BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN019P16

Length=469
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD22104.1|  B12D protein                                            147   3e-42   Ipomoea batatas [batate]
ref|XP_010929102.1|  PREDICTED: uncharacterized protein LOC105050689    129   3e-35   Elaeis guineensis
ref|XP_010942173.1|  PREDICTED: uncharacterized protein LOC105060...    129   5e-35   Elaeis guineensis
ref|XP_008779549.1|  PREDICTED: uncharacterized protein LOC103699287    127   2e-34   Phoenix dactylifera
ref|XP_008806317.1|  PREDICTED: uncharacterized protein LOC103719037    126   4e-34   Phoenix dactylifera
ref|XP_011087179.1|  PREDICTED: uncharacterized protein LOC105168733    125   1e-33   Sesamum indicum [beniseed]
ref|XP_008437938.1|  PREDICTED: uncharacterized protein LOC103483212    125   1e-33   Cucumis melo [Oriental melon]
ref|XP_009385140.1|  PREDICTED: uncharacterized protein LOC103972508    125   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010100274.1|  hypothetical protein L484_027580                   125   1e-33   Morus notabilis
ref|XP_004233340.1|  PREDICTED: uncharacterized protein LOC101261386    125   2e-33   
ref|XP_002283743.1|  PREDICTED: uncharacterized protein LOC100263922    124   2e-33   Vitis vinifera
ref|XP_004152455.1|  PREDICTED: uncharacterized protein LOC101218501    124   2e-33   
ref|XP_007138129.1|  hypothetical protein PHAVU_009G182600g             124   3e-33   Phaseolus vulgaris [French bean]
emb|CBI15096.3|  unnamed protein product                                124   4e-33   Vitis vinifera
ref|XP_008798028.1|  PREDICTED: uncharacterized protein LOC103713044    124   4e-33   Phoenix dactylifera
ref|XP_006856912.1|  hypothetical protein AMTR_s00055p00220460          123   4e-33   Amborella trichopoda
ref|XP_003527039.1|  PREDICTED: uncharacterized protein LOC100499787    123   5e-33   Glycine max [soybeans]
ref|XP_006357136.1|  PREDICTED: uncharacterized protein LOC102583994    123   5e-33   Solanum tuberosum [potatoes]
ref|XP_010913425.1|  PREDICTED: uncharacterized protein LOC105039118    123   6e-33   Elaeis guineensis
gb|EPS70000.1|  hypothetical protein M569_04763                         122   8e-33   Genlisea aurea
ref|XP_010556171.1|  PREDICTED: uncharacterized protein LOC104825524    122   9e-33   Tarenaya hassleriana [spider flower]
gb|AGC24177.1|  unknown                                                 122   1e-32   Rehmannia glutinosa [Chinese foxglove]
ref|XP_008222037.1|  PREDICTED: uncharacterized protein LOC103321965    122   1e-32   Prunus mume [ume]
ref|XP_006338509.1|  PREDICTED: uncharacterized protein LOC102603775    122   2e-32   Solanum tuberosum [potatoes]
ref|XP_004501964.1|  PREDICTED: uncharacterized protein LOC101508877    122   2e-32   Cicer arietinum [garbanzo]
ref|XP_010678668.1|  PREDICTED: uncharacterized protein LOC104894188    122   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008800943.1|  PREDICTED: uncharacterized protein LOC103715180    122   2e-32   Phoenix dactylifera
ref|XP_009760043.1|  PREDICTED: uncharacterized protein LOC104212451    122   2e-32   Nicotiana sylvestris
ref|XP_010027818.1|  PREDICTED: uncharacterized protein LOC104418237    121   2e-32   Eucalyptus grandis [rose gum]
ref|XP_008792162.1|  PREDICTED: uncharacterized protein LOC103708847    121   3e-32   Phoenix dactylifera
ref|XP_009615457.1|  PREDICTED: uncharacterized protein LOC104108174    121   4e-32   Nicotiana tomentosiformis
gb|KHG12689.1|  Uncharacterized protein F383_19724                      121   4e-32   Gossypium arboreum [tree cotton]
ref|XP_010272106.1|  PREDICTED: uncharacterized protein LOC104607987    121   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006845122.1|  hypothetical protein AMTR_s00005p00190110          120   5e-32   Amborella trichopoda
ref|XP_004236155.1|  PREDICTED: uncharacterized protein LOC101260417    120   6e-32   Solanum lycopersicum
ref|XP_011085792.1|  PREDICTED: uncharacterized protein LOC105167687    120   6e-32   Sesamum indicum [beniseed]
ref|XP_003523058.1|  PREDICTED: uncharacterized protein LOC100500534    120   6e-32   Glycine max [soybeans]
ref|XP_002270661.1|  PREDICTED: uncharacterized protein LOC100259604    120   7e-32   Vitis vinifera
ref|XP_009627555.1|  PREDICTED: uncharacterized protein LOC104118078    122   7e-32   
ref|XP_010907762.1|  PREDICTED: uncharacterized protein LOC105034337    120   8e-32   Elaeis guineensis
ref|XP_007226455.1|  hypothetical protein PRUPE_ppa024551mg             120   8e-32   Prunus persica
ref|XP_006344997.1|  PREDICTED: uncharacterized protein LOC102605944    120   8e-32   Solanum tuberosum [potatoes]
ref|XP_009785405.1|  PREDICTED: uncharacterized protein LOC104233674    120   9e-32   Nicotiana sylvestris
ref|XP_010027794.1|  PREDICTED: uncharacterized protein LOC104418219    120   9e-32   Eucalyptus grandis [rose gum]
gb|KJB30971.1|  hypothetical protein B456_005G172200                    120   9e-32   Gossypium raimondii
ref|XP_011098540.1|  PREDICTED: uncharacterized protein LOC105177185    120   1e-31   Sesamum indicum [beniseed]
ref|XP_004232259.1|  PREDICTED: uncharacterized protein LOC101265497    120   1e-31   Solanum lycopersicum
ref|XP_009403647.1|  PREDICTED: uncharacterized protein LOC103987158    120   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009588369.1|  PREDICTED: uncharacterized protein LOC104085953    119   1e-31   Nicotiana tomentosiformis
ref|XP_009771458.1|  PREDICTED: uncharacterized protein LOC104221988    119   2e-31   Nicotiana sylvestris
ref|NP_001148351.1|  LOC100281961                                       119   2e-31   Zea mays [maize]
ref|NP_001057280.1|  Os06g0246000                                       119   2e-31   
ref|XP_010111964.1|  hypothetical protein L484_004741                   119   2e-31   Morus notabilis
ref|XP_007163724.1|  hypothetical protein PHAVU_001G258900g             119   2e-31   Phaseolus vulgaris [French bean]
ref|XP_008340166.1|  PREDICTED: uncharacterized protein LOC103403120    119   2e-31   
emb|CAK22419.1|  B12D-like protein                                      119   2e-31   Beta vulgaris [beet]
ref|XP_010415343.1|  PREDICTED: uncharacterized protein LOC104701372    119   2e-31   Camelina sativa [gold-of-pleasure]
ref|NP_001152717.1|  LOC100286358                                       119   2e-31   Zea mays [maize]
gb|ADB08699.1|  B12D-like protein                                       119   2e-31   Wolffia arrhiza
gb|ACU15648.1|  unknown                                                 119   3e-31   Glycine max [soybeans]
ref|XP_002311729.1|  hypothetical protein POPTR_0008s17950g             119   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_003564009.1|  PREDICTED: uncharacterized protein LOC100821381    119   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_010930055.1|  PREDICTED: uncharacterized protein LOC105051361    119   3e-31   Elaeis guineensis
gb|KHG26447.1|  Uncharacterized protein F383_04740                      119   3e-31   Gossypium arboreum [tree cotton]
ref|XP_011029641.1|  PREDICTED: uncharacterized protein LOC105129336    119   3e-31   Populus euphratica
ref|XP_007209803.1|  hypothetical protein PRUPE_ppa014036mg             119   3e-31   Prunus persica
gb|AEC10990.1|  b12d-like protein                                       119   3e-31   Camellia sinensis [black tea]
ref|XP_003551877.1|  PREDICTED: uncharacterized protein LOC100500344    118   4e-31   Glycine max [soybeans]
emb|CDP02170.1|  unnamed protein product                                118   4e-31   Coffea canephora [robusta coffee]
ref|XP_010942172.1|  PREDICTED: uncharacterized protein LOC105060...    119   5e-31   Elaeis guineensis
ref|XP_010470676.1|  PREDICTED: uncharacterized protein LOC104750563    119   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_011042304.1|  PREDICTED: uncharacterized protein LOC105138023    118   5e-31   Populus euphratica
ref|XP_002438146.1|  hypothetical protein SORBIDRAFT_10g008810          118   5e-31   Sorghum bicolor [broomcorn]
ref|XP_010511712.1|  PREDICTED: uncharacterized protein LOC104787778    118   6e-31   Camelina sativa [gold-of-pleasure]
gb|AFW76868.1|  hypothetical protein ZEAMMB73_758599                    119   6e-31   
gb|ACU15396.1|  unknown                                                 118   7e-31   Glycine max [soybeans]
ref|XP_006439727.1|  hypothetical protein CICLE_v10023087mg             117   8e-31   Citrus clementina [clementine]
ref|XP_010546014.1|  PREDICTED: uncharacterized protein LOC104818223    117   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_011042649.1|  PREDICTED: uncharacterized protein LOC105138299    117   9e-31   Populus euphratica
ref|XP_004142944.1|  PREDICTED: uncharacterized protein LOC101222643    117   1e-30   Cucumis sativus [cucumbers]
emb|CDP14927.1|  unnamed protein product                                117   1e-30   Coffea canephora [robusta coffee]
ref|XP_004965125.1|  PREDICTED: uncharacterized protein LOC101762161    117   1e-30   Setaria italica
gb|AFO59572.1|  B12D like protein                                       117   1e-30   Saccharum hybrid cultivar GT28
gb|EPS70497.1|  hypothetical protein M569_04271                         117   1e-30   Genlisea aurea
gb|ACU16637.1|  unknown                                                 117   1e-30   Glycine max [soybeans]
ref|XP_008239697.1|  PREDICTED: uncharacterized protein LOC103338283    117   1e-30   Prunus mume [ume]
ref|XP_002314553.2|  hypothetical protein POPTR_0010s06550g             119   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_003538567.1|  PREDICTED: uncharacterized protein LOC100527541    117   2e-30   Glycine max [soybeans]
gb|ACJ84101.1|  unknown                                                 117   2e-30   Medicago truncatula
ref|XP_006655963.1|  PREDICTED: uncharacterized protein LOC102707968    116   2e-30   Oryza brachyantha
ref|XP_002511469.1|  conserved hypothetical protein                     116   2e-30   Ricinus communis
ref|XP_006376832.1|  hypothetical protein POPTR_0012s07660g             116   3e-30   
ref|XP_010255359.1|  PREDICTED: uncharacterized protein LOC104596051    116   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_004502329.1|  PREDICTED: uncharacterized protein LOC101491577    116   4e-30   Cicer arietinum [garbanzo]
ref|XP_002515002.1|  conserved hypothetical protein                     115   5e-30   
gb|KHN44408.1|  hypothetical protein glysoja_014449                     115   5e-30   Glycine soja [wild soybean]
ref|XP_002318014.1|  senescence-associated family protein               115   6e-30   Populus trichocarpa [western balsam poplar]
gb|AFK33307.1|  unknown                                                 115   6e-30   Medicago truncatula
ref|XP_007036078.1|  B12D protein                                       115   7e-30   Theobroma cacao [chocolate]
ref|XP_010692143.1|  PREDICTED: uncharacterized protein LOC104905334    115   8e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006391239.1|  hypothetical protein EUTSA_v10019446mg             115   8e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010550670.1|  PREDICTED: uncharacterized protein LOC104821467    115   8e-30   Tarenaya hassleriana [spider flower]
gb|KDP26755.1|  hypothetical protein JCGZ_17913                         114   2e-29   Jatropha curcas
ref|XP_008374479.1|  PREDICTED: uncharacterized protein LOC103437758    114   2e-29   Malus domestica [apple tree]
gb|EMT09386.1|  hypothetical protein F775_07588                         114   3e-29   
gb|AFK36649.1|  unknown                                                 113   5e-29   Lotus japonicus
gb|KCW61991.1|  hypothetical protein EUGRSUZ_H04674                     114   6e-29   Eucalyptus grandis [rose gum]
gb|AFK42697.1|  unknown                                                 112   7e-29   Lotus japonicus
ref|XP_006404294.1|  hypothetical protein EUTSA_v10010862mg             112   8e-29   Eutrema salsugineum [saltwater cress]
emb|CAA54065.1|  HvB12D                                                 112   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011086732.1|  PREDICTED: uncharacterized protein LOC105168371    111   2e-28   Sesamum indicum [beniseed]
gb|KFK34105.1|  b12d protein                                            111   3e-28   Arabis alpina [alpine rockcress]
ref|XP_008351806.1|  PREDICTED: uncharacterized protein LOC103415246    110   6e-28   
ref|XP_004310038.1|  PREDICTED: uncharacterized protein LOC101295883    110   7e-28   Fragaria vesca subsp. vesca
ref|XP_002875880.1|  hypothetical protein ARALYDRAFT_485174             110   8e-28   
ref|XP_010515125.1|  PREDICTED: uncharacterized protein LOC104791023    110   8e-28   Camelina sativa [gold-of-pleasure]
ref|NP_190397.1|  B12D protein                                          110   8e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601829.1|  B12D protein                                       109   1e-27   Medicago truncatula
gb|ACG48656.1|  B12D protein                                            109   2e-27   Zea mays [maize]
emb|CDY44977.1|  BnaCnng12070D                                          108   2e-27   Brassica napus [oilseed rape]
ref|XP_007044988.1|  B12D protein                                       108   2e-27   Theobroma cacao [chocolate]
ref|XP_004504481.1|  PREDICTED: uncharacterized protein LOC101503540    108   2e-27   Cicer arietinum [garbanzo]
ref|XP_006290288.1|  hypothetical protein CARUB_v10018322mg             108   3e-27   Capsella rubella
ref|XP_008651557.1|  PREDICTED: B12D protein isoform X1                 108   3e-27   Zea mays [maize]
gb|ABK24106.1|  unknown                                                 108   3e-27   Picea sitchensis
ref|XP_009149843.1|  PREDICTED: uncharacterized protein LOC103873171    108   3e-27   Brassica rapa
ref|NP_001151846.1|  B12D protein                                       108   3e-27   Zea mays [maize]
gb|EMS61978.1|  hypothetical protein TRIUR3_19930                       108   3e-27   Triticum urartu
gb|EMT27875.1|  hypothetical protein F775_28789                         108   4e-27   
ref|XP_004299593.1|  PREDICTED: uncharacterized protein LOC101301782    108   5e-27   Fragaria vesca subsp. vesca
ref|XP_002459694.1|  hypothetical protein SORBIDRAFT_02g008930          108   5e-27   Sorghum bicolor [broomcorn]
gb|KEH20547.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit        108   6e-27   Medicago truncatula
dbj|BAK01100.1|  predicted protein                                      108   6e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010249439.1|  PREDICTED: uncharacterized protein LOC104591985    105   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009150210.1|  PREDICTED: uncharacterized protein LOC103873555    105   4e-26   Brassica rapa
gb|EMS45331.1|  hypothetical protein TRIUR3_29962                       105   6e-26   Triticum urartu
ref|XP_003557311.1|  PREDICTED: uncharacterized protein LOC100833199    105   8e-26   
dbj|BAK01669.1|  predicted protein                                      105   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88884.1|  predicted protein                                      105   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP13299.1|  unnamed protein product                                103   3e-25   Coffea canephora [robusta coffee]
dbj|BAC84633.1|  putative B12D protein                                  103   4e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955942.1|  PREDICTED: uncharacterized protein LOC101785845    103   4e-25   Setaria italica
ref|NP_001059360.2|  Os07g0274700                                       103   1e-24   
ref|XP_006658464.1|  PREDICTED: uncharacterized protein LOC102702396    102   1e-24   Oryza brachyantha
gb|KEH35272.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit      97.8    2e-23   Medicago truncatula
ref|XP_011099034.1|  PREDICTED: uncharacterized protein LOC105177540  98.2    3e-23   Sesamum indicum [beniseed]
ref|XP_006438116.1|  hypothetical protein CICLE_v10033501mg           97.8    5e-23   Citrus clementina [clementine]
ref|XP_006484337.1|  PREDICTED: uncharacterized protein LOC102622685  97.4    7e-23   
gb|AAL17696.1|  B12D-like protein                                     98.2    9e-23   Castanea sativa
ref|XP_009596991.1|  PREDICTED: uncharacterized protein LOC104092997  97.1    1e-22   Nicotiana tomentosiformis
ref|XP_006338343.1|  PREDICTED: uncharacterized protein LOC102603988  97.1    1e-22   Solanum tuberosum [potatoes]
ref|XP_010694063.1|  PREDICTED: uncharacterized protein LOC104906928  96.7    1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009792586.1|  PREDICTED: uncharacterized protein LOC104239607  95.1    4e-22   Nicotiana sylvestris
ref|XP_008464582.1|  PREDICTED: uncharacterized protein LOC103502424  95.1    5e-22   Cucumis melo [Oriental melon]
ref|XP_004232140.1|  PREDICTED: uncharacterized protein LOC101252543  94.7    7e-22   Solanum lycopersicum
ref|XP_010257978.1|  PREDICTED: uncharacterized protein LOC104597899  93.6    2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010260461.1|  PREDICTED: uncharacterized protein LOC104599559  93.6    2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008230281.1|  PREDICTED: uncharacterized protein LOC103329570  92.8    3e-21   Prunus mume [ume]
emb|CDP19974.1|  unnamed protein product                              93.2    3e-21   Coffea canephora [robusta coffee]
gb|EYU25265.1|  hypothetical protein MIMGU_mgv1a024239mg              92.8    3e-21   Erythranthe guttata [common monkey flower]
gb|EYU20492.1|  hypothetical protein MIMGU_mgv1a026736mg              92.8    4e-21   Erythranthe guttata [common monkey flower]
ref|XP_002281305.1|  PREDICTED: uncharacterized protein LOC100258293  92.8    4e-21   Vitis vinifera
gb|KJB22813.1|  hypothetical protein B456_004G066900                  92.8    4e-21   Gossypium raimondii
ref|XP_003531875.1|  PREDICTED: uncharacterized protein LOC100527287  92.4    5e-21   Glycine max [soybeans]
ref|XP_007032847.1|  B12D protein                                     92.0    6e-21   
ref|XP_001779363.1|  predicted protein                                92.0    7e-21   
ref|XP_010260574.1|  PREDICTED: uncharacterized protein LOC104599651  92.0    8e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010099316.1|  hypothetical protein L484_018178                 92.0    8e-21   Morus notabilis
ref|XP_011021065.1|  PREDICTED: uncharacterized protein LOC105123251  91.7    9e-21   Populus euphratica
ref|XP_007215204.1|  hypothetical protein PRUPE_ppa014104mg           91.7    1e-20   Prunus persica
ref|XP_001776158.1|  predicted protein                                91.7    1e-20   
ref|XP_008664404.1|  PREDICTED: uncharacterized protein LOC100383000  91.3    1e-20   Zea mays [maize]
ref|XP_008362218.1|  PREDICTED: uncharacterized protein LOC103425898  91.3    2e-20   
ref|XP_006373388.1|  germination family protein                       91.3    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006856407.1|  hypothetical protein AMTR_s00047p00213990        90.9    2e-20   Amborella trichopoda
gb|EYU29509.1|  hypothetical protein MIMGU_mgv1a024878mg              90.9    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_004955938.1|  PREDICTED: uncharacterized protein LOC101784102  90.9    2e-20   Setaria italica
dbj|BAG94722.1|  unnamed protein product                              90.5    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059359.1|  Os07g0274400                                     90.5    3e-20   
ref|XP_010029400.1|  PREDICTED: uncharacterized protein LOC104419...  90.1    3e-20   Eucalyptus grandis [rose gum]
ref|XP_010029399.1|  PREDICTED: uncharacterized protein LOC104419...  90.1    4e-20   Eucalyptus grandis [rose gum]
gb|KGN53786.1|  hypothetical protein Csa_4G129030                     89.7    4e-20   Cucumis sativus [cucumbers]
ref|XP_008379445.1|  PREDICTED: uncharacterized protein LOC103442440  90.1    4e-20   
ref|XP_006430939.1|  hypothetical protein CICLE_v10013823mg           90.1    5e-20   Citrus clementina [clementine]
dbj|BAK03592.1|  predicted protein                                    89.7    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004137261.1|  PREDICTED: uncharacterized protein LOC101217963  89.7    6e-20   Cucumis sativus [cucumbers]
ref|XP_010034410.1|  PREDICTED: uncharacterized protein LOC104423644  89.7    6e-20   
ref|XP_006482419.1|  PREDICTED: uncharacterized protein LOC102612079  89.4    8e-20   Citrus sinensis [apfelsine]
gb|EYU29787.1|  hypothetical protein MIMGU_mgv1a021169mg              89.0    8e-20   Erythranthe guttata [common monkey flower]
ref|XP_006658463.1|  PREDICTED: uncharacterized protein LOC102702117  89.0    1e-19   Oryza brachyantha
ref|XP_006340507.1|  PREDICTED: uncharacterized protein LOC102592850  89.7    1e-19   Solanum tuberosum [potatoes]
ref|XP_004491894.1|  PREDICTED: uncharacterized protein LOC101510215  88.6    1e-19   Cicer arietinum [garbanzo]
ref|XP_007139429.1|  hypothetical protein PHAVU_008G028700g           89.4    2e-19   Phaseolus vulgaris [French bean]
ref|XP_002531002.1|  conserved hypothetical protein                   88.2    2e-19   Ricinus communis
ref|XP_009419068.1|  PREDICTED: uncharacterized protein LOC103999135  88.2    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004304209.1|  PREDICTED: uncharacterized protein LOC101313329  88.2    3e-19   Fragaria vesca subsp. vesca
ref|XP_003552604.1|  PREDICTED: uncharacterized protein LOC100785946  87.8    3e-19   Glycine max [soybeans]
gb|KCW56312.1|  hypothetical protein EUGRSUZ_I02053                   90.9    3e-19   Eucalyptus grandis [rose gum]
ref|XP_003561264.1|  PREDICTED: uncharacterized protein LOC100824762  87.4    4e-19   Brachypodium distachyon [annual false brome]
dbj|BAC83875.1|  unknown protein                                      87.4    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562728.1|  PREDICTED: uncharacterized protein LOC100837236  87.4    5e-19   Brachypodium distachyon [annual false brome]
gb|KDP24288.1|  hypothetical protein JCGZ_25584                       87.0    6e-19   Jatropha curcas
ref|XP_010514670.1|  PREDICTED: uncharacterized protein LOC104790592  87.0    7e-19   Camelina sativa [gold-of-pleasure]
emb|CDX85280.1|  BnaC07g25910D                                        86.3    7e-19   
ref|NP_001060222.2|  Os07g0604600                                     87.8    7e-19   
ref|XP_010034411.1|  PREDICTED: uncharacterized protein LOC104423646  86.7    7e-19   
gb|AFK43764.1|  unknown                                               86.3    1e-18   Medicago truncatula
ref|XP_009151762.1|  PREDICTED: uncharacterized protein LOC103875065  85.9    1e-18   Brassica rapa
ref|XP_006395262.1|  hypothetical protein EUTSA_v10005671mg           85.9    1e-18   Eutrema salsugineum [saltwater cress]
ref|XP_002305391.1|  germination family protein                       85.9    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010502994.1|  PREDICTED: uncharacterized protein LOC104780196  85.9    2e-18   Camelina sativa [gold-of-pleasure]
ref|NP_189632.1|  B12D protein                                        85.9    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44347.1|  unknown                                               85.5    2e-18   Lotus japonicus
ref|XP_002875526.1|  hypothetical protein ARALYDRAFT_323026           85.5    2e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_011008605.1|  PREDICTED: uncharacterized protein LOC105113935  84.7    4e-18   Populus euphratica
ref|XP_002460987.1|  hypothetical protein SORBIDRAFT_02g038760        84.3    4e-18   
ref|XP_010553961.1|  PREDICTED: uncharacterized protein LOC104823885  84.7    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_003601294.1|  B12D-like protein                                84.3    6e-18   
ref|XP_002978639.1|  hypothetical protein SELMODRAFT_152721           84.3    7e-18   Selaginella moellendorffii
ref|XP_004958246.1|  PREDICTED: uncharacterized protein LOC101775472  84.3    8e-18   Setaria italica
ref|XP_008346823.1|  PREDICTED: putative cyclin-B3-1                  84.7    1e-17   
ref|NP_001147337.1|  B12D protein                                     83.6    1e-17   
ref|XP_009394678.1|  PREDICTED: uncharacterized protein LOC103980120  82.8    1e-17   
ref|XP_002459693.1|  hypothetical protein SORBIDRAFT_02g008920        83.6    2e-17   Sorghum bicolor [broomcorn]
ref|XP_006657932.1|  PREDICTED: uncharacterized protein LOC102705450  83.2    2e-17   Oryza brachyantha
ref|NP_001060223.1|  Os07g0604700                                     82.8    3e-17   
ref|XP_008651396.1|  PREDICTED: B12D protein isoform X1               82.8    3e-17   
tpg|DAA63528.1|  TPA: b12D protein                                    83.6    3e-17   
ref|XP_002887135.1|  hypothetical protein ARALYDRAFT_894514           82.0    7e-17   
ref|XP_009406306.1|  PREDICTED: uncharacterized protein LOC103989230  80.1    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006658786.1|  PREDICTED: uncharacterized protein LOC102700818  80.1    3e-16   Oryza brachyantha
gb|AAR13310.1|  B12D-like protein                                     80.1    6e-16   Phaseolus vulgaris [French bean]
gb|EMS55237.1|  hypothetical protein TRIUR3_19745                     77.8    1e-15   Triticum urartu
ref|XP_008810952.1|  PREDICTED: uncharacterized protein LOC103722254  78.2    1e-15   
gb|EPS63516.1|  hypothetical protein M569_11268                       77.4    3e-15   Genlisea aurea
ref|XP_001757013.1|  predicted protein                                77.0    4e-15   
ref|XP_009351238.1|  PREDICTED: uncharacterized protein LOC103942755  75.5    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_002961492.1|  hypothetical protein SELMODRAFT_76981            75.5    2e-14   
gb|EMS56733.1|  Microspherule protein 1                               79.7    4e-14   Triticum urartu
ref|XP_010937886.1|  PREDICTED: uncharacterized protein LOC105057112  73.6    6e-14   Elaeis guineensis
ref|XP_002975136.1|  hypothetical protein SELMODRAFT_102690           71.6    3e-13   
ref|XP_001772578.1|  predicted protein                                67.4    9e-12   
gb|ACU13634.1|  unknown                                               67.4    2e-11   Glycine max [soybeans]
gb|EMS53792.1|  hypothetical protein TRIUR3_24112                     66.2    7e-11   Triticum urartu
gb|KDO50116.1|  hypothetical protein CISIN_1g036394mg                 63.5    3e-10   Citrus sinensis [apfelsine]
gb|AAP12919.2|  expressed protein                                     63.5    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97493.1|  expressed protein                                     63.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050622.2|  Os03g0601500                                     63.2    5e-10   
gb|ABR25826.1|  b12d protein                                          58.9    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_001754887.1|  predicted protein                                63.5    1e-08   
ref|XP_001416807.1|  predicted protein                                57.0    9e-08   Ostreococcus lucimarinus CCE9901
ref|XP_007511902.1|  predicted protein                                56.6    1e-07   Bathycoccus prasinos
ref|XP_002507620.1|  predicted protein                                50.4    1e-05   Micromonas commoda



