharomyces cerevisiae YJM972]
 gb|AJT11197.1| Zim17p [Saccharomyces cerevisiae YJM975]
 gb|AJT11577.1| Zim17p [Saccharomyces cerevisiae YJM978]
 gb|AJT11961.1| Zim17p [Saccharomyces cerevisiae YJM981]
 gb|AJT12342.1| Zim17p [Saccharomyces cerevisiae YJM984]
 gb|AJT12724.1| Zim17p [Saccharomyces cerevisiae YJM987]
 gb|AJT13109.1| Zim17p [Saccharomyces cerevisiae YJM990]
 gb|AJT13490.1| Zim17p [Saccharomyces cerevisiae YJM996]
 gb|AJT13874.1| Zim17p [Saccharomyces cerevisiae YJM1083]
 gb|AJT14244.1| Zim17p [Saccharomyces cerevisiae YJM1129]
 gb|AJT14618.1| Zim17p [Saccharomyces cerevisiae YJM1133]
 gb|AJT15364.1| Zim17p [Saccharomyces cerevisiae YJM1199]
 gb|AJT15737.1| Zim17p [Saccharomyces cerevisiae YJM1202]
 gb|AJT16111.1| Zim17p [Saccharomyces cerevisiae YJM1208]
 gb|AJT16479.1| Zim17p [Saccharomyces cerevisiae YJM1242]
 gb|AJT16856.1| Zim17p [Saccharomyces cerevisiae YJM1244]
 gb|AJT17603.1| Zim17p [Saccharomyces cerevisiae YJM1250]
 gb|AJT17983.1| Zim17p [Saccharomyces cerevisiae YJM1252]
 gb|AJT18726.1| Zim17p [Saccharomyces cerevisiae YJM1304]
 gb|AJT19096.1| Zim17p [Saccharomyces cerevisiae YJM1307]
 gb|AJT19463.1| Zim17p [Saccharomyces cerevisiae YJM1311]
 gb|AJT19831.1| Zim17p [Saccharomyces cerevisiae YJM1326]
 gb|AJT20205.1| Zim17p [Saccharomyces cerevisiae YJM1332]
 gb|AJT20580.1| Zim17p [Saccharomyces cerevisiae YJM1336]
 gb|AJT20957.1| Zim17p [Saccharomyces cerevisiae YJM1338]
 gb|AJT22400.1| Zim17p [Saccharomyces cerevisiae YJM1356]
 gb|AJT22783.1| Zim17p [Saccharomyces cerevisiae YJM1381]
 gb|AJT23535.1| Zim17p [Saccharomyces cerevisiae YJM1385]
 gb|AJT23911.1| Zim17p [Saccharomyces cerevisiae YJM1386]
 gb|AJT24280.1| Zim17p [Saccharomyces cerevisiae YJM1387]
 gb|AJT25748.1| Zim17p [Saccharomyces cerevisiae YJM1400]
 gb|AJT26481.1| Zim17p [Saccharomyces cerevisiae YJM1402]
 gb|AJT26849.1| Zim17p [Saccharomyces cerevisiae YJM1415]
 gb|AJT27223.1| Zim17p [Saccharomyces cerevisiae YJM1417]
 gb|AJT27600.1| Zim17p [Saccharomyces cerevisiae YJM1418]
 gb|AJT27970.1| Zim17p [Saccharomyces cerevisiae YJM1419]
 gb|AJT28343.1| Zim17p [Saccharomyces cerevisiae YJM1433]
 gb|AJT29094.1| Zim17p [Saccharomyces cerevisiae YJM1443]
 gb|AJT29430.1| Zim17p [Saccharomyces cerevisiae YJM1444]
 gb|AJT29803.1| Zim17p [Saccharomyces cerevisiae YJM1447]
 gb|AJT30155.1| Zim17p [Saccharomyces cerevisiae YJM1450]
 gb|AJT30527.1| Zim17p [Saccharomyces cerevisiae YJM1460]
 gb|AJT31254.1| Zim17p [Saccharomyces cerevisiae YJM1477]
 gb|AJT32006.1| Zim17p [Saccharomyces cerevisiae YJM1479]
 gb|AJT31635.1| Zim17p [Saccharomyces cerevisiae YJM1478]
 gb|AJT32372.1| Zim17p [Saccharomyces cerevisiae YJM1526]
 gb|AJT33124.1| Zim17p [Saccharomyces cerevisiae YJM1549]
 gb|AJT33502.1| Zim17p [Saccharomyces cerevisiae YJM1573]
 gb|AJT33868.1| Zim17p [Saccharomyces cerevisiae YJM1574]
 gb|AJT34609.1| Zim17p [Saccharomyces cerevisiae YJM1615]
Length=174

