BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN018J20

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2             348   2e-119   Nicotiana tomentosiformis
gb|KDP28183.1|  hypothetical protein JCGZ_13954                         348   4e-119   Jatropha curcas
ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like        347   6e-119   Nicotiana tomentosiformis
ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like        347   1e-118   Nicotiana sylvestris
ref|XP_002301485.1|  60S ribosomal protein L18                          345   5e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like        345   6e-118   Nicotiana tomentosiformis
gb|KJB41867.1|  hypothetical protein B456_007G127300                    344   2e-117   Gossypium raimondii
ref|NP_001237789.1|  uncharacterized protein LOC100500164               343   2e-117   Glycine max [soybeans]
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2             343   3e-117   Eucalyptus grandis [rose gum]
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like        343   3e-117   Nicotiana sylvestris
gb|KJB45330.1|  hypothetical protein B456_007G301700                    343   4e-117   Gossypium raimondii
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like        342   6e-117   Populus euphratica
ref|XP_002320999.1|  60S ribosomal protein L18                          342   9e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002523106.1|  60S ribosomal protein L18, putative                342   1e-116   Ricinus communis
gb|KHN43503.1|  60S ribosomal protein L18-2                             342   1e-116   Glycine soja [wild soybean]
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like        342   1e-116   Nicotiana sylvestris
gb|KHN20393.1|  60S ribosomal protein L18-2                             345   1e-116   Glycine soja [wild soybean]
ref|XP_007031040.1|  Ribosomal protein L18                              342   1e-116   Theobroma cacao [chocolate]
gb|KJB41866.1|  hypothetical protein B456_007G127300                    342   2e-116   Gossypium raimondii
ref|NP_001236701.1|  uncharacterized protein LOC100306301               341   2e-116   
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like        341   3e-116   Solanum lycopersicum
gb|KJB82632.1|  hypothetical protein B456_013G206100                    341   3e-116   Gossypium raimondii
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like        340   4e-116   Solanum tuberosum [potatoes]
ref|NP_001236071.1|  uncharacterized protein LOC100499789               340   4e-116   Glycine max [soybeans]
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                       340   5e-116   Gossypium arboreum [tree cotton]
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like        340   5e-116   Glycine max [soybeans]
gb|KJB23303.1|  hypothetical protein B456_004G091200                    340   5e-116   Gossypium raimondii
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g             340   8e-116   Phaseolus vulgaris [French bean]
ref|XP_006382454.1|  60S ribosomal protein L18                          339   1e-115   Populus trichocarpa [western balsam poplar]
gb|KDP23459.1|  hypothetical protein JCGZ_23292                         339   1e-115   Jatropha curcas
ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2             339   1e-115   Cucumis melo [Oriental melon]
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2             339   1e-115   Populus euphratica
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                    339   1e-115   Theobroma cacao [chocolate]
gb|KGN66048.1|  hypothetical protein Csa_1G569250                       341   2e-115   Cucumis sativus [cucumbers]
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3             338   3e-115   Cucumis melo [Oriental melon]
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like        338   4e-115   Cucumis sativus [cucumbers]
gb|KHN20252.1|  60S ribosomal protein L18-3                             338   5e-115   Glycine soja [wild soybean]
ref|XP_002319502.1|  60S ribosomal protein L18                          337   6e-115   Populus trichocarpa [western balsam poplar]
gb|KHN03962.1|  60S ribosomal protein L18-2                             337   9e-115   Glycine soja [wild soybean]
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                       337   1e-114   Gossypium arboreum [tree cotton]
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2             337   1e-114   Eucalyptus grandis [rose gum]
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg             337   1e-114   Citrus clementina [clementine]
ref|XP_010088293.1|  60S ribosomal protein L18-3                        337   2e-114   
emb|CDP17112.1|  unnamed protein product                                338   2e-114   Coffea canephora [robusta coffee]
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like        337   3e-114   Glycine max [soybeans]
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like        335   4e-114   Vitis vinifera
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2             335   4e-114   Tarenaya hassleriana [spider flower]
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2             335   4e-114   Populus euphratica
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g             335   5e-114   Phaseolus vulgaris [French bean]
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like        335   6e-114   Tarenaya hassleriana [spider flower]
gb|ABK92688.1|  unknown                                                 335   6e-114   Populus trichocarpa [western balsam poplar]
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like        335   7e-114   Solanum tuberosum [potatoes]
gb|AFK49563.1|  unknown                                                 334   8e-114   Lotus japonicus
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642    342   9e-114   
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like        334   1e-113   Tarenaya hassleriana [spider flower]
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like        334   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g             333   2e-113   
emb|CBI39539.3|  unnamed protein product                                336   2e-113   Vitis vinifera
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like        333   2e-113   
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g             333   2e-113   Phaseolus vulgaris [French bean]