>gb|AAD22104.1| B12D protein [Ipomoea batatas]
Length=90

 Score =   147 bits (371),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
             VAVGICGFQLIRN+TTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP
Sbjct  19   SVAVGICGFQLIRNLTTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  78

Query  182  SLNRFFSDPQRN  217
            SLNRFFSDPQRN
Sbjct  79   SLNRFFSDPQRN  90



>ref|XP_010929102.1| PREDICTED: uncharacterized protein LOC105050689 [Elaeis guineensis]
Length=91

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG+KYAEH LRKFVRNK+PEIMP
Sbjct  22   GVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGEKYAEHGLRKFVRNKAPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+NRFF+DP+
Sbjct  82   SINRFFADPK  91



>ref|XP_010942173.1| PREDICTED: uncharacterized protein LOC105060250 isoform X2 [Elaeis 
guineensis]
Length=91

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG+KYAEH LR+FVRNK+PEIMP
Sbjct  22   GVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGQKYAEHGLRRFVRNKAPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+NRFF+DP+
Sbjct  82   SINRFFADPK  91



>ref|XP_008779549.1| PREDICTED: uncharacterized protein LOC103699287 [Phoenix dactylifera]
Length=91

 Score =   127 bits (318),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLEN+ EG+KYAEH LRKFVRNK+PEI+P
Sbjct  22   GVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENFAEGQKYAEHGLRKFVRNKAPEILP  81

Query  182  SLNRFFSDPQ  211
            S+NRFF+DP+
Sbjct  82   SINRFFADPK  91



>ref|XP_008806317.1| PREDICTED: uncharacterized protein LOC103719037 [Phoenix dactylifera]
Length=91

 Score =   126 bits (316),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLEN+ EG+KYAEH LR+FVRNK+PEIMP
Sbjct  22   GVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENHAEGEKYAEHGLRRFVRNKAPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+NRFF+DP+
Sbjct  82   SINRFFADPK  91



>ref|XP_011087179.1| PREDICTED: uncharacterized protein LOC105168733 [Sesamum indicum]
Length=89

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRVNKEGRAAGVLEN+ EG+KY+EH+L+KFVRN+ PEIMP
Sbjct  19   GVAVGICGFQLVRNICINPEVRVNKEGRAAGVLENFAEGQKYSEHALKKFVRNRRPEIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FF+DPQ
Sbjct  79   SINSFFTDPQ  88



>ref|XP_008437938.1| PREDICTED: uncharacterized protein LOC103483212 [Cucumis melo]
Length=94

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQLIRNI  NPEVRV+KE RAAGVL+N+ EG+KY+EH LRKFVRNKSPEIMP
Sbjct  23   GVAVGICGFQLIRNICINPEVRVSKENRAAGVLDNFAEGEKYSEHFLRKFVRNKSPEIMP  82

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP RN
Sbjct  83   SINNFFTDPSRN  94



>ref|XP_009385140.1| PREDICTED: uncharacterized protein LOC103972508 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI+TNP+VRVNK+ RAAGVLEN+ EG+KYAEHSLRKFVRNK+PEIMP
Sbjct  22   GVAVGICGVQLVRNISTNPQVRVNKQNRAAGVLENFGEGEKYAEHSLRKFVRNKAPEIMP  81

Query  182  SLNRFFSDPQ  211
            ++N+FFSDP+
Sbjct  82   AVNKFFSDPK  91



>ref|XP_010100274.1| hypothetical protein L484_027580 [Morus notabilis]
 gb|EXB82408.1| hypothetical protein L484_027580 [Morus notabilis]
Length=92

 Score =   125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QLIRNITTNPEVRV KE RAAG+L+N+EEG++Y++HSLRKFVRNKSP+IMP
Sbjct  23   GVAVGICGMQLIRNITTNPEVRVTKENRAAGILDNFEEGERYSQHSLRKFVRNKSPQIMP  82

Query  182  SLNRFFSDP  208
            +LN FFSDP
Sbjct  83   NLNNFFSDP  91



>ref|XP_004233340.1| PREDICTED: uncharacterized protein LOC101261386 [Solanum lycopersicum]
Length=91

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQLIRN+  NPEVRVNKE RAAGVLEN+ EG+KYAEH LRKFVRN+SPEIMP
Sbjct  22   GVAVGICGFQLIRNVCINPEVRVNKENRAAGVLENFSEGEKYAEHGLRKFVRNRSPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  82   SINGFFSDPK  91



>ref|XP_002283743.1| PREDICTED: uncharacterized protein LOC100263922 [Vitis vinifera]
Length=93

 Score =   124 bits (312),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NP+VRV+KE RAAGVLEN+ EG+KY+EH LRK+VRNKSPEIMP
Sbjct  22   GVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEGQKYSEHFLRKYVRNKSPEIMP  81

Query  182  SLNRFFSDPQRN  217
            S+N FFSDP++N
Sbjct  82   SINSFFSDPEKN  93



>ref|XP_004152455.1| PREDICTED: uncharacterized protein LOC101218501 [Cucumis sativus]
 ref|XP_004157801.1| PREDICTED: uncharacterized LOC101218501 [Cucumis sativus]
 gb|KGN64280.1| hypothetical protein Csa_1G045780 [Cucumis sativus]
Length=94

 Score =   124 bits (312),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQLIRNI  NPEVRV KE RAAGVL+N+ EG+KY+EH LRKFVRNKSPEIMP
Sbjct  23   GVAVGICGFQLIRNICINPEVRVTKENRAAGVLDNFAEGEKYSEHFLRKFVRNKSPEIMP  82

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP RN
Sbjct  83   SINNFFTDPNRN  94



>ref|XP_007138129.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
 gb|ESW10123.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
Length=89

 Score =   124 bits (310),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGFQL+RNI  NPEVRVNKEGR AGVLEN+ EG+KY EH LRK+VRN+SPEIMP
Sbjct  18   GAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFSEGEKYTEHFLRKYVRNRSPEIMP  77

Query  182  SLNRFFSDPQRN  217
            SLN FF+DP RN
Sbjct  78   SLNSFFADPSRN  89



>emb|CBI15096.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   124 bits (310),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NP+VRV+KE RAAGVLEN+ EG+KY+EH LRK+VRNKSPEIMP
Sbjct  17   GVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEGQKYSEHFLRKYVRNKSPEIMP  76

Query  182  SLNRFFSDPQRN  217
            S+N FFSDP++N
Sbjct  77   SINSFFSDPEKN  88



>ref|XP_008798028.1| PREDICTED: uncharacterized protein LOC103713044 [Phoenix dactylifera]
Length=92

 Score =   124 bits (310),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG+ YAEH LRKF+R ++PEIMP
Sbjct  23   GVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGETYAEHGLRKFLRTRTPEIMP  82

Query  182  SLNRFFSDPQ  211
            S+NRFF+DP+
Sbjct  83   SINRFFADPK  92



>ref|XP_006856912.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
 gb|ERN18379.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
Length=91

 Score =   123 bits (309),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRVNKE RAAG+LEN+ EG++YAEHSLRKFVRN+SPEIMP
Sbjct  22   GVAVGICGFQLVRNICINPEVRVNKEARAAGILENFTEGERYAEHSLRKFVRNRSPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+N +F+DP+
Sbjct  82   SINGYFTDPK  91



>ref|XP_003527039.1| PREDICTED: uncharacterized protein LOC100499787 [Glycine max]
 gb|KHN19346.1| hypothetical protein glysoja_012266 [Glycine soja]
Length=89

 Score =   123 bits (309),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGFQL+RNI  NPEVRVNKEGR AGVLEN+ EG+KYAEH LRK+VRN++PEIMP
Sbjct  18   GAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAEHFLRKYVRNRTPEIMP  77

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP RN
Sbjct  78   SINSFFADPSRN  89



>ref|XP_006357136.1| PREDICTED: uncharacterized protein LOC102583994 [Solanum tuberosum]
Length=91

 Score =   123 bits (309),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RN+  NPEVRV KE RAAGVLEN+ EG+KYAEH+LRKFVRN+SPEIMP
Sbjct  22   GVAVGICGFQLVRNVCINPEVRVTKENRAAGVLENFSEGEKYAEHTLRKFVRNRSPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  82   SINGFFSDPK  91



>ref|XP_010913425.1| PREDICTED: uncharacterized protein LOC105039118 [Elaeis guineensis]
Length=92

 Score =   123 bits (308),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KEGRAAGVLENY EG+KYAEH LRKF+R ++PEIMP
Sbjct  23   GVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGEKYAEHGLRKFLRTRAPEIMP  82

Query  182  SLNRFFSDPQ  211
            S+NRFF++P+
Sbjct  83   SINRFFANPK  92



>gb|EPS70000.1| hypothetical protein M569_04763, partial [Genlisea aurea]
Length=86

 Score =   122 bits (307),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G+AVGICGFQLIRNIT NPEVRVNK  R+AGVLEN+EEG KY EHSLRKFVRN+ PEIMP
Sbjct  18   GIAVGICGFQLIRNITGNPEVRVNKRDRSAGVLENFEEGHKYKEHSLRKFVRNRKPEIMP  77