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>emb|CDF87706.1| BN860_12596g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH09544.1| related to Mitochondrial protein import protein ZIM17 [Zygosaccharomyces 
bailii ISA1307]
Length=167

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  480  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            +++AFTCK C  R++  ++  AYT+GTV +QC  C+  H + D+L +F+D
Sbjct  61   LMIAFTCKKCNHRSSHTMSKQAYTNGTVLIQCPTCHARHLIADHLKIFND  110



>gb|AJT25380.1| Zim17p [Saccharomyces cerevisiae YJM1399]
Length=174

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>gb|AJT18360.1| Zim17p [Saccharomyces cerevisiae YJM1273]
Length=174

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>ref|XP_001691699.1| Hsp70 escorting protein 2 [Chlamydomonas reinhardtii]
 gb|ABS84949.1| HSP70 escort protein [Chlamydomonas reinhardtii]
 gb|EDP04807.1| Hsp70 escorting protein 2 [Chlamydomonas reinhardtii]
Length=205

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +3

Query  426  EQISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL-  602
            +++   P S      RR  LV FTC  CG R+ R +NP A+  G VF QC  C+++H L 
Sbjct  99   KKVVRIPLSAMGDGARRSKLVLFTCNKCGGRSARLVNPVAWEKGVVFGQCSKCSVWHVLQ  158

Query  603  VDNLNLFHDMK  635
             +N  ++ +++
Sbjct  159  ANNKKIYEEVR  169



>gb|AJT26115.1| Zim17p [Saccharomyces cerevisiae YJM1401]
Length=174

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>ref|XP_010736167.1| PREDICTED: DNL-type zinc finger protein, partial [Larimichthys 
crocea]
Length=174

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 56/127 (44%), Gaps = 22/127 (17%)
 Frame = +3

Query  252  TGTSPISDPIPMTRAWYRSFPRMRRWDWLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQ  431
            +G S  S PI   R  +   P  R    +S    RG+TT + +   +V           +
Sbjct  31   SGLSCRSLPIA-ARTRHVLLPADRCEARVSTLYHRGFTTSASVSSDAVG----------K  79

Query  432  ISTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  611
            I T  + L            +TCKVC  R+T  I+  AY  G V V C GCN +H + DN
Sbjct  80   IETKHYQLV-----------YTCKVCSTRSTEKISKQAYHKGVVIVTCRGCNNHHIIADN  128

Query  612  LNLFHDM  632
            LN F D+
Sbjct  129  LNWFSDL  135



>gb|AJT05212.1| Zim17p [Saccharomyces cerevisiae YJM450]
 gb|AJT14991.1| Zim17p [Saccharomyces cerevisiae YJM1190]
 gb|AJT32750.1| Zim17p [Saccharomyces cerevisiae YJM1527]
Length=174

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHD  118



>gb|EJT44486.1| ZIM17-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=175

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  462  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD
Sbjct  63   KVEKPKMMIAFTCKKCDTRSSHTMSKQAYEKGTVMISCPHCKVRHLIADHLKIFHD  118



>emb|CDK25150.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=222

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  480  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  629
            +++AFTCK C  R++  ++  AYT GTV +QC GC+  H + D+L +F D
Sbjct  108  LMIAFTCKKCDTRSSHVMSKQAYTSGTVLIQCPGCSNRHLIADHLKIFSD  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750