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2             333   2e-113   Vitis vinifera
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3             333   3e-113   Tarenaya hassleriana [spider flower]
emb|CDO98841.1|  unnamed protein product                                335   3e-113   Coffea canephora [robusta coffee]
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like        333   4e-113   Nicotiana tomentosiformis
ref|XP_010094463.1|  60S ribosomal protein L18-2                        333   5e-113   
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like        332   5e-113   Pyrus x bretschneideri [bai li]
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like        332   6e-113   Malus domestica [apple tree]
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg             332   7e-113   Prunus persica
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like        332   9e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2             332   1e-112   
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                    332   1e-112   
ref|XP_010104147.1|  60S ribosomal protein L18-2                        332   1e-112   
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2             332   1e-112   Pyrus x bretschneideri [bai li]
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg             332   1e-112   Prunus persica
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2             331   1e-112   Malus domestica [apple tree]
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2             331   2e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001235897.1|  uncharacterized protein LOC100527681               331   2e-112   
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2             330   6e-112   Sesamum indicum [beniseed]
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg             330   7e-112   Citrus clementina [clementine]
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like        330   8e-112   Nelumbo nucifera [Indian lotus]
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3             329   8e-112   Nelumbo nucifera [Indian lotus]
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like        329   9e-112   Sesamum indicum [beniseed]
gb|KJB82634.1|  hypothetical protein B456_013G206100                    329   1e-111   Gossypium raimondii
ref|XP_002512455.1|  60S ribosomal protein L18, putative                337   1e-111   
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like          329   1e-111   Cicer arietinum [garbanzo]
emb|CDX74138.1|  BnaA03g29090D                                          330   2e-111   
gb|AFK45456.1|  unknown                                                 328   2e-111   Lotus japonicus
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2             328   2e-111   Vitis vinifera
ref|NP_187210.1|  60S ribosomal protein L18-2                           328   4e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like        328   4e-111   Elaeis guineensis
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2             328   4e-111   Brassica rapa
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                       327   1e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2             327   1e-110   Elaeis guineensis
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850             326   2e-110   Arabidopsis lyrata subsp. lyrata
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                    326   3e-110   Arabis alpina [alpine rockcress]
emb|CDY18813.1|  BnaAnng02780D                                          328   3e-110   Brassica napus [oilseed rape]
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2             325   3e-110   Phoenix dactylifera
emb|CBI22977.3|  unnamed protein product                                328   3e-110   Vitis vinifera
emb|CDY40718.1|  BnaC03g34340D                                          327   3e-110   Brassica napus [oilseed rape]
emb|CBI36879.3|  unnamed protein product                                329   5e-110   Vitis vinifera
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like        325   7e-110   Brassica rapa
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like        324   9e-110   
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3             324   1e-109   Nelumbo nucifera [Indian lotus]
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860          324   1e-109   Sorghum bicolor [broomcorn]
ref|XP_002874343.1|  60S ribosomal protein L18                          324   1e-109   Arabidopsis lyrata subsp. lyrata
ref|NP_198137.1|  60S ribosomal protein L18-3                           323   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2             323   4e-109   Brassica rapa
emb|CDY66803.1|  BnaAnng22990D                                          323   5e-109   Brassica napus [oilseed rape]
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg             322   6e-109   Eutrema salsugineum [saltwater cress]
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like        322   6e-109   Phoenix dactylifera
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2             322   8e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750          322   1e-108   Sorghum bicolor [broomcorn]
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3             321   1e-108   Elaeis guineensis
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like        323   1e-108   Brassica rapa
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like          321   1e-108   
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2             321   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like        321   2e-108   Brassica rapa
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg             321   2e-108   Capsella rubella
gb|EMS45435.1|  60S ribosomal protein L18-2                             321   2e-108   Triticum urartu
emb|CDY19736.1|  BnaA09g03890D                                          322   2e-108   Brassica napus [oilseed rape]
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like        321   2e-108   Phoenix dactylifera
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like        320   4e-108   Camelina sativa [gold-of-pleasure]
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like        320   4e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3             320   5e-108   Camelina sativa [gold-of-pleasure]
emb|CDX99969.1|  BnaC09g03320D                                          321   5e-108   