Query  182  SLNRFFSDP  208
            +LN FFSDP
Sbjct  78   ALNSFFSDP  86



>ref|XP_010556171.1| PREDICTED: uncharacterized protein LOC104825524 [Tarenaya hassleriana]
Length=88

 Score =   122 bits (307),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI +NPEVRV KE RAAG+LEN+EEG+KY EH LRKFVR+KSPEIMP
Sbjct  19   GVAVGICGMQLVRNICSNPEVRVTKENRAAGILENFEEGEKYKEHRLRKFVRSKSPEIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDPQ
Sbjct  79   SINSFFSDPQ  88



>gb|AGC24177.1| unknown [Rehmannia glutinosa]
Length=93

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QLIRNIT NPEVRV KE RAAGVL+++ EG+KYAEH+LRK+VRN+SPEIMP
Sbjct  23   GVAVGICGMQLIRNITINPEVRVTKENRAAGVLDDFAEGEKYAEHALRKYVRNRSPEIMP  82

Query  182  SLNRFFSDPQ  211
            SLN FF+DP+
Sbjct  83   SLNSFFTDPK  92



>ref|XP_008222037.1| PREDICTED: uncharacterized protein LOC103321965 [Prunus mume]
Length=91

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI TNPEVRVNKE RAAGVL+N+ EG++YAEH LRK+VRNK+P+IMP
Sbjct  19   GVAVGICGMQLVRNIYTNPEVRVNKEKRAAGVLDNHAEGERYAEHRLRKYVRNKTPQIMP  78

Query  182  SLNRFFSDPQ  211
            ++N+FFSDPQ
Sbjct  79   TINKFFSDPQ  88



>ref|XP_006338509.1| PREDICTED: uncharacterized protein LOC102603775 [Solanum tuberosum]
Length=91

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI TNPEVRV KE RAAGVL+N+ EG+KY+EH+LRKFVRNKSPEIMP
Sbjct  22   GVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEGEKYSEHALRKFVRNKSPEIMP  81

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  82   SINGFFSDP  90



>ref|XP_004501964.1| PREDICTED: uncharacterized protein LOC101508877 [Cicer arietinum]
Length=89

 Score =   122 bits (305),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRVNK+ RAAGVLEN+ EG+KY EH LRKF RN+SPEIMP
Sbjct  18   GVAVGICGFQLVRNICINPEVRVNKQTRAAGVLENFSEGEKYTEHLLRKFSRNRSPEIMP  77

Query  182  SLNRFFSDPQRN  217
            ++N FF+DP RN
Sbjct  78   TINSFFTDPSRN  89



>ref|XP_010678668.1| PREDICTED: uncharacterized protein LOC104894188 [Beta vulgaris 
subsp. vulgaris]
Length=91

 Score =   122 bits (305),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRV+KE RAAGVLEN+ EG+KYAEH LRK+VRNK+PEIMP
Sbjct  20   GVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEKYAEHFLRKYVRNKTPEIMP  79

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP RN
Sbjct  80   SINSFFADPTRN  91



>ref|XP_008800943.1| PREDICTED: uncharacterized protein LOC103715180 [Phoenix dactylifera]
Length=121

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV K+ RAAGVL+N+ EG+KYAEH LRKF+RNKSPEIMP
Sbjct  52   GVAVGICGMQLVRNITTNPEVRVTKQNRAAGVLDNFAEGEKYAEHGLRKFIRNKSPEIMP  111

Query  182  SLNRFFSDP  208
            S+N+FFS+P
Sbjct  112  SVNKFFSNP  120



>ref|XP_009760043.1| PREDICTED: uncharacterized protein LOC104212451 [Nicotiana sylvestris]
Length=92

 Score =   122 bits (305),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KYAEH+LRKFVRN++PEIMP
Sbjct  23   GVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGEKYAEHALRKFVRNRAPEIMP  82

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  83   SINGFFSDPK  92



>ref|XP_010027818.1| PREDICTED: uncharacterized protein LOC104418237 [Eucalyptus grandis]
 gb|KCW83385.1| hypothetical protein EUGRSUZ_B00320 [Eucalyptus grandis]
Length=90

 Score =   121 bits (304),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGF L+R+I  NPEVRV KE RAAGVL+N++EG+KYAEHSLRKFVRN+SPEIMP
Sbjct  19   GVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKYAEHSLRKFVRNRSPEIMP  78

Query  182  SLNRFFSDPQRN  217
            SLN FF+ P RN
Sbjct  79   SLNSFFTSPDRN  90



>ref|XP_008792162.1| PREDICTED: uncharacterized protein LOC103708847 [Phoenix dactylifera]
Length=91

 Score =   121 bits (303),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC  QLIRNITTNPEVRV KE RAAGVL+N+ EG+KYAEH LRKF+RNK+PEIMP
Sbjct  22   GTAVGICCMQLIRNITTNPEVRVTKENRAAGVLDNFSEGEKYAEHGLRKFLRNKNPEIMP  81

Query  182  SLNRFFSDP  208
            SLN+FFSDP
Sbjct  82   SLNKFFSDP  90



>ref|XP_009615457.1| PREDICTED: uncharacterized protein LOC104108174 [Nicotiana tomentosiformis]
Length=91

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KYAEH+LRKFVRNKSPEIMP
Sbjct  22   GVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEGEKYAEHALRKFVRNKSPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  82   SINGFFSDPK  91



>gb|KHG12689.1| Uncharacterized protein F383_19724 [Gossypium arboreum]
Length=89

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL N+EEG+KYAEH LRKFVRN+ P+IMP
Sbjct  20   GVAVGICAMQLVRNITTNPEVRVTKENRAAGVLNNFEEGEKYAEHGLRKFVRNRQPQIMP  79

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  80   SVNNFFSDPK  89



>ref|XP_010272106.1| PREDICTED: uncharacterized protein LOC104607987 [Nelumbo nucifera]
Length=90

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KE RAAGVLEN+ EG+KYAEH+LRKFVRN++PEIMP
Sbjct  21   GVAVGICGFQLVRNICINPEVRVSKETRAAGVLENFSEGEKYAEHTLRKFVRNRTPEIMP  80

Query  182  SLNRFFSDPQ  211
            S+N FF++P+
Sbjct  81   SINNFFTNPK  90



>ref|XP_006845122.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
 gb|ERN06797.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
Length=91

 Score =   120 bits (302),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICG QL+RNI TNP+VRV KE R+AGVLEN+ EG++YA+HSLRKFVRNKSPEIMP
Sbjct  22   GTAVGICGLQLVRNIRTNPDVRVTKEKRSAGVLENFAEGERYAQHSLRKFVRNKSPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+N+FF+DP+
Sbjct  82   SINKFFTDPK  91



>ref|XP_004236155.1| PREDICTED: uncharacterized protein LOC101260417 [Solanum lycopersicum]
Length=90

 Score =   120 bits (302),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GICG QL+RN+  NPEVRVNKE RAAG+LEN+EEG+KYAEH++RKF R++ PEI P
Sbjct  19   GVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKYAEHAIRKFARSRPPEIFP  78

Query  182  SLNRFFSDPQRN  217
            +LNRFFSDPQ+N
Sbjct  79   NLNRFFSDPQKN  90



>ref|XP_011085792.1| PREDICTED: uncharacterized protein LOC105167687 [Sesamum indicum]
Length=93

 Score =   120 bits (302),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRV KE RAAGVLEN+ EG+KYAEH+LRKFVRN++PEIMP
Sbjct  23   GVAVGICGMQLVRNICINPEVRVTKENRAAGVLENFAEGEKYAEHALRKFVRNRAPEIMP  82

Query  182  SLNRFFSDPQ  211
            S+N FF+DP+
Sbjct  83   SINSFFTDPK  92



>ref|XP_003523058.1| PREDICTED: uncharacterized protein LOC100500534 [Glycine max]
Length=89

 Score =   120 bits (302),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGFQL+RNI  NPEVRVNKEGR AGVLEN+ EG+KYAEH LRK+VRN++PEIMP
Sbjct  18   GAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAEHFLRKYVRNRTPEIMP  77

Query  182  SLNRFFSDPQRN  217
            S+N FF+D  RN
Sbjct  78   SINSFFADTSRN  89



>ref|XP_002270661.1| PREDICTED: uncharacterized protein LOC100259604 [Vitis vinifera]
 emb|CBI27548.3| unnamed protein product [Vitis vinifera]
Length=93

 Score =   120 bits (302),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI TNPEVRV K+ R AGVLEN+EEG++YAEH LRKFVRNK P+IMP
Sbjct  22   GVAVGICGMQLVRNICTNPEVRVTKQNRTAGVLENFEEGERYAEHRLRKFVRNKEPQIMP  81

Query  182  SLNRFFSDP  208
            S+N+FFSDP
Sbjct  82   SINKFFSDP  90



>ref|XP_009627555.1| PREDICTED: uncharacterized protein LOC104118078 [Nicotiana tomentosiformis]
Length=149

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GICG QL+RN+  NPEVRV+KE RAAGVLEN+EEG+KYAEH++RKF R++ PEI P
Sbjct  78   GVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLENFEEGEKYAEHAVRKFARSRPPEIFP  137

Query  182  SLNRFFSDPQRN  217
            SLNRFFSDPQ+N
Sbjct  138  SLNRFFSDPQKN  149



>ref|XP_010907762.1| PREDICTED: uncharacterized protein LOC105034337 [Elaeis guineensis]
Length=91

 Score =   120 bits (301),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVG+CG QL+RNITTNPEVRV K+ RAAGVL+N+ EG+KYAEH LRKF+RNK+PEIMP
Sbjct  22   GVAVGMCGMQLVRNITTNPEVRVTKQNRAAGVLDNFAEGEKYAEHGLRKFLRNKAPEIMP  81

Query  182  SLNRFFSDP  208
            S+N+FFS P
Sbjct  82   SVNKFFSSP  90



>ref|XP_007226455.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
 gb|EMJ27654.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
Length=91

 Score =   120 bits (301),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICG QL+RNI TNP+VRVNKE RAAGVL+N+ EG++YAEH LRK+VRNK+P+IMP
Sbjct  19   GAAVGICGMQLVRNIYTNPDVRVNKENRAAGVLDNHAEGERYAEHGLRKYVRNKTPQIMP  78

Query  182  SLNRFFSDPQ  211
            ++N+FFSDPQ
Sbjct  79   TINKFFSDPQ  88



>ref|XP_006344997.1| PREDICTED: uncharacterized protein LOC102605944 [Solanum tuberosum]
Length=90

 Score =   120 bits (301),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GICG QL+RN+  NPEVRVNKE RAAG+LEN+EEG+KYAEH++RKF R++ PEI P
Sbjct  19   GVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKYAEHAVRKFARSRPPEIFP  78

Query  182  SLNRFFSDPQRN  217
            +LNRFFSDPQ+N
Sbjct  79   NLNRFFSDPQKN  90



>ref|XP_009785405.1| PREDICTED: uncharacterized protein LOC104233674 [Nicotiana sylvestris]
Length=90

 Score =   120 bits (301),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GICG QL+RN+  NPEVRV+KE RAAGVL+N+EEG+KYAEH++RKF R++ PEI P
Sbjct  19   GVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLDNFEEGQKYAEHAVRKFARSRPPEIFP  78

Query  182  SLNRFFSDPQRN  217
            SLNRFFSDPQ+N
Sbjct  79   SLNRFFSDPQKN  90



>ref|XP_010027794.1| PREDICTED: uncharacterized protein LOC104418219 [Eucalyptus grandis]
 gb|KCW83389.1| hypothetical protein EUGRSUZ_B00324 [Eucalyptus grandis]
Length=90

 Score =   120 bits (301),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGF L+R+I  NPEVRV KE RAAGVL+N++EG+KY EHSLRKFVRN+SPEIMP
Sbjct  19   GVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKYTEHSLRKFVRNRSPEIMP  78

Query  182  SLNRFFSDPQRN  217
            SLN FF+ P RN
Sbjct  79   SLNSFFTSPDRN  90



>gb|KJB30971.1| hypothetical protein B456_005G172200 [Gossypium raimondii]
Length=89

 Score =   120 bits (300),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNP+VRV KE RAAGVL N+EEG+KYAEH LRKFVRN+ P+IMP
Sbjct  20   GVAVGICAMQLVRNITTNPDVRVTKENRAAGVLNNFEEGEKYAEHGLRKFVRNRQPQIMP  79

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  80   SVNNFFSDPK  89



>ref|XP_011098540.1| PREDICTED: uncharacterized protein LOC105177185 [Sesamum indicum]
Length=93

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KYAEH+LRKFVRN++PEIMP
Sbjct  23   GVAVGICGMQLVRNICINPEVRVTKENRAAGVLDNFAEGEKYAEHALRKFVRNRAPEIMP  82

Query  182  SLNRFFSDPQ  211
            S+N FF+DP+
Sbjct  83   SINSFFTDPK  92



>ref|XP_004232259.1| PREDICTED: uncharacterized protein LOC101265497 [Solanum lycopersicum]
Length=91

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI TNPEVRV KE RAAGVL+N+ EG+KY+EH+LRKFVRNKSPEIMP
Sbjct  22   GVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEGEKYSEHALRKFVRNKSPEIMP  81

Query  182  SLNRFFSDP  208
            S+N FFS+P
Sbjct  82   SINGFFSNP  90



>ref|XP_009403647.1| PREDICTED: uncharacterized protein LOC103987158 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICG QLIRNI  NPEVRV KE RAAGVL+N++EG+KYAEH LRKFVRNKSP+IMP
Sbjct  19   GTAVGICGMQLIRNICINPEVRVTKENRAAGVLDNFQEGEKYAEHGLRKFVRNKSPQIMP  78

Query  182  SLNRFFSDP  208
            SLN +FSDP
Sbjct  79   SLNNYFSDP  87



>ref|XP_009588369.1| PREDICTED: uncharacterized protein LOC104085953 [Nicotiana tomentosiformis]
Length=92

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA GICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KYAEH+LRKFVRN++PEIMP
Sbjct  23   GVAFGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGEKYAEHALRKFVRNRAPEIMP  82

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  83   SINGFFSDPK  92



>ref|XP_009771458.1| PREDICTED: uncharacterized protein LOC104221988 [Nicotiana sylvestris]
Length=91

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KYAEH+LRKFVRNKSPEIMP
Sbjct  22   GVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEGEKYAEHALRKFVRNKSPEIMP  81

Query  182  SLNRFFSDPQ  211
            ++N FFSDP+
Sbjct  82   NINGFFSDPK  91



>ref|NP_001148351.1| LOC100281961 [Zea mays]
 gb|ACG30961.1| B12D protein [Zea mays]
 gb|AFW85170.1| b12D protein [Zea mays]
Length=87

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA H LR FV +K+PEIMP
Sbjct  18   GVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRSFVHDKTPEIMP  77

Query  182  SLNRFFSDPQ  211
            ++N+FF+DP+
Sbjct  78   AINKFFTDPK  87



>ref|NP_001057280.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|AAB65433.1| HvB12D homolog [Oryza sativa]
 gb|AAL76334.1| putative G-box binding protein [Oryza sativa]
 dbj|BAD45657.1| G-box binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF19194.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|ABR25364.1| senescence associated protein [Oryza sativa Indica Group]
 gb|ACJ54927.1| G-box binding protein [Oryza sativa Japonica Group]
 dbj|BAG94133.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99740.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00561.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80316.1| hypothetical protein OsI_22358 [Oryza sativa Indica Group]
 gb|EEE65438.1| hypothetical protein OsJ_20800 [Oryza sativa Japonica Group]
Length=89

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YAEH LR +VR+K+PEIMP
Sbjct  19   GVAVGICGFQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRYAEHGLRNYVRDKTPEIMP  78

Query  182  SLNRFFSDPQR  214
            ++N+FF++P +
Sbjct  79   AINKFFTEPTK  89



>ref|XP_010111964.1| hypothetical protein L484_004741 [Morus notabilis]
 gb|EXC32238.1| hypothetical protein L484_004741 [Morus notabilis]
Length=93

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GICGFQL+RNI  NPEVRV+KE RAAGVL+N+ EG+KY+EH LRK+VRN++PEIMP
Sbjct  22   GVAIGICGFQLVRNICINPEVRVSKETRAAGVLDNFAEGEKYSEHFLRKYVRNRAPEIMP  81

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP R+
Sbjct  82   SINSFFTDPNRS  93



>ref|XP_007163724.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
 gb|ESW35718.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
Length=89

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV K+ RAAG+LEN+EEG+KY+EHSLRK+VR K+P+IMP
Sbjct  19   GVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFEEGEKYSEHSLRKYVRGKNPQIMP  78

Query  182  SLNRFFSDP  208
            S+N FFS+P
Sbjct  79   SVNNFFSEP  87



>ref|XP_008340166.1| PREDICTED: uncharacterized protein LOC103403120 [Malus domestica]
 ref|XP_008361836.1| PREDICTED: uncharacterized protein LOC103425520 [Malus domestica]
Length=92

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNIT+NPEVRV K+ R AGVLEN+EEG++YAEH LRK+VR ++P+IMP
Sbjct  20   GVAVGICGMQLVRNITSNPEVRVTKQNRTAGVLENHEEGERYAEHGLRKYVRTRAPQIMP  79

Query  182  SLNRFFSDPQ  211
            S+N++FSDPQ
Sbjct  80   SINKYFSDPQ  89



>emb|CAK22419.1| B12D-like protein [Beta vulgaris]
Length=91

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRV+KE RAAGVLEN+ EG+KYAEH LRK+VRNK+PEIMP
Sbjct  20   GVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEKYAEHFLRKYVRNKTPEIMP  79

Query  182  SLNRFFSDPQRN  217
            S+N FF+D  RN
Sbjct  80   SINSFFADSTRN  91



>ref|XP_010415343.1| PREDICTED: uncharacterized protein LOC104701372 [Camelina sativa]
Length=89

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI+TNPEVRV KE R AG+LEN+ EG++YAEH LRKFVRNK+P+IMP
Sbjct  19   GVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGERYAEHGLRKFVRNKAPQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  79   SINGFFSDPK  88



>ref|NP_001152717.1| LOC100286358 [Zea mays]
 gb|ACG30827.1| B12D protein [Zea mays]
 gb|ACG49122.1| B12D protein [Zea mays]
 gb|AFW76867.1| b12D protein [Zea mays]
Length=87

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA H LR FV +K+PEIMP
Sbjct  18   GVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRSFVHDKTPEIMP  77

Query  182  SLNRFFSDPQ  211
            ++N+FF+DP+
Sbjct  78   AVNKFFTDPK  87



>gb|ADB08699.1| B12D-like protein [Wolffia arrhiza]
 gb|AEI83500.1| B12D [Wolffia arrhiza]
 gb|AEQ39050.1| putative B12D-like protein [Wolffia arrhiza]
Length=91

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RN+  NPEVRV+KEGRA+GVLEN+ EG++YAEHSLRKF+RNK PEIMP
Sbjct  22   GVAVGICGFQLVRNVCINPEVRVSKEGRASGVLENFAEGERYAEHSLRKFLRNKRPEIMP  81

Query  182  SLNRFFSDPQ  211
            S+N FF++P+
Sbjct  82   SINGFFANPK  91



>gb|ACU15648.1| unknown [Glycine max]
Length=89

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGFQL+R+I  NPEVRVNKEGR AGVLEN+ EG+KYAEH LRK+VRN++PEIMP
Sbjct  18   GAAVGICGFQLVRSICINPEVRVNKEGRKAGVLENFAEGEKYAEHFLRKYVRNRTPEIMP  77

Query  182  SLNRFFSDPQRN  217
            S+N FF+D  RN
Sbjct  78   SINSFFADTSRN  89



>ref|XP_002311729.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
 gb|EEE89096.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
Length=92

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNI TNPEVRV KE RAAGVL+N++EG+KYAEH LRKFVRNK+P+IMP
Sbjct  19   GVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKYAEHGLRKFVRNKTPQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP 
Sbjct  79   SINGFFSDPD  88



>ref|XP_003564009.1| PREDICTED: uncharacterized protein LOC100821381 [Brachypodium 
distachyon]
Length=88

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC FQL+RNIT NPEVRV+K GRAAGVL+N+EEG++YAEH LR FVR+K+PEIMP
Sbjct  19   GVAVGICAFQLLRNITGNPEVRVSKVGRAAGVLDNHEEGRRYAEHGLRSFVRDKTPEIMP  78

Query  182  SLNRFFSDPQ  211
             +N+FF+DP+
Sbjct  79   GINKFFTDPK  88



>ref|XP_010930055.1| PREDICTED: uncharacterized protein LOC105051361 [Elaeis guineensis]
Length=91

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC  QL+RNITTNPEVRV KE RAAGVLEN+ EG++YAEH LRKF+R+K+PEIMP
Sbjct  22   GTAVGICCMQLVRNITTNPEVRVTKENRAAGVLENFSEGERYAEHGLRKFLRSKNPEIMP  81

Query  182  SLNRFFSDP  208
            SLN+FFSDP
Sbjct  82   SLNKFFSDP  90



>gb|KHG26447.1| Uncharacterized protein F383_04740 [Gossypium arboreum]
 gb|KJB07848.1| hypothetical protein B456_001G047700 [Gossypium raimondii]
Length=87

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KY+EH LRK+VRNK+PEIMP
Sbjct  18   GVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFAEGEKYSEHFLRKYVRNKTPEIMP  77

Query  182  SLNRFFSDPQ  211
            S+N FF+DP+
Sbjct  78   SINSFFTDPK  87



>ref|XP_011029641.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
 ref|XP_011029642.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
Length=92

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNI TNPEVRV KE RAAGVL+N++EG+KYAEH LRKFVRNK+P+IMP
Sbjct  19   GVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKYAEHGLRKFVRNKTPQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP 
Sbjct  79   SINGFFSDPD  88



>ref|XP_007209803.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
 gb|EMJ11002.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
Length=90

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG  L R+IT NPEVRV+KE RAAG+LEN++EG+KY EH LRKFVRNKSPEIMP
Sbjct  19   GVAVGICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKYKEHFLRKFVRNKSPEIMP  78

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP RN
Sbjct  79   SVNGFFTDPSRN  90



>gb|AEC10990.1| b12d-like protein [Camellia sinensis]
Length=91

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRVNKE  AAGVL+N+ EG+KYAEH +RKFVRNKSPEIMP
Sbjct  22   GVAVGICGFQLVRNICINPEVRVNKEKGAAGVLDNHAEGEKYAEHFVRKFVRNKSPEIMP  81

Query  182  SLNRFFSDPQ  211
            ++N+FF+DP+
Sbjct  82   AVNKFFTDPK  91



>ref|XP_003551877.1| PREDICTED: uncharacterized protein LOC100500344 [Glycine max]
 gb|KHN24095.1| hypothetical protein glysoja_025268 [Glycine soja]
Length=89

 Score =   118 bits (296),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV K+ RAAG+LEN+ EG+KY++HSLRK+VR K P+IMP
Sbjct  19   GVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHSLRKYVRGKQPQIMP  78

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  79   SVNNFFSDP  87



>emb|CDP02170.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   118 bits (296),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QLIRNI  NPEVRV KE RAAGVLEN+ EG+KYAEH+LRKFVRN++P+IMP
Sbjct  22   GVAVGICGAQLIRNICINPEVRVTKENRAAGVLENHAEGEKYAEHALRKFVRNRAPQIMP  81

Query  182  SLNRFFSDPQ  211
            S+N FFS PQ
Sbjct  82   SVNNFFSKPQ  91



>ref|XP_010942172.1| PREDICTED: uncharacterized protein LOC105060250 isoform X1 [Elaeis 
guineensis]
Length=105

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 14/84 (17%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVR--------------VNKEGRAAGVLENYEEGKKYAEHS  139
            GVAVGICGFQL+RNI  NPEVR              V+KEGRAAGVLENY EG+KYAEH 
Sbjct  22   GVAVGICGFQLVRNICINPEVRYGDVLFHTYGDFTRVSKEGRAAGVLENYAEGQKYAEHG  81

Query  140  LRKFVRNKSPEIMPSLNRFFSDPQ  211
            LR+FVRNK+PEIMPS+NRFF+DP+
Sbjct  82   LRRFVRNKAPEIMPSINRFFADPK  105



>ref|XP_010470676.1| PREDICTED: uncharacterized protein LOC104750563 [Camelina sativa]
Length=134

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI+TNPEVRV KE R AG+LEN+ EG++YAEH LRKFVRNK+P+IMP
Sbjct  64   GVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGERYAEHGLRKFVRNKAPQIMP  123

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  124  SINGFFSDPK  133



>ref|XP_011042304.1| PREDICTED: uncharacterized protein LOC105138023 [Populus euphratica]
Length=92

 Score =   118 bits (296),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV KE RAAGVL+N++EG+KYAEH LRK+VR ++P+IMP
Sbjct  19   GVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGEKYAEHGLRKYVRKRTPQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP 
Sbjct  79   SINGFFSDPD  88



>ref|XP_002438146.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
 gb|EER89513.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
Length=87

 Score =   118 bits (295),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA H LR FV  K+PEIMP
Sbjct  18   GVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRSFVHEKTPEIMP  77

Query  182  SLNRFFSDPQ  211
            ++N+FF+DP+
Sbjct  78   AINKFFTDPK  87



>ref|XP_010511712.1| PREDICTED: uncharacterized protein LOC104787778 [Camelina sativa]
Length=89

 Score =   118 bits (295),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI+TNPEVRV KE R AG+L+N+ EG++YAEH LRKFVRNK+P+IMP
Sbjct  19   GVAVGICGMQLVRNISTNPEVRVTKENRTAGILDNHAEGERYAEHGLRKFVRNKAPQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  79   SINGFFSDPK  88



>gb|AFW76868.1| hypothetical protein ZEAMMB73_758599, partial [Zea mays]
Length=141

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA H LR FV +K+PEIMP
Sbjct  72   GVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRSFVHDKTPEIMP  131

Query  182  SLNRFFSDPQ  211
            ++N+FF+DP+
Sbjct  132  AVNKFFTDPK  141



>gb|ACU15396.1| unknown [Glycine max]
Length=89

 Score =   118 bits (295),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV K+ RAAG+LEN+ EG+KY++HSLRK+VR K P++MP
Sbjct  19   GVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHSLRKYVRGKQPQVMP  78

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  79   SVNNFFSDP  87



>ref|XP_006439727.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 ref|XP_006476687.1| PREDICTED: uncharacterized protein LOC102617192 [Citrus sinensis]
 gb|ESR52967.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 gb|KDO69809.1| hypothetical protein CISIN_1g034649mg [Citrus sinensis]
Length=88

 Score =   117 bits (294),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRV K+ RAAGVLENY EG+KY+EH LRK+VRNK+PEIMP
Sbjct  19   GVAVGICGMQLVRNICINPEVRVTKQNRAAGVLENYAEGEKYSEHFLRKYVRNKTPEIMP  78

Query  182  SLNRFFSDPQ  211
             +N FF+DPQ
Sbjct  79   KINSFFTDPQ  88



>ref|XP_010546014.1| PREDICTED: uncharacterized protein LOC104818223 [Tarenaya hassleriana]
Length=88

 Score =   117 bits (294),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGFQL+RNI  NPEVRV+KE RAAGVLEN+ EG++YAEH +R+FVRNK PEIMP
Sbjct  18   GAAVGICGFQLVRNICINPEVRVSKENRAAGVLENFAEGERYAEHFVRRFVRNKDPEIMP  77

Query  182  SLNRFFSDPQ  211
            S+N+FF+DP+
Sbjct  78   SINKFFTDPK  87



>ref|XP_011042649.1| PREDICTED: uncharacterized protein LOC105138299 [Populus euphratica]
Length=90

 Score =   117 bits (294),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNI  NPEVRV K+ RAAGVLEN+ EG+KY+EH LRK VRN+SPEIMP
Sbjct  19   GVAVGICGFQLARNICINPEVRVTKQNRAAGVLENFSEGEKYSEHGLRKLVRNRSPEIMP  78

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP+ N
Sbjct  79   SINNFFTDPKLN  90



>ref|XP_004142944.1| PREDICTED: uncharacterized protein LOC101222643 [Cucumis sativus]
 ref|XP_004159555.1| PREDICTED: uncharacterized protein LOC101224466 [Cucumis sativus]
 gb|KGN62359.1| hypothetical protein Csa_2G350420 [Cucumis sativus]
Length=89

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N+EEG+KYAEH LRKF+R + P+IMP
Sbjct  20   GVAVGICAMQLVRNITTNPEVRVIKERRAAGVLDNFEEGEKYAEHGLRKFLRTRPPQIMP  79

Query  182  SLNRFFSDP  208
            S+N+FFSDP
Sbjct  80   SINKFFSDP  88



>emb|CDP14927.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GICGF L+RNI  NPEVRV K+ RAAGVLEN+ EG+KYAEH+LRK+VRN+ PEIMP
Sbjct  22   GVAIGICGFSLVRNICINPEVRVAKQDRAAGVLENFAEGEKYAEHALRKYVRNRKPEIMP  81

Query  182  SLNRFFSDPQRN  217
            S+N FF++P++N
Sbjct  82   SINSFFTEPEKN  93



>ref|XP_004965125.1| PREDICTED: uncharacterized protein LOC101762161 [Setaria italica]
Length=87

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA H LR FV +K+PEIMP
Sbjct  18   GVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRSFVHDKTPEIMP  77

Query  182  SLNRFFSDPQ  211
            ++N+FF++P+
Sbjct  78   AINKFFTEPK  87



>gb|AFO59572.1| B12D like protein [Saccharum hybrid cultivar GT28]
 gb|AHB79077.1| B12D-like protein [Saccharum hybrid cultivar]
Length=87

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNIT NPEVRVNK GRAAGVLEN+EEG++YA H LR FV +K+PEIMP
Sbjct  18   GVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRSFVHDKTPEIMP  77

Query  182  SLNRFFSDPQ  211
            ++N+FF++P+
Sbjct  78   AINKFFTEPK  87



>gb|EPS70497.1| hypothetical protein M569_04271, partial [Genlisea aurea]
Length=79

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVG+CG QLIRNIT NPEVRVNK  R AGVL+N+EEG+KYA+HS+RKFVR +SPEIMP
Sbjct  9    GVAVGLCGMQLIRNITINPEVRVNKMNRGAGVLDNFEEGEKYAQHSVRKFVRKRSPEIMP  68

Query  182  SLNRFFSDP  208
            S+N FFS+P
Sbjct  69   SINHFFSEP  77



>gb|ACU16637.1| unknown [Glycine max]
Length=89

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV K+ R AG+LEN+ EG+KY++HSLRK+VR K P+IMP
Sbjct  19   GVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKYSQHSLRKYVRGKQPQIMP  78

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  79   SVNNFFSDP  87



>ref|XP_008239697.1| PREDICTED: uncharacterized protein LOC103338283 [Prunus mume]
Length=90

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAV ICG  L R+IT NPEVRV+KE RAAG+LEN++EG+KY EH LRKFVRNKSPEIMP
Sbjct  19   GVAVAICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKYKEHFLRKFVRNKSPEIMP  78

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP RN
Sbjct  79   SVNGFFTDPSRN  90



>ref|XP_002314553.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
 gb|EEF00724.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
Length=163

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV KE RAAGVL+N++EG+KYAEH LRK+VR ++P+IMP
Sbjct  90   GVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGEKYAEHGLRKYVRKRTPQIMP  149

Query  182  SLNRFFSDPQ  211
            S+N FFSDP 
Sbjct  150  SINGFFSDPD  159



>ref|XP_003538567.1| PREDICTED: uncharacterized protein LOC100527541 [Glycine max]
Length=89

 Score =   117 bits (292),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV K+ R AG+LEN+ EG+KY++HSLRK+VR K P+IMP
Sbjct  19   GVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKYSQHSLRKYVRGKQPQIMP  78

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  79   SVNNFFSDP  87



>gb|ACJ84101.1| unknown [Medicago truncatula]
 gb|AFK34497.1| unknown [Medicago truncatula]
 gb|KEH35090.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=90

 Score =   117 bits (292),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC F L+RNI  NPEVRVNK+ RAAGVLEN+ EG+KY EH LRKF RN+SPEIMP
Sbjct  19   GAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKYTEHLLRKFSRNRSPEIMP  78

Query  182  SLNRFFSDPQRN  217
             LN FF+DP RN
Sbjct  79   GLNSFFTDPSRN  90



>ref|XP_006655963.1| PREDICTED: uncharacterized protein LOC102707968 [Oryza brachyantha]
Length=88

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAV ICG QL RNIT NPEVRVNK GRAAGVLEN+EEG++YAEH LR FVR+K+PEIMP
Sbjct  19   GVAVAICGMQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRYAEHGLRNFVRDKTPEIMP  78

Query  182  SLNRFFSDPQ  211
            ++N+FF++P+
Sbjct  79   TINKFFTEPK  88



>ref|XP_002511469.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52071.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC FQL+RNI  NPEVRVNK+ RAAGVLEN++EG+KY+E+ LRKFVRNK+PEIMP
Sbjct  19   GVAVGICSFQLVRNICINPEVRVNKQNRAAGVLENFKEGEKYSENFLRKFVRNKTPEIMP  78

Query  182  SLNRFFSDP  208
            S+NRFF++P
Sbjct  79   SINRFFTEP  87



>ref|XP_006376832.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
 gb|ERP54629.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
Length=82

 Score =   116 bits (290),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNI  NPEVRV K+ RAAGVL+N+ EG+KY+EH LRK VRN+SP+IMP
Sbjct  11   GVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKYSEHGLRKLVRNRSPQIMP  70

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP+ N
Sbjct  71   SINNFFTDPKLN  82



>ref|XP_010255359.1| PREDICTED: uncharacterized protein LOC104596051 [Nelumbo nucifera]
Length=90

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL+RNI  NPEVRV+KE R AGVLEN+ EG+KYAEH+LRKFVRN++PEIMP
Sbjct  21   GVAVGICGFQLVRNICINPEVRVSKETRTAGVLENFAEGEKYAEHTLRKFVRNRTPEIMP  80

Query  182  SLNRFFSD  205
            S+N FF++
Sbjct  81   SINNFFTN  88



>ref|XP_004502329.1| PREDICTED: uncharacterized protein LOC101491577 [Cicer arietinum]
Length=88

 Score =   116 bits (290),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNIT NP+VRV K+ RAAGVL+N+ EG+KY++H+LRKFVRNKS +IMP
Sbjct  19   GVAVGICGMQLVRNITGNPDVRVTKQNRAAGVLDNFSEGEKYSQHTLRKFVRNKSSQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  79   SVNNFFSDPK  88



>ref|XP_002515002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47556.1| conserved hypothetical protein [Ricinus communis]
Length=93

 Score =   115 bits (289),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI TNPEVRV KE RAAGVL+N+ EG++Y EH LRKFVRN+SP+IMP
Sbjct  19   GVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFAEGERYKEHGLRKFVRNRSPQIMP  78

Query  182  SLNRFFSDPQ  211
            SLN FFS+P 
Sbjct  79   SLNGFFSEPD  88



>gb|KHN44408.1| hypothetical protein glysoja_014449 [Glycine soja]
Length=89

 Score =   115 bits (289),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNITTNPEVRV K  R AG+LEN+ EG+KY++HSLRK+VR K P+IMP
Sbjct  19   GVAVGICGMQLVRNITTNPEVRVTKRNRTAGILENFAEGEKYSQHSLRKYVRGKQPQIMP  78

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  79   SVNNFFSDP  87



>ref|XP_002318014.1| senescence-associated family protein [Populus trichocarpa]
 gb|ABK94203.1| unknown [Populus trichocarpa]
 gb|EEE96234.1| senescence-associated family protein [Populus trichocarpa]
Length=90

 Score =   115 bits (289),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGFQL RNI  NPEVRV K+ RAAGVL+N+ EG+KY+EH LRK VRN+SP+IMP
Sbjct  19   GVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKYSEHGLRKLVRNRSPQIMP  78

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP+ N
Sbjct  79   SINNFFTDPKLN  90



>gb|AFK33307.1| unknown [Medicago truncatula]
Length=90

 Score =   115 bits (288),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC F L+RNI  NPEVRVNK+ RAAGVLEN+ EG+KY EH LR+F RN+SPEIMP
Sbjct  19   GAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKYTEHLLRRFSRNRSPEIMP  78

Query  182  SLNRFFSDPQRN  217
             LN FF+DP RN
Sbjct  79   GLNSFFTDPSRN  90



>ref|XP_007036078.1| B12D protein [Theobroma cacao]
 gb|EOY20579.1| B12D protein [Theobroma cacao]
Length=87