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                    319   7e-108   
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like        320   7e-108   Camelina sativa [gold-of-pleasure]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like        320   7e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560          319   9e-108   Amborella trichopoda
ref|NP_001131538.1|  uncharacterized protein LOC100192878               319   1e-107   Zea mays [maize]
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg             320   1e-107   
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like          318   2e-107   Cicer arietinum [garbanzo]
gb|EMT12638.1|  60S ribosomal protein L18-2                             318   2e-107   
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg             318   3e-107   Capsella rubella
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    317   4e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like        317   5e-107   Camelina sativa [gold-of-pleasure]
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                    317   5e-107   Arabis alpina [alpine rockcress]
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like        317   6e-107   
emb|CDX80616.1|  BnaC07g28280D                                          318   8e-107   
emb|CDY25018.1|  BnaC02g39900D                                          317   8e-107   Brassica napus [oilseed rape]
gb|ABK26318.1|  unknown                                                 317   9e-107   Picea sitchensis
ref|NP_001050069.1|  Os03g0341100                                       316   2e-106   
ref|XP_003591163.1|  Ribosomal protein L18                              315   3e-106   Medicago truncatula
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like        315   3e-106   
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like        315   5e-106   Brachypodium distachyon [annual false brome]
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like        314   1e-105   Setaria italica
gb|ABK21809.1|  unknown                                                 314   1e-105   Picea sitchensis
emb|CDY05559.1|  BnaA02g31320D                                          325   1e-105   
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2             313   1e-105   Nicotiana tomentosiformis
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like        313   2e-105   Oryza brachyantha
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein                313   5e-105   Phaseolus vulgaris [French bean]
gb|ABK22247.1|  unknown                                                 312   7e-105   Picea sitchensis
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2             311   1e-104   Solanum lycopersicum
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3             311   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_003626231.1|  60S ribosomal protein L18                          311   2e-104   Medicago truncatula
gb|EPS67068.1|  hypothetical protein M569_07709                         311   2e-104   Genlisea aurea
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like        312   2e-104   
ref|NP_001132852.1|  uncharacterized protein LOC100194344               311   2e-104   Zea mays [maize]
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like        310   4e-104   Oryza brachyantha
emb|CDY05183.1|  BnaC05g46200D                                          311   5e-104   
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290          310   5e-104   Sorghum bicolor [broomcorn]
gb|AFC88838.1|  60S ribosomal protein L18-like protein                  309   8e-104   Miscanthus sinensis
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    309   9e-104   Tarenaya hassleriana [spider flower]
gb|AFK34017.1|  unknown                                                 308   1e-103   Medicago truncatula
gb|KEH24393.1|  60S ribosomal protein L18-3                             308   1e-103   Medicago truncatula
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157    316   1e-103   
gb|EMT18368.1|  60S ribosomal protein L18-2                             307   7e-103   
dbj|BAJ90421.1|  predicted protein                                      306   9e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001781485.1|  predicted protein                                  306   1e-102   
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like        306   1e-102   Brachypodium distachyon [annual false brome]
ref|NP_001060617.1|  Os07g0674700                                       306   1e-102   
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like        306   2e-102   Oryza brachyantha
ref|XP_001760902.1|  predicted protein                                  306   2e-102   
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like        306   2e-102   Setaria italica
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...    305   3e-102   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001751734.1|  predicted protein                                  304   1e-101   
ref|NP_001054688.1|  Os05g0155100                                       303   1e-101   
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like        303   2e-101   Nicotiana tomentosiformis
gb|EMS65848.1|  60S ribosomal protein L18-2                             304   5e-101   Triticum urartu
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg                302   5e-101   Erythranthe guttata [common monkey flower]
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302    325   6e-101   
gb|ACJ85943.1|  unknown                                                 298   1e-99    Medicago truncatula
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18         296   6e-99    Cicer arietinum [garbanzo]
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2             296   7e-99    Fragaria vesca subsp. vesca
emb|CEF99132.1|  Ribosomal protein L18e, conserved site                 296   7e-99    Ostreococcus tauri
ref|XP_001785869.1|  predicted protein                                  296   8e-99    
gb|KIZ05100.1|  60S ribosomal protein L18-3                             295   3e-98    Monoraphidium neglectum
ref|XP_001760959.1|  predicted protein                                  293   1e-97    
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...    291   6e-97    Chlamydomonas reinhardtii
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg                291   1e-96    Erythranthe guttata [common monkey flower]