 Score =   115 bits (288),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
             VAVGICG QL+RNI  NPEVRVNKE RAAGVL+N+ EG+KYAEH +RK+VRN++PEIMP
Sbjct  18   SVAVGICGLQLVRNICINPEVRVNKENRAAGVLDNFAEGEKYAEHFVRKYVRNRAPEIMP  77

Query  182  SLNRFFSDPQ  211
            S+N FF+DP+
Sbjct  78   SINSFFTDPK  87



>ref|XP_010692143.1| PREDICTED: uncharacterized protein LOC104905334 [Beta vulgaris 
subsp. vulgaris]
Length=89

 Score =   115 bits (288),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGFQL+RNI  NPEVRVNKE RAAGVL+N++EG+KYAEH +RKF R +S EIMP
Sbjct  20   GAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNHKEGEKYAEHFIRKFSRTQSAEIMP  79

Query  182  SLNRFFSDPQ  211
             LN+FFSDPQ
Sbjct  80   GLNKFFSDPQ  89



>ref|XP_006391239.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
 gb|ESQ28525.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
Length=89

 Score =   115 bits (288),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNI+TNPEVRV K+ R AGVL+N+ EG+KYAEH LRKFVRNK+P+IMP
Sbjct  19   GVAVGICVMQLVRNISTNPEVRVTKQNRIAGVLDNFAEGEKYAEHGLRKFVRNKTPQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  79   SINGFFSDPK  88



>ref|XP_010550670.1| PREDICTED: uncharacterized protein LOC104821467 [Tarenaya hassleriana]
Length=86

 Score =   115 bits (287),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGFQL+RNI  NPEVRVNKE RAAGVL+N+ EG++YAEH LRKFVRNK PEIMP
Sbjct  18   GAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNFAEGERYAEHFLRKFVRNKGPEIMP  77

Query  182  SLNRFFSD  205
            S+N+FF++
Sbjct  78   SINKFFTE  85



>gb|KDP26755.1| hypothetical protein JCGZ_17913 [Jatropha curcas]
Length=93

 Score =   114 bits (286),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NP+VRV KE RAAGVL+N+ EG+KYAEH LRKFVR K P+IMP
Sbjct  19   GVAVGICGMQLVRNICINPDVRVTKEKRAAGVLDNFAEGEKYAEHGLRKFVRKKQPQIMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDP 
Sbjct  79   SINGFFSDPD  88



>ref|XP_008374479.1| PREDICTED: uncharacterized protein LOC103437758 [Malus domestica]
Length=90

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG  L R+IT NPEVRV KE RAAGVL+N+ EG+KY EH LRKFVRNK+PEIMP
Sbjct  19   GVAVGICGLSLFRHITINPEVRVTKENRAAGVLDNHAEGEKYKEHFLRKFVRNKAPEIMP  78

Query  182  SLNRFFSDPQRN  217
             +N FF+DP +N
Sbjct  79   GINAFFTDPSKN  90



>gb|EMT09386.1| hypothetical protein F775_07588 [Aegilops tauschii]
Length=87

 Score =   114 bits (284),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GIC F L+RNIT NPEVRVNK GRAAGVLEN+EEG++YAEH LR +V++K+PEIMP
Sbjct  18   GVAIGICAFSLLRNITGNPEVRVNKMGRAAGVLENHEEGRRYAEHGLRAYVQDKTPEIMP  77

Query  182  SLNRFFSDPQ  211
             +N+FF+ P+
Sbjct  78   GINKFFTSPK  87



>gb|AFK36649.1| unknown [Lotus japonicus]
Length=88

 Score =   113 bits (282),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G+AVGICG QL+RNI+TNPEVRV K+ RAAG+L+N+EEG+KY++H +RKFVR K  +IMP
Sbjct  19   GIAVGICGMQLVRNISTNPEVRVTKQNRAAGILDNFEEGEKYSQHFVRKFVRGKDTQIMP  78

Query  182  SLNRFFSDP  208
            S+N+FFSDP
Sbjct  79   SINKFFSDP  87



>gb|KCW61991.1| hypothetical protein EUGRSUZ_H04674, partial [Eucalyptus grandis]
Length=135

 Score =   114 bits (285),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QLIRNI TNPEVRV KE RAAGVL+N+ EG+KY++H +R+FVRN+ P++MP
Sbjct  66   GVAVGICGMQLIRNICTNPEVRVTKEKRAAGVLDNFAEGEKYSQHVVRRFVRNRPPQVMP  125

Query  182  SLNRFFSDPQ  211
            S+N FFSDP+
Sbjct  126  SINNFFSDPK  135



>gb|AFK42697.1| unknown [Lotus japonicus]
Length=89

 Score =   112 bits (281),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG QL+RNI  NPEVRVNK+ RAAGVL+N+ EG+KY EH +RKF R  S EIMP
Sbjct  18   GVAVGICGMQLVRNICINPEVRVNKQNRAAGVLDNFSEGEKYTEHFIRKFARTSSREIMP  77

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP RN
Sbjct  78   SINSFFADPSRN  89



>ref|XP_006404294.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
 gb|ESQ45747.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
Length=88

 Score =   112 bits (281),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICGF LIRNIT NPEVRV KE RAAGVL+N+ EG+KY E+ LRK+VRNK PEIMP
Sbjct  18   GVAVGICGFSLIRNITGNPEVRVTKENRAAGVLDNHAEGEKYKENFLRKYVRNKHPEIMP  77

Query  182  SLNRFFSDPQ  211
             +N+FF+DP+
Sbjct  78   GINKFFTDPK  87



>emb|CAA54065.1| HvB12D [Hordeum vulgare subsp. vulgare]
 emb|CAA70936.1| B12Dg1 [Hordeum vulgare subsp. vulgare]
Length=87

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GIC F L+RNIT NPEVRV+K GRAAGVLEN+EEG++YAEH LR +V++K+PEIMP
Sbjct  18   GVAIGICAFSLLRNITGNPEVRVSKMGRAAGVLENHEEGRRYAEHGLRAYVQDKTPEIMP  77

Query  182  SLNRFFSDPQ  211
             +N+FF+ P+
Sbjct  78   GINKFFTSPK  87



>ref|XP_011086732.1| PREDICTED: uncharacterized protein LOC105168371 [Sesamum indicum]
Length=86

 Score =   111 bits (278),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICG QLIRNI TNPEVRV KE RAAGVL+NYEEG+KYA+H+ RK++R + P+IMP
Sbjct  17   GFAVGICGMQLIRNICTNPEVRVTKENRAAGVLQNYEEGEKYADHAFRKYLRGQHPQIMP  76

Query  182  SLNRFFSDPQ  211
             +NR+FS P+
Sbjct  77   GINRYFSKPE  86



>gb|KFK34105.1| b12d protein [Arabis alpina]
Length=90

 Score =   111 bits (277),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC F LIRNIT NPEVRV+KE RAAG+L+N+ EG+KY E+ LRKFVRNK PEIMP
Sbjct  20   GVAVGICAFSLIRNITGNPEVRVSKENRAAGILDNHAEGEKYKENFLRKFVRNKHPEIMP  79

Query  182  SLNRFFSDP  208
             +N+FF+DP
Sbjct  80   GINKFFTDP  88



>ref|XP_008351806.1| PREDICTED: uncharacterized protein LOC103415246 [Malus domestica]
Length=90

 Score =   110 bits (275),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVA+GICG  L R+IT NPEVRVNKE RAAGVL+N+ EG+KY E+ LRKFVRN++PEIMP
Sbjct  19   GVAIGICGLSLFRHITINPEVRVNKENRAAGVLDNHAEGEKYKENFLRKFVRNRAPEIMP  78

Query  182  SLNRFFSDPQRN  217
            ++N FF+DP+ N
Sbjct  79   AINGFFTDPKNN  90



>ref|XP_004310038.1| PREDICTED: uncharacterized protein LOC101295883 [Fragaria vesca 
subsp. vesca]
Length=87

 Score =   110 bits (274),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNIT NPEVRV KE RAAG+L+N+EEG+KY E+++R+FVRNK P+IMP
Sbjct  18   GVAVGICAMQLVRNITGNPEVRVTKENRAAGILDNFEEGEKYRENAVRRFVRNKKPQIMP  77

Query  182  SLNRFFSDP  208
            S+N FFS+P
Sbjct  78   SINNFFSEP  86



>ref|XP_002875880.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52139.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
Length=88

 Score =   110 bits (274),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E+ LRKFVRNK PEIMP
Sbjct  18   GVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENFLRKFVRNKKPEIMP  77

Query  182  SLNRFFSDP  208
             LN+FF+DP
Sbjct  78   GLNKFFTDP  86



>ref|XP_010515125.1| PREDICTED: uncharacterized protein LOC104791023 [Camelina sativa]
 ref|XP_010426282.1| PREDICTED: uncharacterized protein LOC104711289 [Camelina sativa]
Length=88

 Score =   110 bits (274),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E+ LRKFVRNK PEIMP
Sbjct  18   GVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKENFLRKFVRNKHPEIMP  77

Query  182  SLNRFFSDPQ  211
             +N+FF+DP+
Sbjct  78   GINKFFTDPK  87



>ref|NP_190397.1| B12D protein [Arabidopsis thaliana]
 pir||T13003 hypothetical protein T24C20.20 - Arabidopsis thaliana
 emb|CAB51061.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAL91215.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAN65070.1| B12D-like protein [Arabidopsis thaliana]
 dbj|BAH19734.1| AT3G48140 [Arabidopsis thaliana]
 gb|AEE78372.1| B12D protein [Arabidopsis thaliana]
Length=88

 Score =   110 bits (274),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E+ LRKFVRNK PEIMP
Sbjct  18   GVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENFLRKFVRNKKPEIMP  77

Query  182  SLNRFFSDP  208
             LN+FF+DP
Sbjct  78   GLNKFFTDP  86



>ref|XP_003601829.1| B12D protein [Medicago truncatula]
 gb|AES72080.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
 gb|AFK33923.1| unknown [Medicago truncatula]
Length=88

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC  QL+RNITTNPEVRV K+ RAAG+L+N++EG+KY++H +R+FVR KS EIMP
Sbjct  19   GAAVGICVMQLVRNITTNPEVRVTKQNRAAGILDNHDEGEKYSQHFIRRFVRGKSTEIMP  78

Query  182  SLNRFFSDPQ  211
            SLN FFSDP+
Sbjct  79   SLNGFFSDPK  88



>gb|ACG48656.1| B12D protein [Zea mays]
Length=98

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
             VA+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG++YA H LRKFVR K PEIM 
Sbjct  26   AVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHGLRKFVRGKKPEIMA  85

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP ++
Sbjct  86   SINSFFADPXKD  97



>emb|CDY44977.1| BnaCnng12070D [Brassica napus]
Length=88

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC F LIRNIT NPEVR  KE RAAGVL+N+ EG+KY E+ LRK+VRNK PEIMP
Sbjct  18   GVAVGICAFSLIRNITGNPEVRCTKENRAAGVLDNHAEGEKYKENFLRKYVRNKHPEIMP  77

Query  182  SLNRFFSDPQ  211
             +N+FF+DP+
Sbjct  78   GINKFFTDPK  87



>ref|XP_007044988.1| B12D protein [Theobroma cacao]
 gb|EOY00820.1| B12D protein [Theobroma cacao]
Length=89

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC  QL+RNI+TNPEVRV KE R+AG+LEN+EEG++YAEH LR FVR +  +IMP
Sbjct  20   GFAVGICAMQLVRNISTNPEVRVTKENRSAGILENFEEGERYAEHGLRNFVRKRPSQIMP  79

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  80   SINNFFSDP  88



>ref|XP_004504481.1| PREDICTED: uncharacterized protein LOC101503540 [Cicer arietinum]
Length=90

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G  VGIC  QL+RNI+TNPEVRVNKE R AGVL+N+ EG+ YAEH  RKFVRNK  ++MP
Sbjct  19   GAVVGICAMQLVRNISTNPEVRVNKENRLAGVLDNHAEGEAYAEHRFRKFVRNKPRQVMP  78

Query  182  SLNRFFSDPQ  211
            S+N FFSDPQ
Sbjct  79   SVNNFFSDPQ  88



>ref|XP_006290288.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
 gb|EOA23186.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
Length=88

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E+ LRKFVR+K PEIMP
Sbjct  18   GVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKENFLRKFVRDKHPEIMP  77

Query  182  SLNRFFSDPQ  211
             +N+FF+DP+
Sbjct  78   GINKFFTDPK  87



>ref|XP_008651557.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG31473.1| B12D protein [Zea mays]
 tpg|DAA60235.1| TPA: hypothetical protein ZEAMMB73_939997 [Zea mays]
Length=98

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
             VA+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG++YA H LRKFVR K PEIM 
Sbjct  26   AVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHGLRKFVRGKKPEIMA  85

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP ++
Sbjct  86   SINSFFADPPKD  97



>gb|ABK24106.1| unknown [Picea sitchensis]
Length=92

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G+AV +C FQL RN+ TNPEVR+ KE RAAG+L+N+EEG+KYAEH LRK+VRNKSPEIMP
Sbjct  23   GIAVTMCCFQLSRNLFTNPEVRLLKENRAAGILDNFEEGEKYAEHKLRKYVRNKSPEIMP  82

Query  182  SLNRFFSD  205
            S+N++F++
Sbjct  83   SINKYFTE  90



>ref|XP_009149843.1| PREDICTED: uncharacterized protein LOC103873171 [Brassica rapa]
 emb|CDY36902.1| BnaA06g16870D [Brassica napus]
Length=88

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E+ LRK+VRNK PEIMP
Sbjct  18   GVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENFLRKYVRNKHPEIMP  77

Query  182  SLNRFFSDPQ  211
             +N+FF+DP+
Sbjct  78   GINKFFTDPK  87



>ref|NP_001151846.1| B12D protein [Zea mays]
 gb|ACG44577.1| B12D protein [Zea mays]
Length=84

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
             VA+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG++YA H LRKFVR K PEIM 
Sbjct  12   AVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHGLRKFVRGKKPEIMA  71

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP ++
Sbjct  72   SINSFFADPPKD  83



>gb|EMS61978.1| hypothetical protein TRIUR3_19930 [Triticum urartu]
 gb|EMT04073.1| hypothetical protein F775_11885 [Aegilops tauschii]
Length=97

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAV IC  QLIRNITTNPEVRV KE RAAG+ EN++EGK+Y++H  RKF+  + PEIMP
Sbjct  26   GVAVSICAMQLIRNITTNPEVRVTKENRAAGIQENFDEGKRYSQHGFRKFIDRQRPEIMP  85

Query  182  SLNRFFSDPQR  214
            ++N FFSDP +
Sbjct  86   AINNFFSDPPK  96



>gb|EMT27875.1| hypothetical protein F775_28789 [Aegilops tauschii]
Length=98

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H  R+F+  KS EIMP
Sbjct  27   GVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHPFRRFIDGKSAEIMP  86

Query  182  SLNRFFSDPQRN  217
             +N FF+DP +N
Sbjct  87   GINSFFTDPPKN  98



>ref|XP_004299593.1| PREDICTED: uncharacterized protein LOC101301782 [Fragaria vesca 
subsp. vesca]
Length=88

 Score =   108 bits (269),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGICGF ++R++  NPEVRV+K  RAAGVL+N+ EG+KY EH LRKFVRN+SPEIMP
Sbjct  18   GAAVGICGFSMVRHMCINPEVRVSKVNRAAGVLDNFAEGEKYQEHMLRKFVRNRSPEIMP  77

Query  182  SLNRFFSDPQR  214
             +N FF+DP +
Sbjct  78   GINSFFADPAK  88



>ref|XP_002459694.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
 gb|EER96215.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
Length=97

 Score =   108 bits (269),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
              A+GIC +QL+RNIT NPEVRV KE RAAGVL+N++EG+KYA H LRKFVR K PEIM 
Sbjct  25   AAALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGEKYAMHGLRKFVRGKKPEIMA  84

Query  182  SLNRFFSDPQRN  217
            S+N FF+DP ++
Sbjct  85   SINSFFADPPKD  96



>gb|KEH20547.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=91

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G  VGIC  QL+RNI TNPEVRVNK+ R AGVLEN+ EG+ YAEH +RKF+RNK P++MP
Sbjct  19   GTVVGICAMQLVRNICTNPEVRVNKQNRIAGVLENHAEGEAYAEHRVRKFLRNKPPQVMP  78

Query  182  SLNRFFSDP  208
            S+N+FFS+P
Sbjct  79   SVNKFFSEP  87



>dbj|BAK01100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=97

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAV IC  QLIRNITTNPEVRV KE RAAGV EN++EGK+Y++H  RKF+  + P+IMP
Sbjct  26   GVAVSICAMQLIRNITTNPEVRVTKENRAAGVQENFDEGKRYSQHGFRKFIDRQRPQIMP  85

Query  182  SLNRFFSDPQR  214
            ++N FFSDP +
Sbjct  86   AINNFFSDPPK  96



>ref|XP_010249439.1| PREDICTED: uncharacterized protein LOC104591985 [Nelumbo nucifera]
Length=94

 Score =   105 bits (263),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G  VG+C FQL+RNI +NP+VRVNK+ R+ GV +N+EEGK Y EHS+RKF+RN+ PE+MP
Sbjct  21   GGVVGLCAFQLVRNICSNPDVRVNKQKRSEGVFDNFEEGKNYKEHSIRKFLRNRPPEVMP  80

Query  182  SLNRFFSDPQ  211
            S+N+FFS+P+
Sbjct  81   SVNKFFSEPK  90



>ref|XP_009150210.1| PREDICTED: uncharacterized protein LOC103873555 [Brassica rapa]
 emb|CDY21808.1| BnaA06g20770D [Brassica napus]
Length=88

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC F LIRNIT NPEVR  KE RAAG+L+N+ EG+KY E+ LRK+VR+K PEIMP
Sbjct  18   GAAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENFLRKYVRDKRPEIMP  77

Query  182  SLNRFFSDP  208
             LN+FF+DP
Sbjct  78   GLNKFFTDP  86



>gb|EMS45331.1| hypothetical protein TRIUR3_29962 [Triticum urartu]
Length=98

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H  R+F+  KS EIMP
Sbjct  27   GVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHPFRRFIDGKSAEIMP  86

Query  182  SLNRFFSDPQRN  217
             +N FF+ P +N
Sbjct  87   GINSFFTAPPKN  98



>ref|XP_003557311.1| PREDICTED: uncharacterized protein LOC100833199 [Brachypodium 
distachyon]
Length=97

 Score =   105 bits (261),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N+ EG++Y+ H  RKF+  +S EIMP
Sbjct  26   GVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHAEGERYSRHGFRKFIDGRSREIMP  85

Query  182  SLNRFFSDPQR  214
            +LN FF+DP +
Sbjct  86   ALNSFFTDPPK  96



>dbj|BAK01669.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=98

 Score =   105 bits (261),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H  R+F+  KS EIMP
Sbjct  27   GVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHPFRRFIDGKSAEIMP  86

Query  182  SLNRFFSDPQRN  217
             +N FF+ P +N
Sbjct  87   GINNFFTAPPKN  98



>dbj|BAJ88884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=150

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++YA H  R+F+  KS EIMP
Sbjct  79   GVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHPFRRFIDGKSAEIMP  138

Query  182  SLNRFFSDPQRN  217
             +N FF+ P +N
Sbjct  139  GINNFFTAPPKN  150



>emb|CDP13299.1| unnamed protein product [Coffea canephora]
Length=89

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
               VG+C  QL+RNI TNPEVRV KE RAAGVL N+EEG+ YA+H LR+F+R + PE+MP
Sbjct  20   AAVVGLCTMQLVRNICTNPEVRVTKENRAAGVLNNFEEGEYYAQHRLRQFLRGRRPEVMP  79

Query  182  SLNRFFSDP  208
            S+N+FFSDP
Sbjct  80   SVNKFFSDP  88



>dbj|BAC84633.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31625.1| putative B12D protein [Oryza sativa Japonica Group]
 gb|EAZ03481.1| hypothetical protein OsI_25619 [Oryza sativa Indica Group]
 gb|EAZ39393.1| hypothetical protein OsJ_23824 [Oryza sativa Japonica Group]
 dbj|BAH01595.1| unnamed protein product [Oryza sativa Japonica Group]
Length=98

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAV IC  QL+RNIT NPEVRV KE RAAGVLEN++EGK+Y++H  RKF+  K PEIMP
Sbjct  27   GVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHGFRKFIDGKRPEIMP  86

Query  182  SLNRFFSDPQR  214
             +N FFSDP +
Sbjct  87   GINSFFSDPPK  97



>ref|XP_004955942.1| PREDICTED: uncharacterized protein LOC101785845 [Setaria italica]
Length=95

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC  QLIRNIT NPEVRV KE RAAGVLEN+EEG++Y++H  RK++  K PEIM 
Sbjct  25   GAAVGICAMQLIRNITGNPEVRVLKEKRAAGVLENHEEGRRYSQHGFRKYIDGKKPEIMQ  84

Query  182  SLNRFFSDPQ  211
            SLN + +DP+
Sbjct  85   SLNSWMADPK  94



>ref|NP_001059360.2| Os07g0274700 [Oryza sativa Japonica Group]
 dbj|BAF21274.2| Os07g0274700, partial [Oryza sativa Japonica Group]
Length=130

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAV IC  QL+RNIT NPEVRV KE RAAGVLEN++EGK+Y++H  RKF+  K PEIMP
Sbjct  59   GVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHGFRKFIDGKRPEIMP  118

Query  182  SLNRFFSDPQR  214
             +N FFSDP +
Sbjct  119  GINSFFSDPPK  129



>ref|XP_006658464.1| PREDICTED: uncharacterized protein LOC102702396 [Oryza brachyantha]
Length=100

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAV IC  QL+RNIT NPEVRV KE RAAGVLEN++EG++Y++H  RKF+  + PEIMP
Sbjct  29   GVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGRRYSQHGFRKFIDGRRPEIMP  88

Query  182  SLNRFFSDPQR  214
            S+N FF+DP +
Sbjct  89   SINSFFADPPK  99



>gb|KEH35272.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=62

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  26   FQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSD  205
             QL+RNITTNPEVRV K+ RAAG+L+N++EG+KY++H +R+FVR KS EIMPSLN FFSD
Sbjct  1    MQLVRNITTNPEVRVTKQNRAAGILDNHDEGEKYSQHFIRRFVRGKSTEIMPSLNGFFSD  60

Query  206  PQ  211
            P+
Sbjct  61   PK  62



>ref|XP_011099034.1| PREDICTED: uncharacterized protein LOC105177540 [Sesamum indicum]
Length=86

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN   NP+VR+NK  R   VLEN EEG+KYAEHSLRKF+R + PE+MPSLN
Sbjct  20   TGMCLFQLTRNALLNPDVRINKAHRRRAVLENQEEGEKYAEHSLRKFLRTRPPEVMPSLN  79

Query  191  RFFSD  205
            RFFSD
Sbjct  80   RFFSD  84



>ref|XP_006438116.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|ESR51356.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|KDO82025.1| hypothetical protein CISIN_1g047755mg [Citrus sinensis]
Length=90

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC  QL+RN  TNPEVR+ K  R AGVLEN++EG +Y E++LR+FVR+K P+IMP
Sbjct  21   GAAVGICAMQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYKENALRRFVRDKPPQIMP  80

Query  182  SLNRFFS  202
            S+N FFS
Sbjct  81   SVNEFFS  87



>ref|XP_006484337.1| PREDICTED: uncharacterized protein LOC102622685 [Citrus sinensis]
Length=90

 Score = 97.4 bits (241),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G AVGIC  QL+RN  TNPEVR+ K  R AGVLEN++EG +Y E++LR+FVR+K P+IMP
Sbjct  21   GAAVGICAVQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYKENALRRFVRDKPPQIMP  80

Query  182  SLNRFFS  202
            S+N FFS
Sbjct  81   SVNEFFS  87



>gb|AAL17696.1| B12D-like protein [Castanea sativa]
Length=134

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAA-GVLENYEEGKKYAEHSLRKFVRNKSPEIM  178
            GVAVGIC  QL+RNI TNPEVRV KE  +    L N+EEG+KY++H++RKFV N+SP IM
Sbjct  45   GVAVGICAMQLVRNICTNPEVRVTKENNSCRKCLHNFEEGEKYSQHAVRKFVLNRSPHIM  104

Query  179  PSLNRFFSDPQ  211
            PSL  FFS+P+
Sbjct  105  PSLKSFFSEPK  115



>ref|XP_009596991.1| PREDICTED: uncharacterized protein LOC104092997 [Nicotiana tomentosiformis]
Length=88

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR++K  R+  VLEN EEG+KYA+HSLRKF+R + P++MPS+
Sbjct  19   VTGMCVFQLTRNVLLNPDVRISKVHRSMAVLENEEEGEKYAQHSLRKFLRTRPPQVMPSI  78

Query  188  NRFFSDPQRN  217
            NRFFSD  +N
Sbjct  79   NRFFSDHDKN  88



>ref|XP_006338343.1| PREDICTED: uncharacterized protein LOC102603988 [Solanum tuberosum]
Length=88

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYA+HSLR F+R + P++MPS+
Sbjct  19   VTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHSLRNFLRTRPPQVMPSI  78

Query  188  NRFFSDPQRN  217
            NRFFSD   N
Sbjct  79   NRFFSDHDNN  88



>ref|XP_010694063.1| PREDICTED: uncharacterized protein LOC104906928 [Beta vulgaris 
subsp. vulgaris]
Length=88

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  RA  VLEN+EEG+KYAEH  RK++R +SPE+MPS+
Sbjct  19   VTGMCIFQLTRNVLLNPDVRINKAHRATAVLENHEEGEKYAEHGFRKYLRTRSPEVMPSI  78

Query  188  NRFFSDPQRN  217
            N FFS+ +++
Sbjct  79   NSFFSETKKD  88



>ref|XP_009792586.1| PREDICTED: uncharacterized protein LOC104239607 [Nicotiana sylvestris]
Length=87

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+ K  R+  +LEN EEG+KYA+HSLRKF+R + P++MPS+
Sbjct  19   VTGMCVFQLTRNVLLNPDVRIKKAHRSMAILENEEEGEKYAQHSLRKFLRTRPPQVMPSI  78

Query  188  NRFFSD  205
            NRFFSD
Sbjct  79   NRFFSD  84



>ref|XP_008464582.1| PREDICTED: uncharacterized protein LOC103502424 [Cucumis melo]
Length=86

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +C FQL RNI  NP+VRVNK  R  GVLEN EEG+KY+EHSLR+F+R + PEIMP
Sbjct  17   GFVTSMCVFQLTRNILINPDVRVNKAHRRMGVLENEEEGEKYSEHSLRRFLRTRPPEIMP  76

Query  182  SLNRFFSD  205
            ++NR+FS 
Sbjct  77   TINRYFSQ  84



>ref|XP_004232140.1| PREDICTED: uncharacterized protein LOC101252543 [Solanum lycopersicum]
Length=88

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYA+HSLR F+R + P++MPS+
Sbjct  19   VTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHSLRNFLRTRPPQVMPSI  78

Query  188  NRFFSDPQRN  217
            NRFFS+   N
Sbjct  79   NRFFSNHDNN  88



>ref|XP_010257978.1| PREDICTED: uncharacterized protein LOC104597899 [Nelumbo nucifera]
Length=87

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN   NP+VRVNK+ R   VLENYEEG+KYAEH LRKF+R + PEIMP++
Sbjct  19   VTSMCVFQLTRNAFLNPDVRVNKDHRKTAVLENYEEGEKYAEHGLRKFLRTRPPEIMPTI  78

Query  188  NRFFS  202
            N FFS
Sbjct  79   NHFFS  83



>ref|XP_010260461.1| PREDICTED: uncharacterized protein LOC104599559 [Nelumbo nucifera]
Length=89

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR+NK+ R   VLEN EEG+KYAEH LRKF+R + PEIMP++
Sbjct  21   VTSMCVFQLTRNVFLNPDVRINKDRRKMAVLENQEEGEKYAEHGLRKFLRTRPPEIMPTI  80

Query  188  NRFFSDPQ  211
            N FFS P+
Sbjct  81   NHFFSKPE  88



>ref|XP_008230281.1| PREDICTED: uncharacterized protein LOC103329570 [Prunus mume]
Length=86

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR++K  R  GVLEN EEG+KYAEH LRKF+R + PEIMP++
Sbjct  19   VTSLCAFQLTRNVFLNPDVRIDKARRGMGVLENKEEGEKYAEHGLRKFLRTRPPEIMPTI  78

Query  188  NRFFS  202
            NRFFS
Sbjct  79   NRFFS  83



>emb|CDP19974.1| unnamed protein product [Coffea canephora]
Length=92

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRV+K  R   VLEN EEG+KYA+HSLR+F+R + PEIMPS+N
Sbjct  20   TGMCIFQLTRNVLLNPDVRVDKAHRKTAVLENQEEGEKYAQHSLRRFLRTRPPEIMPSIN  79

Query  191  RFFS  202
            RFF+
Sbjct  80   RFFA  83



>gb|EYU25265.1| hypothetical protein MIMGU_mgv1a024239mg [Erythranthe guttata]
Length=86

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  R   VLEN EEG KY EH+LRKF+R + PE+MPS+
Sbjct  19   VTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGWKYREHNLRKFLRTRPPEVMPSV  78

Query  188  NRFFSD  205
            NRFFS+
Sbjct  79   NRFFSE  84



>gb|EYU20492.1| hypothetical protein MIMGU_mgv1a026736mg [Erythranthe guttata]
Length=86

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  R   VLEN EEG  Y EH+LRKF+R + PE+MPS+
Sbjct  19   VTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGLTYREHNLRKFLRTRPPEVMPSV  78

Query  188  NRFFSD  205
            NRFFSD
Sbjct  79   NRFFSD  84



>ref|XP_002281305.1| PREDICTED: uncharacterized protein LOC100258293 [Vitis vinifera]
Length=89

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
            G+  F L R++T NP+VR++KEGR   VL+N +EG++YAEH LRKF+R ++PEI P LNR
Sbjct  21   GMVVFSLGRHVTMNPDVRISKEGRKQAVLDNADEGERYAEHGLRKFLRTRTPEIFPKLNR  80

Query  194  FFSDPQRN  217
            FFSDP+++
Sbjct  81   FFSDPEKS  88



>gb|KJB22813.1| hypothetical protein B456_004G066900 [Gossypium raimondii]
Length=86

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
                 +C FQL RN+  NP VR+NK  R+  VLENYEEG+KYAEH LRKF+R + PE+MP
Sbjct  17   AFVTSMCIFQLTRNVFLNPAVRINKSDRSQAVLENYEEGEKYAEHGLRKFLRTRPPEVMP  76

Query  182  SLNRFFSD  205
            ++N FFS+
Sbjct  77   AINHFFSE  84



>ref|XP_003531875.1| PREDICTED: uncharacterized protein LOC100527287 [Glycine max]
 gb|ACU16358.1| unknown [Glycine max]
 gb|KHN30319.1| hypothetical protein glysoja_037830 [Glycine soja]
Length=86

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  R+  VLEN EEG+KYAEH LRKF+R + PEIMP++
Sbjct  19   VTGMCVFQLTRNVLGNPDVRINKTRRSMAVLENREEGEKYAEHGLRKFLRTRPPEIMPTI  78

Query  188  NRFFSD  205
            N FFS+
Sbjct  79   NHFFSE  84



>ref|XP_007032847.1| B12D protein [Theobroma cacao]
 gb|EOY03773.1| B12D protein [Theobroma cacao]
Length=86

 Score = 92.0 bits (227),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
              +C FQL RN+  NP VR+NK  R+  VLENYEEG+KYAEH LRKF+R + PE+MP++N
Sbjct  20   TSMCIFQLTRNVFLNPAVRINKADRSKAVLENYEEGEKYAEHGLRKFLRTRPPEVMPAIN  79

Query  191  RFFSD  205
             FFS+
Sbjct  80   HFFSE  84



>ref|XP_001779363.1| predicted protein [Physcomitrella patens]
 gb|EDQ55870.1| predicted protein [Physcomitrella patens]
Length=93

 Score = 92.0 bits (227),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G A+GICG+ + RN+  NP+VR+ KE RAAGVLENY+EG+ Y  H LRK+++ + P+IMP
Sbjct  24   GAALGICGYSMARNLAINPDVRITKEDRAAGVLENYKEGEAYKMHGLRKYLQQQEPQIMP  83

Query  182  SLNRFFS  202
             +N +FS
Sbjct  84   GINNYFS  90



>ref|XP_010260574.1| PREDICTED: uncharacterized protein LOC104599651 [Nelumbo nucifera]
Length=88

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
             +C FQL RN+  NP+VRVNKE R   VLEN EEG+KYAEH LRKF+R + PE+MP++N 
Sbjct  21   SMCVFQLTRNVFMNPDVRVNKEHRQKAVLENAEEGEKYAEHGLRKFLRTRPPEVMPAINS  80

Query  194  FFS  202
            FFS
Sbjct  81   FFS  83



>ref|XP_010099316.1| hypothetical protein L484_018178 [Morus notabilis]
 gb|EXB77662.1| hypothetical protein L484_018178 [Morus notabilis]
Length=87

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYAEH LRKF+R + PE+MPS+
Sbjct  19   VTSMCVFQLTRNMFLNPDVRINKAHRSMGVLENKEEGEKYAEHCLRKFLRTRPPEVMPSV  78

Query  188  NRFFSD  205
            N FFS 
Sbjct  79   NHFFSS  84



>ref|XP_011021065.1| PREDICTED: uncharacterized protein LOC105123251 [Populus euphratica]
Length=86

 Score = 91.7 bits (226),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR+NK  R  GVLEN EEG+KYAEH LRKF+R + PEIMP++
Sbjct  19   VTSLCIFQLTRNVFMNPDVRINKANRGMGVLENKEEGEKYAEHGLRKFLRTRPPEIMPTV  78

Query  188  NRFFSD  205
            N FFS+
Sbjct  79   NHFFSE  84



>ref|XP_007215204.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
 gb|EMJ16403.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
Length=86

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR++K  R  GVLEN EEG+KYAEH LRKF+R + PEIMP++
Sbjct  19   VTSLCAFQLTRNVFLNPDVRIDKAKRGMGVLENKEEGEKYAEHGLRKFLRTRPPEIMPTI  78

Query  188  NRFFS  202
            N+FFS
Sbjct  79   NQFFS  83



>ref|XP_001776158.1| predicted protein [Physcomitrella patens]
 gb|EDQ59069.1| predicted protein [Physcomitrella patens]
Length=93

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G A+GICG+ + RN+  NP+VR+ KE RAAGVLENY+EG+ Y  H LR +VR + P+IMP
Sbjct  24   GAALGICGYAMARNLAINPDVRITKEDRAAGVLENYKEGEAYKMHGLRAYVRQQEPQIMP  83

Query  182  SLNRFFS  202
              N +FS
Sbjct  84   GFNNYFS  90



>ref|XP_008664404.1| PREDICTED: uncharacterized protein LOC100383000 [Zea mays]
 gb|ACN31786.1| unknown [Zea mays]
Length=88

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVL+N++EG++Y++H +R+F  +K  + M 
Sbjct  18   GVAVGICVMQLVRNITTNPEVRVTKEKRAAGVLDNHDEGRRYSQHGVRRFWLSKRRDYMQ  77

Query  182  SLNRFFSDPQR  214
            ++++  +DP +
Sbjct  78   AMDKVPTDPNK  88



>ref|XP_008362218.1| PREDICTED: uncharacterized protein LOC103425898 [Malus domestica]
 ref|XP_009373788.1| PREDICTED: uncharacterized protein LOC103962745 [Pyrus x bretschneideri]
Length=86

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
              +C FQL RN+  NPEVR+NK  R   VLEN EEG+KYAEH LRKF+R + PEIMP++N
Sbjct  20   TSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHGLRKFLRTRPPEIMPTIN  79

Query  191  RFFSD  205
             FFS 
Sbjct  80   HFFSQ  84



>ref|XP_006373388.1| germination family protein [Populus trichocarpa]
 gb|ERP51185.1| germination family protein [Populus trichocarpa]
Length=86

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VRVNK  R  GVLEN EEG++YAEH LRKF+R + PEIMP++
Sbjct  19   VTSLCIFQLTRNVFMNPDVRVNKANRGMGVLENKEEGERYAEHGLRKFLRTRPPEIMPTV  78

Query  188  NRFFSD  205
            N FFS+
Sbjct  79   NHFFSE  84



>ref|XP_006856407.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
 gb|ERN17874.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
Length=87

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +C FQL RN+  NP+VR+NK  R + VL+N EEG+KYAEHSLR F+R + PEIMP
Sbjct  17   GFVTSLCIFQLTRNLLLNPDVRINKAHRTSAVLDNEEEGQKYAEHSLRNFLRTRPPEIMP  76

Query  182  SLNRFFSD  205
            ++N+ FS+
Sbjct  77   AINKIFSE  84



>gb|EYU29509.1| hypothetical protein MIMGU_mgv1a024878mg [Erythranthe guttata]
Length=90

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  59   EVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  217
            EVRVNKE RAAG+L+N++EG KY EH+LRK+VRN+ PEIMPSLN FF+DPQ N
Sbjct  38   EVRVNKENRAAGILDNFDEGHKYKEHALRKYVRNRKPEIMPSLNSFFTDPQNN  90



>ref|XP_004955938.1| PREDICTED: uncharacterized protein LOC101784102 [Setaria italica]
Length=91

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV K+ RAAGVL+N++EG++Y++H +R+F  +K  + M 
Sbjct  18   GVAVGICVMQLVRNITTNPEVRVTKQNRAAGVLDNHDEGRRYSQHGVRRFWLSKRRDYMQ  77

Query  182  SLNRFFSDP  208
            ++++  +DP
Sbjct  78   AMDKVPTDP  86



>dbj|BAG94722.1| unnamed protein product [Oryza sativa Japonica Group]
Length=90

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVLEN++EGK+Y++H +R+F  +K  + M 
Sbjct  18   GVAVGICAMQLVRNITTNPEVRVTKENRAAGVLENFDEGKRYSQHGVRRFWLSKRRDYMQ  77

Query  182  SLN  190
            +L+
Sbjct  78   ALD  80



>ref|NP_001059359.1| Os07g0274400 [Oryza sativa Japonica Group]
 dbj|BAC84630.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31622.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAF21273.1| Os07g0274400 [Oryza sativa Japonica Group]
 gb|EAZ39392.1| hypothetical protein OsJ_23823 [Oryza sativa Japonica Group]
Length=89

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVLEN++EGK+Y++H +R+F  +K  + M 
Sbjct  18   GVAVGICAMQLVRNITTNPEVRVTKENRAAGVLENFDEGKRYSQHGVRRFWLSKRRDYMQ  77

Query  182  SLN  190
            +L+
Sbjct  78   ALD  80



>ref|XP_010029400.1| PREDICTED: uncharacterized protein LOC104419438 isoform X2 [Eucalyptus 
grandis]
Length=86

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  R  GVL+N EEG+KY++H LRKF+R + PEIMP++
Sbjct  19   VTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHGLRKFLRTRPPEIMPAI  78

Query  188  NRFFSD  205
            N FFS+
Sbjct  79   NHFFSE  84



>ref|XP_010029399.1| PREDICTED: uncharacterized protein LOC104419438 isoform X1 [Eucalyptus 
grandis]
Length=90

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
              G+C FQL RN+  NP+VR+NK  R  GVL+N EEG+KY++H LRKF+R + PEIMP++
Sbjct  23   VTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHGLRKFLRTRPPEIMPAI  82

Query  188  NRFFSD  205
            N FFS+
Sbjct  83   NHFFSE  88



>gb|KGN53786.1| hypothetical protein Csa_4G129030 [Cucumis sativus]
Length=72

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +C FQL RNI  NP+VRV K  R  GVL+N EEG+KY+EHSLR+F+R + PEIMP
Sbjct  2    GFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHSLRRFLRTRPPEIMP  61

Query  182  SLNRFFSDPQR  214
            ++N +FS   +
Sbjct  62   TINHYFSQDHK  72



>ref|XP_008379445.1| PREDICTED: uncharacterized protein LOC103442440 [Malus domestica]
 ref|XP_008348095.1| PREDICTED: uncharacterized protein LOC103411226 [Malus domestica]
Length=86

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
              +C FQL RN+  NPEVR+NK  R   VLEN EEG+KYAEH LRKF+R + PEIMP+ N
Sbjct  20   TSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHGLRKFLRTRPPEIMPTXN  79

Query  191  RFFSD  205
             FFS 
Sbjct  80   HFFSQ  84



>ref|XP_006430939.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
 gb|ESR44179.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
Length=94

 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
             +C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYAEH LR+F+R + P++MP++NR
Sbjct  21   SMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHGLRRFLRTRPPQVMPAINR  80

Query  194  FFS  202
            FFS
Sbjct  81   FFS  83



>dbj|BAK03592.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=89

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNI TNPEVRV KE RAAGVLEN++EGK+Y++H +R+F  +K  + M 
Sbjct  18   GVAVGICVMQLVRNIMTNPEVRVTKENRAAGVLENHDEGKRYSQHGVRRFWLSKRRDYMQ  77

Query  182  SLNRFFSDP  208
            +L+   +DP
Sbjct  78   ALDNVPTDP  86



>ref|XP_004137261.1| PREDICTED: uncharacterized protein LOC101217963 [Cucumis sativus]
 ref|XP_004154766.1| PREDICTED: uncharacterized LOC101217963 [Cucumis sativus]
Length=87

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +C FQL RNI  NP+VRV K  R  GVL+N EEG+KY+EHSLR+F+R + PEIMP
Sbjct  17   GFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHSLRRFLRTRPPEIMP  76

Query  182  SLNRFFSDPQR  214
            ++N +FS   +
Sbjct  77   TINHYFSQDHK  87



>ref|XP_010034410.1| PREDICTED: uncharacterized protein LOC104423644 [Eucalyptus grandis]
 gb|KCW51947.1| hypothetical protein EUGRSUZ_J01394 [Eucalyptus grandis]
Length=88

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
              +C FQL RN+  NP+VR+NK  R   VL+N EEG+KYAEH LRKF+R + PE+MP++N
Sbjct  20   TSLCIFQLTRNVLLNPDVRINKAHRGMAVLDNAEEGRKYAEHGLRKFLRTRPPEVMPTIN  79

Query  191  RFFS  202
             FFS
Sbjct  80   HFFS  83



>ref|XP_006482419.1| PREDICTED: uncharacterized protein LOC102612079 [Citrus sinensis]
 gb|KDO72280.1| hypothetical protein CISIN_1g048115mg [Citrus sinensis]
Length=94

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
             +C FQL RN+  NP+VR+NK  R+ GVLEN EEG+KYAEH LR+F+R + P++MP++NR
Sbjct  21   SMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHGLRRFLRTRPPQVMPAINR  80

Query  194  FFS  202
            FF+
Sbjct  81   FFT  83



>gb|EYU29787.1| hypothetical protein MIMGU_mgv1a021169mg [Erythranthe guttata]
Length=80

 Score = 89.0 bits (219),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 11/72 (15%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G+AVGICGFQL+RNI  NPEVR           +N++EG KY E +LRK+VRN+  EIMP
Sbjct  20   GLAVGICGFQLVRNICGNPEVR-----------DNFDEGHKYKERALRKYVRNRKLEIMP  68

Query  182  SLNRFFSDPQRN  217
            SLN FF+DPQ N
Sbjct  69   SLNSFFTDPQNN  80



>ref|XP_006658463.1| PREDICTED: uncharacterized protein LOC102702117 [Oryza brachyantha]
Length=86

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV KE RAAGVLEN++EGK+Y++H +R+F  +K  + M 
Sbjct  18   GVAVGICAMQLVRNITTNPEVRVTKEKRAAGVLENFDEGKRYSQHGVRRFWLSKRRDYMH  77

Query  182  SLNRFFSDP  208
             L+   +DP
Sbjct  78   VLD---NDP  83



>ref|XP_006340507.1| PREDICTED: uncharacterized protein LOC102592850 [Solanum tuberosum]
Length=125

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 10/69 (14%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGICG Q +             E RAAGVL+N+ EG+KYAEH+LRKFVRNKSPEIMP
Sbjct  66   GVAVGICGMQYMHQ----------PENRAAGVLDNFSEGEKYAEHALRKFVRNKSPEIMP  115

Query  182  SLNRFFSDP  208
            S+N FFSDP
Sbjct  116  SINGFFSDP  124



>ref|XP_004491894.1| PREDICTED: uncharacterized protein LOC101510215 [Cicer arietinum]
Length=86

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RNI  NP+VR++K  R  GV +N EEG+KYAEH LRKF+R + PEIMPS+
Sbjct  19   VTSMCIFQLTRNILGNPDVRISKSRRTKGVFDNKEEGEKYAEHGLRKFLRTRPPEIMPSI  78

Query  188  NRFFSD  205
            N FFS+
Sbjct  79   NHFFSE  84



>ref|XP_007139429.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
 gb|ESW11423.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
Length=115

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VRVNK  R+  VL+N EEG+KYAEH LRKF+R + PEIMP++
Sbjct  48   VTSMCVFQLTRNLLGNPDVRVNKTRRSMAVLDNREEGEKYAEHGLRKFLRTRPPEIMPTI  107

Query  188  NRFFS  202
            N FFS
Sbjct  108  NHFFS  112



>ref|XP_002531002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31390.1| conserved hypothetical protein [Ricinus communis]
Length=86

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
              +C FQL RN+  NP+VR+NK  R   VLEN  EG++YAEH LRKF+R + PEIMPS+N
Sbjct  20   TSLCAFQLTRNMFLNPDVRINKAHRRTAVLENEVEGEQYAEHGLRKFLRTRPPEIMPSIN  79

Query  191  RFFSD  205
             FFS+
Sbjct  80   HFFSE  84



>ref|XP_009419068.1| PREDICTED: uncharacterized protein LOC103999135 [Musa acuminata 
subsp. malaccensis]
Length=87

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
              +C FQL RN+  NP+VR+NK  R   VLEN EEG+KY++HSLR+F+ ++ PE+ P+LN
Sbjct  20   TSMCVFQLTRNMLMNPDVRINKTNRTTAVLENAEEGEKYSQHSLRRFLSHRPPEVFPALN  79

Query  191  RFFSD  205
            RFFS 
Sbjct  80   RFFSS  84



>ref|XP_004304209.1| PREDICTED: uncharacterized protein LOC101313329 [Fragaria vesca 
subsp. vesca]
Length=89

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VRVNK  R   VL+N EEG++YAEH LRK++R + PE+MP++
Sbjct  19   VTSLCVFQLTRNVILNPDVRVNKAHRRMAVLDNEEEGERYAEHGLRKYLRTRRPEVMPTI  78

Query  188  NRFFSDPQRN  217
            N FFS  Q +
Sbjct  79   NHFFSHSQED  88



>ref|XP_003552604.1| PREDICTED: uncharacterized protein LOC100785946 [Glycine max]
 gb|KHN37934.1| hypothetical protein glysoja_042363 [Glycine soja]
Length=86

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
             +C FQL RN+  NP+VR+NK  R+  VL+N EEG+KYAEH LRKF+R + PEIMP++N 
Sbjct  21   SMCVFQLTRNMLGNPDVRINKTRRSMPVLDNREEGEKYAEHGLRKFLRTRPPEIMPTINH  80

Query  194  FFSD  205
            FFS+
Sbjct  81   FFSE  84



>gb|KCW56312.1| hypothetical protein EUGRSUZ_I02053 [Eucalyptus grandis]
Length=234

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VR+NK  R  GVL+N EEG+KY++H LRKF+R + PEIMP++N
Sbjct  168  TGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHGLRKFLRTRPPEIMPAIN  227

Query  191  RFFSD  205
             FFS+
Sbjct  228  HFFSE  232



>ref|XP_003561264.1| PREDICTED: uncharacterized protein LOC100824762 [Brachypodium 
distachyon]
Length=87

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 55/69 (80%), Gaps = 3/69 (4%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNITTNPEVRV K+ RAAGVLEN++EGK+Y++H +R+F  ++  + M 
Sbjct  18   GVAVGICAMQLVRNITTNPEVRVTKQNRAAGVLENHDEGKRYSQHGVRRFWLSQRRDYMQ  77

Query  182  SLNRFFSDP  208
            +L+   +DP
Sbjct  78   ALD---NDP  83



>dbj|BAC83875.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88459.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82410.1| hypothetical protein OsI_26790 [Oryza sativa Indica Group]
 gb|EEE67550.1| hypothetical protein OsJ_25042 [Oryza sativa Japonica Group]
Length=95

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRVNK  R + VLEN EEG+KY +H+ R+F+  + PE+ P+LN
Sbjct  20   TGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGEKYHQHAFRRFLATQRPEVFPALN  79

Query  191  RFFSDP  208
            RFF+ P
Sbjct  80   RFFAGP  85



>ref|XP_003562728.1| PREDICTED: uncharacterized protein LOC100837236 [Brachypodium 
distachyon]
Length=88

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
             +  G+C FQL+RN+  NP+VR++K  R + VLEN EEG+KY++H+ R+FV    PE+ P
Sbjct  17   SLVTGMCAFQLVRNVLLNPDVRISKSNRQSAVLENAEEGEKYSQHAFRRFVSAHRPEVFP  76

Query  182  SLNRFFSD  205
            ++NRFFS+
Sbjct  77   AINRFFSE  84



>gb|KDP24288.1| hypothetical protein JCGZ_25584 [Jatropha curcas]
Length=86

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR+NK  R   VLEN +EG+KYAEH LRKF+R + PE+MP++
Sbjct  19   VTSMCVFQLTRNVFLNPDVRINKAHRRMAVLENEDEGEKYAEHGLRKFLRTRPPEVMPAI  78

Query  188  NRFFS  202
            N FFS
Sbjct  79   NHFFS  83



>ref|XP_010514670.1| PREDICTED: uncharacterized protein LOC104790592 [Camelina sativa]
Length=87

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R+NK  R  G+LEN +EG+KYA+H+LRK++R + P++MP
Sbjct  17   GFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEDEGEKYAQHNLRKYLRTRPPQVMP  76

Query  182  SLNRFFSD  205
            SLNRFFSD
Sbjct  77   SLNRFFSD  84



>emb|CDX85280.1| BnaC07g25910D [Brassica napus]
Length=72

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R++KE R  G+LEN +EG+KYA+H+LRK++R + P++MP
Sbjct  2    GFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHNLRKYLRTRPPQVMP  61

Query  182  SLNRFFSD  205
            SLNRFFS+
Sbjct  62   SLNRFFSE  69



>ref|NP_001060222.2| Os07g0604600 [Oryza sativa Japonica Group]
 dbj|BAF22136.2| Os07g0604600, partial [Oryza sativa Japonica Group]
Length=127

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRVNK  R + VLEN EEG+KY +H+ R+F+  + PE+ P+LN
Sbjct  52   TGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGEKYHQHAFRRFLATQRPEVFPALN  111

Query  191  RFFSDP  208
            RFF+ P
Sbjct  112  RFFAGP  117



>ref|XP_010034411.1| PREDICTED: uncharacterized protein LOC104423646 [Eucalyptus grandis]
 gb|KCW51953.1| hypothetical protein EUGRSUZ_J01397 [Eucalyptus grandis]
Length=88

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
              +C FQL RN   NP+VRVNK  R   VL+  EEG+KYAEH LRKF+R + PE+MP++N
Sbjct  20   TSLCIFQLTRNALLNPDVRVNKAHRGMAVLDTAEEGRKYAEHGLRKFLRTRPPEVMPTIN  79

Query  191  RFFS  202
             FFS
Sbjct  80   HFFS  83



>gb|AFK43764.1| unknown [Medicago truncatula]
 gb|KEH21758.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=86

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR++K GR  GV +N EEG+KYA+H LR F+R + PE+MP++
Sbjct  19   VTSMCVFQLTRNLLQNPDVRISKNGRTKGVFDNKEEGEKYAKHGLRNFLRTRPPEVMPTI  78

Query  188  NRFFSD  205
            N FFS+
Sbjct  79   NHFFSE  84



>ref|XP_009151762.1| PREDICTED: uncharacterized protein LOC103875065 [Brassica rapa]
 emb|CDX86357.1| BnaA06g30740D [Brassica napus]
Length=87

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R++KE R  G+LEN +EG+KYA+H+LRK++R + P++MP
Sbjct  17   GFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHNLRKYLRTRPPQVMP  76

Query  182  SLNRFFSD  205
            SLNRFFS+
Sbjct  77   SLNRFFSE  84



>ref|XP_006395262.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
 gb|ESQ32548.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
Length=87

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R+NK  R  G+LEN +EG+KYA+H+LRK++R + P++MP
Sbjct  17   GFVTSMVVFQLTRNALLNPDCRINKANRKMGILENEDEGEKYAQHNLRKYLRTRQPQVMP  76

Query  182  SLNRFFS  202
            SLNRFFS
Sbjct  77   SLNRFFS  83



>ref|XP_002305391.1| germination family protein [Populus trichocarpa]
 gb|EEE85902.1| germination family protein [Populus trichocarpa]
Length=86

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR+NK  R+ GVL N EEG++YAEH LR+F+R + PEIMP++
Sbjct  19   VTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYAEHGLRRFLRTRPPEIMPTI  78

Query  188  NRFFSD  205
            N FF++
Sbjct  79   NHFFTE  84



>ref|XP_010502994.1| PREDICTED: uncharacterized protein LOC104780196 [Camelina sativa]
Length=87

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R+NK  R  G+LEN EEG+KYA+H+LRK++R + P++MP
Sbjct  17   GFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEEEGEKYAQHNLRKYLRTRPPQVMP  76

Query  182  SLNRFFSD  205
            SLNRFFS+
Sbjct  77   SLNRFFSE  84



>ref|NP_189632.1| B12D protein [Arabidopsis thaliana]
 dbj|BAB02998.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77618.1| B12D protein [Arabidopsis thaliana]
Length=87

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R+NKE R  G+LEN +EG+KYA+H+ RK++R + P++MP
Sbjct  17   GFVTSMVVFQLTRNAFLNPDCRINKEHRKMGILENKDEGEKYAQHNFRKYLRTRQPQVMP  76

Query  182  SLNRFFS  202
            SLNRFFS
Sbjct  77   SLNRFFS  83



>gb|AFK44347.1| unknown [Lotus japonicus]
Length=87

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVL-ENYEEGKKYAEHSLRKFVRNKSPEIMPS  184
              G+C FQL RN+  NP+VR++K  R+ GVL +N EEG++YAEH LRKF+R + PEIMP+
Sbjct  19   VTGMCVFQLTRNLLGNPDVRISKARRSMGVLFDNKEEGERYAEHGLRKFLRTRQPEIMPT  78

Query  185  LNRFFSD  205
            +N FFS+
Sbjct  79   INHFFSE  85



>ref|XP_002875526.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51785.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
Length=87

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R+NKE R  G+LEN +EG+KYA+H+ RK++R + P++MP
Sbjct  17   GFVTTMVVFQLTRNALLNPDCRINKEHRKMGILENEDEGEKYAQHNFRKYLRTRQPQVMP  76

Query  182  SLNRFFS  202
            SLNRFFS
Sbjct  77   SLNRFFS  83



>ref|XP_011008605.1| PREDICTED: uncharacterized protein LOC105113935 [Populus euphratica]
 ref|XP_011014073.1| PREDICTED: uncharacterized protein LOC105117942 [Populus euphratica]
Length=86

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR+NK  R+ GVL N EEG++YA+H LR+F+R + PEIMP++
Sbjct  19   VTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYADHGLRRFLRTRPPEIMPAI  78

Query  188  NRFFSD  205
            N FF++
Sbjct  79   NHFFTE  84



>ref|XP_002460987.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
 gb|EER97508.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
Length=76

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRV+K  R + VL+N +EG++Y++H+ R+F+  + PE+ P+LN
Sbjct  5    TGMCVFQLTRNVLMNPDVRVSKSHRQSAVLDNADEGQRYSQHAFRRFLSTQRPEVFPALN  64

Query  191  RFFSD  205
            RFFS+
Sbjct  65   RFFSN  69



>ref|XP_010553961.1| PREDICTED: uncharacterized protein LOC104823885 [Tarenaya hassleriana]
Length=87

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G    +  FQL RN   NP+ R+NK  R +GVLEN EEG+KYA+HSLR+F+R ++P++MP
Sbjct  17   GFVTSMVVFQLTRNAMLNPDCRINKGNRKSGVLENEEEGEKYAQHSLRRFLRTRAPQVMP  76

Query  182  SLNRFFSD  205
            ++N FFS 
Sbjct  77   AINNFFSQ  84



>ref|XP_003601294.1| B12D-like protein [Medicago truncatula]
Length=96

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  35   IRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQR  214
            I ++ +    RVNK+ RAAGVLEN+ EG+KY EH LRKF RN+SPEIMP LN FF+DP R
Sbjct  36   IMDVCSFDGFRVNKQSRAAGVLENFAEGEKYTEHLLRKFSRNRSPEIMPGLNSFFTDPSR  95

Query  215  N  217
            N
Sbjct  96   N  96



>ref|XP_002978639.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
 ref|XP_002984577.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ14222.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ20086.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
Length=95

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            G A+G+  F  +RN+  NPEVR+NKE R+AG+++NY+EG +Y EH LR ++RN+  EIMP
Sbjct  26   GAAMGLASFMCVRNLMLNPEVRINKEDRSAGLVQNYKEGYEYHEHGLRHYMRNRKSEIMP  85

Query  182  SLNRFFS  202
             +N +F+
Sbjct  86   RINEYFT  92



>ref|XP_004958246.1| PREDICTED: uncharacterized protein LOC101775472 [Setaria italica]
Length=91

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRV+K  R + VL+N +EG++Y++H+ R+F+  + PE+ P+LN
Sbjct  20   TGMCVFQLTRNVFMNPDVRVSKASRQSAVLDNADEGQRYSQHAFRRFLATQRPEVFPALN  79

Query  191  RFFSD  205
            RFFS+
Sbjct  80   RFFSE  84



>ref|XP_008346823.1| PREDICTED: putative cyclin-B3-1 [Malus domestica]
Length=132

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  17   ICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRF  196
            +   + ++   +  ++RV KE RAAGVL+N+ EG+KY EH LRKFVRNK+PEIMP +N F
Sbjct  66   VFMLRFLKAAQSETKIRVTKENRAAGVLDNHAEGEKYKEHFLRKFVRNKAPEIMPGINAF  125

Query  197  FSDPQRN  217
            F+DP +N
Sbjct  126  FTDPSKN  132



>ref|NP_001147337.1| B12D protein [Zea mays]
 gb|ACG26928.1| B12D protein [Zea mays]
Length=88

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRV+K  R + VL+N  EG++Y++H+ R+F+  + PE+ P+LN
Sbjct  14   TGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFLATQRPEVFPALN  73

Query  191  RFFSDPQRN*LPG  229
             FFSD   N  P 
Sbjct  74   SFFSDSNNNNTPA  86



>ref|XP_009394678.1| PREDICTED: uncharacterized protein LOC103980120 [Musa acuminata 
subsp. malaccensis]
Length=66

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  65   RVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  211
            RV+KEGRAAGVL+N+ EG+KYAEHSLRKFVRNK+PEIMP++N FF+ P+
Sbjct  16   RVSKEGRAAGVLDNHAEGEKYAEHSLRKFVRNKNPEIMPAINNFFTRPE  64



>ref|XP_002459693.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
 gb|EER96214.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
Length=96

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
            GVAVGIC  QL+RNIT NPEVRV KE RAAGVL+N++EG++Y++H +R+F  ++  + M 
Sbjct  19   GVAVGICVMQLVRNITGNPEVRVTKENRAAGVLDNHDEGRRYSQHGVRRFWLSQRRDYMQ  78

Query  182  SLNRFFSD  205
            +++   +D
Sbjct  79   AMDNVPTD  86



>ref|XP_006657932.1| PREDICTED: uncharacterized protein LOC102705450 [Oryza brachyantha]
Length=95

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRVNK  R + VLEN  EG++Y++H+ R+F+  + PE+ P+ N
Sbjct  20   TGLCTFQLTRNVFMNPDVRVNKNNRQSAVLENATEGERYSQHAFRRFLATQRPEVFPAAN  79

Query  191  RFFSDP  208
            RFF+ P
Sbjct  80   RFFAGP  85



>ref|NP_001060223.1| Os07g0604700 [Oryza sativa Japonica Group]
 dbj|BAC83876.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF22137.1| Os07g0604700 [Oryza sativa Japonica Group]
 gb|EAZ04641.1| hypothetical protein OsI_26791 [Oryza sativa Indica Group]
 gb|EAZ40584.1| hypothetical protein OsJ_25043 [Oryza sativa Japonica Group]
 dbj|BAH01133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=95

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
            G+C FQL RN+  NP+VRVNK  R + VLEN +EG+KY  H+ R+F+  + PE+ P++NR
Sbjct  21   GMCVFQLTRNVFMNPDVRVNKSHRQSAVLENADEGEKYHHHAFRRFLGTQRPEVFPAINR  80

Query  194  FFSDP  208
            FF+ P
Sbjct  81   FFAGP  85



>ref|XP_008651396.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG30695.1| B12D protein [Zea mays]
 tpg|DAA63527.1| TPA: b12D protein [Zea mays]
Length=94

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VRV+K  R + VL+N  EG++Y++H+ R+F+  + PE+ P+LN
Sbjct  20   TGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFLATQRPEVFPALN  79

Query  191  RFFSDPQRN*LPG  229
             FFSD   N  P 
Sbjct  80   SFFSDSNNNNTPA  92



>tpg|DAA63528.1| TPA: b12D protein [Zea mays]
Length=125

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
            G+C FQL RN+  NP+VRV+K  R + VL+N  EG++Y++H+ R+F+  + PE+ P+LN 
Sbjct  52   GMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFLATQRPEVFPALNS  111

Query  194  FFSDPQRN*LPG  229
            FFSD   N  P 
Sbjct  112  FFSDSNNNNTPA  123



>ref|XP_002887135.1| hypothetical protein ARALYDRAFT_894514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63394.1| hypothetical protein ARALYDRAFT_894514 [Arabidopsis lyrata subsp. 
lyrata]
Length=109

 Score = 82.0 bits (201),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  62   VRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  211
            +RV KE R AG+LEN+ +G++YAEHSLRKFVRNK+P+IMPS+N FF+DP+
Sbjct  59   IRVTKENRTAGILENHTKGERYAEHSLRKFVRNKAPQIMPSINGFFTDPK  108



>ref|XP_009406306.1| PREDICTED: uncharacterized protein LOC103989230 [Musa acuminata 
subsp. malaccensis]
Length=89

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
               +C FQL RN+  NP+VR+NK  R   VLEN +E ++Y++H LR+F+  + PEIMP++
Sbjct  19   VTSLCLFQLTRNMFLNPDVRINKSHRTTPVLENADEAQRYSQHGLRRFLSRRPPEIMPTI  78

Query  188  NRFFSDPQRN  217
            N FFS  +R+
Sbjct  79   NTFFSGIKRD  88



>ref|XP_006658786.1| PREDICTED: uncharacterized protein LOC102700818 [Oryza brachyantha]
Length=100

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  14   GICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNR  193
            G+C F L RN+  NP+VRVNK  R + V EN EEG+KY++H+ R+F+  + PE+ P++NR
Sbjct  21   GMCVFSLTRNVFMNPDVRVNKNNRQSAVPENAEEGEKYSQHAFRRFLGTQRPEVFPAINR  80

Query  194  FFSDP  208
            FF+ P
Sbjct  81   FFAGP  85



>gb|AAR13310.1| B12D-like protein [Phaseolus vulgaris]
Length=128

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 13/78 (17%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEV-------------RVNKEGRAAGVLENYEEGKKYAEHSLRK  148
               +C FQL RN+  NP+V             RVNK  R+  VL+N EEG+KYAEH LRK
Sbjct  48   VTSMCVFQLTRNLLGNPDVSILVINFWSENWYRVNKTRRSMAVLDNREEGEKYAEHGLRK  107

Query  149  FVRNKSPEIMPSLNRFFS  202
            F+R + PEIMP++N FFS
Sbjct  108  FLRTRPPEIMPTINHFFS  125



>gb|EMS55237.1| hypothetical protein TRIUR3_19745 [Triticum urartu]
Length=64

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   VNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQ  211
            VNK GRAAGVLEN+EEG++YAEH LR +V++K+PEIMP +N+FF+ P+
Sbjct  17   VNKMGRAAGVLENHEEGRRYAEHGLRAYVQDKTPEIMPGINKFFTSPK  64



>ref|XP_008810952.1| PREDICTED: uncharacterized protein LOC103722254 [Phoenix dactylifera]
Length=87

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +2

Query  11   VGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             G+C FQL RN+  NP+VR+NK  RA+ +L+N EEG+KY++HS RKF+  +   +MP+L+
Sbjct  20   TGMCAFQLTRNMILNPDVRINKARRASAILDNAEEGEKYSQHSFRKFLYRQRSAVMPALD  79

Query  191  RFFSDPQR  214
               +D  +
Sbjct  80   GLSTDSDK  87



>gb|EPS63516.1| hypothetical protein M569_11268, partial [Genlisea aurea]
Length=86

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = +2

Query  17   ICG---FQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
            +CG    QL RN+  NP VR+ K  R + +++N E+G KY EH+LRKF+R + PEIMP++
Sbjct  19   VCGMVVLQLTRNVMHNPAVRLKKSERGSAIVDNEEKGMKYTEHALRKFLRTRPPEIMPAV  78

Query  188  NRFFS  202
            NRFF+
Sbjct  79   NRFFA  83



>ref|XP_001757013.1| predicted protein [Physcomitrella patens]
 gb|EDQ78244.1| predicted protein [Physcomitrella patens]
Length=94

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
              A+ + GF + R+I  NP+VR++K+ R AGVLENY+EG+ Y  H LR +     P+IMP
Sbjct  24   ATALSMGGFVMARSIAVNPDVRISKQDREAGVLENYKEGEVYKNHRLRHYALKHGPQIMP  83

Query  182  SLNRFFSD  205
            SLN +FS 
Sbjct  84   SLNNYFSS  91



>ref|XP_009351238.1| PREDICTED: uncharacterized protein LOC103942755, partial [Pyrus 
x bretschneideri]
Length=66

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRK  148
            GVA+GICG  L R+IT NPEVRV+KEGRAAGVL+N+ EG+KY E+ LRK
Sbjct  9    GVAIGICGLSLFRHITINPEVRVSKEGRAAGVLDNHAEGEKYKENFLRK  57



>ref|XP_002961492.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
 gb|EFJ36752.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
Length=95

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  8    AVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSL  187
            AVG+  +   R + T+PEVRVNK+ R  G L+N+ EG+ Y  H LR+F+R+K  +IMP L
Sbjct  24   AVGLAAYLSARKLITDPEVRVNKDDRKHGRLDNHSEGEVYHNHPLRRFLRDKKTQIMPGL  83

Query  188  NRFFSDP  208
            N +FS P
Sbjct  84   NEYFSKP  90



>gb|EMS56733.1| Microspherule protein 1 [Triticum urartu]
Length=892

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEH  136
            GVAVGIC  QL+RNITTNPEVRV K+ RAAGVLEN++EGK+Y++H
Sbjct  31   GVAVGICVMQLVRNITTNPEVRVTKQNRAAGVLENHDEGKRYSQH  75



>ref|XP_010937886.1| PREDICTED: uncharacterized protein LOC105057112 [Elaeis guineensis]
Length=87

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    VAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPS  184
            +  G+C FQL RN+  NP+VR+NK  R+  +L+N EEG+ Y++HS RKF+    P ++PS
Sbjct  18   LVTGMCVFQLTRNMILNPDVRINKTRRSTAILDNAEEGEMYSQHSFRKFLYRLRPSVLPS  77

Query  185  LNRFFSDPQR  214
             +   +D  +
Sbjct  78   FDGLSTDSDK  87



>ref|XP_002975136.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
 ref|XP_002977540.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ21544.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ23921.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
Length=81

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRN-KSPEIM  178
              AVG+  F  +RN+T NPEVRVNK+ R AG+++N++EGK Y +H+LR+++   K  +I 
Sbjct  10   AAAVGLASFVSMRNLTLNPEVRVNKDDRMAGLVQNFKEGKAYHDHALRRYLYTRKHFQIT  69

Query  179  PSLNRFF  199
            P +N +F
Sbjct  70   PGINEYF  76



>ref|XP_001772578.1| predicted protein [Physcomitrella patens]
 gb|EDQ62620.1| predicted protein, partial [Physcomitrella patens]
Length=72

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKS  166
            G AVG+CG  ++RN + NP+VR+NKE RAAG LEN+ EGK Y + + R+F   +S
Sbjct  17   GTAVGLCGTAIVRNASINPDVRINKEDRAAGYLENFTEGKAYKDSAHRRFFAKQS  71



>gb|ACU13634.1| unknown [Glycine max]
Length=110

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  183  DGIISGLLLRTNFLRECSAYFFPSS*FSNtpaalpslltltSGLVVIFRIN*NPQIPTAT  4
            +GIISG+LLRT FLR+CSAYF PS+ FSNTPA LPSL TLTSGL+ I R N NPQIPTA 
Sbjct  2    EGIISGVLLRTYFLRKCSAYFSPSAKFSNTPAFLPSLFTLTSGLMQILRTNWNPQIPTAA  61

Query  3    P  1
            P
Sbjct  62   P  62



>gb|EMS53792.1| hypothetical protein TRIUR3_24112 [Triticum urartu]
Length=131

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMP  181
             +  G+C FQL RN+  NP+VRV+K  R + V EN EEG++Y++H+ R+FV    PE  P
Sbjct  17   SLVTGMCVFQLTRNVFLNPDVRVSKSNRQSAVPENEEEGERYSQHAFRRFVSAHRPEGFP  76

Query  182  S  184
            +
Sbjct  77   A  77



>gb|KDO50116.1| hypothetical protein CISIN_1g036394mg [Citrus sinensis]
Length=80

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  65   RVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQRN  217
            R++KE RA GVLEN+ EGK+++EH LR +V NK+PEIMP +  FF DP  +
Sbjct  27   RLSKENRAVGVLENFAEGKEFSEHFLRLYVHNKTPEIMPKIC-FFVDPNYD  76



>gb|AAP12919.2| expressed protein [Oryza sativa Japonica Group]
Length=84

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    VAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPS  184
            +A G+  FQL RN+ TNPEV+++K  R   V ++  E ++Y+ H  R+F   + PE+MPS
Sbjct  6    LASGMVVFQLGRNVCTNPEVKISKRNRRNAVPDSAAEAERYSMHGFRRFFGRRRPEVMPS  65

Query  185  LNRFFSDPQR  214
            +NRFFS+  R
Sbjct  66   INRFFSNSDR  75



>gb|ABF97493.1| expressed protein [Oryza sativa Japonica Group]
Length=81

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    VAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPS  184
            +A G+  FQL RN+ TNPEV+++K  R   V ++  E ++Y+ H  R+F   + PE+MPS
Sbjct  3    LASGMVVFQLGRNVCTNPEVKISKRNRRNAVPDSAAEAERYSMHGFRRFFGRRRPEVMPS  62

Query  185  LNRFFSDPQR  214
            +NRFFS+  R
Sbjct  63   INRFFSNSDR  72



>ref|NP_001050622.2| Os03g0601500 [Oryza sativa Japonica Group]
 gb|EEC75707.1| hypothetical protein OsI_12530 [Oryza sativa Indica Group]
 dbj|BAF12536.2| Os03g0601500 [Oryza sativa Japonica Group]
Length=96

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    VAVGICGFQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPS  184
            +A G+  FQL RN+ TNPEV+++K  R   V ++  E ++Y+ H  R+F   + PE+MPS
Sbjct  18   LASGMVVFQLGRNVCTNPEVKISKRNRRNAVPDSAAEAERYSMHGFRRFFGRRRPEVMPS  77

Query  185  LNRFFSDPQR  214
            +NRFFS+  R
Sbjct  78   INRFFSNSDR  87



>gb|ABR25826.1| b12d protein [Oryza sativa Indica Group]
Length=37

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  NYEEGKKYAEHSLRKFVRNKSPEIMPSLNRFFSDPQR  214
            N+EEG++YAEH LR +VR+K+PEIMP++N+FF++P +
Sbjct  1    NHEEGRRYAEHGLRNYVRDKTPEIMPAINKFFTEPTK  37



>ref|XP_001754887.1| predicted protein [Physcomitrella patens]
 gb|EDQ80341.1| predicted protein [Physcomitrella patens]
Length=1047

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  26    FQLIRNITTNPEVRVNKEGRAAGVLENYEEGKKYAEHSLRKFVRNKSPEIMPSLN  190
             F + R+++ NP++R+ KE R  GVL NY EGK Y +H  RKF+R +   +MPSLN
Sbjct  992   FFVSRSMSVNPDIRIKKEDRIVGVLNNYGEGKLYKDHEFRKFLRMQDKTVMPSLN  1046



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556930065965