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...    291   1e-96    Volvox carteri f. nagariensis
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...    291   1e-96    Ostreococcus lucimarinus CCE9901
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein                290   2e-96    Miscanthus sinensis
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976             290   3e-96    Selaginella moellendorffii
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978             290   3e-96    Selaginella moellendorffii
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                    289   8e-96    Arabis alpina [alpine rockcress]
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334              287   5e-95    Chlorella variabilis
gb|AAO46881.1|  60S ribosomal protein                                   285   1e-94    Medicago sativa [alfalfa]
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...    285   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007510670.1|  predicted protein                                  285   1e-93    Bathycoccus prasinos
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...    279   6e-92    Coccomyxa subellipsoidea C-169
gb|ADD54595.1|  putative ribosomal protein L18                          276   2e-91    Linum usitatissimum
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2             276   4e-91    Nicotiana sylvestris
gb|KHG01788.1|  60S ribosomal L18-2 -like protein                       275   1e-90    Gossypium arboreum [tree cotton]
gb|KJB26287.1|  hypothetical protein B456_004G239000                    273   4e-89    Gossypium raimondii
dbj|BAJ93091.1|  predicted protein                                      270   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011396696.1|  60S ribosomal protein L18-3                        266   6e-87    Auxenochlorella protothecoides
ref|XP_003056676.1|  predicted protein                                  265   1e-86    Micromonas pusilla CCMP1545
ref|XP_002506220.1|  ribosomal protein L18                              267   1e-84    Micromonas commoda
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18               258   6e-84    Camponotus floridanus
ref|XP_001745439.1|  hypothetical protein                               258   1e-83    Monosiga brevicollis MX1
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18               258   2e-83    Ooceraea biroi
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                  257   2e-83    Tribolium castaneum [rust-red flour beetle]
emb|CBK21900.2|  Ribosomal protein L18e                                 257   2e-83    Blastocystis hominis
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003              257   3e-83    Batrachochytrium dendrobatidis JAM81
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like          257   6e-83    
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18               255   1e-82    Harpegnathos saltator
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like          254   2e-82    Apis mellifera [bee]
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like          254   4e-82    Apis florea [dwarf honeybee]
emb|CBK22327.2|  unnamed protein product                                254   6e-82    Blastocystis hominis
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18               253   6e-82    Ceratosolen solmsi marchali
gb|KDR14978.1|  60S ribosomal protein L18                               253   1e-81    Zootermopsis nevadensis
gb|EFN87206.1|  60S ribosomal protein L18                               253   1e-81    Harpegnathos saltator
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18               254   1e-81    Acromyrmex echinatior
gb|AAX48850.1|  L18                                                     252   2e-81    Suberites domuncula
gb|KJB41868.1|  hypothetical protein B456_007G127300                    252   2e-81    Gossypium raimondii
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like          252   3e-81    Ooceraea biroi
gb|KJB45331.1|  hypothetical protein B456_007G301700                    252   3e-81    Gossypium raimondii
emb|CAJ17294.1|  ribosomal protein L18e                                 251   5e-81    Hister sp. APV-2005
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854             251   7e-81    Emiliania huxleyi CCMP1516
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18               250   1e-80    Nasonia vitripennis
gb|KJB23304.1|  hypothetical protein B456_004G091200                    249   2e-80    Gossypium raimondii
gb|ABR23470.1|  60s ribosomal protein L18                               249   3e-80    Ornithodoros parkeri
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18               249   3e-80    Microplitis demolitor
emb|CBJ25909.1|  cytoplasmic ribosomal protein L18                      249   5e-80    Ectocarpus siliculosus
ref|XP_004991895.1|  ribosomal protein l18                              248   7e-80    Salpingoeca rosetta
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18               248   8e-80    Fopius arisanus
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    250   8e-80    
ref|XP_001640445.1|  predicted protein                                  248   9e-80    Nematostella vectensis
ref|XP_002400316.1|  ribosomal protein L18, putative                    248   9e-80    Ixodes scapularis [blacklegged tick]
gb|EFZ15690.1|  hypothetical protein SINV_04174                         248   1e-79    
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18         247   2e-79    Timarcha balearica
gb|ABW90395.1|  putative ribosomal protein L18                          246   3e-79    Barentsia elongata
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724       254   3e-79    
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406       253   4e-79    
ref|XP_010559184.1|  PREDICTED: 60S ribosomal protein L18-2-like        245   4e-79    Tarenaya hassleriana [spider flower]
ref|XP_006433452.1|  hypothetical protein CICLE_v10002597mg             246   4e-79    
ref|XP_003081305.1|  ribosomal protein L18 (ISS)                        246   5e-79    
emb|CBK22442.2|  unnamed protein product                                245   8e-79    Blastocystis hominis
gb|KJB82633.1|  hypothetical protein B456_013G206100                    243   1e-78    Gossypium raimondii
ref|XP_009012591.1|  hypothetical protein HELRODRAFT_156470             245   1e-78    Helobdella robusta
ref|XP_004345091.2|  ribosomal protein L18e                             245   1e-78    Capsaspora owczarzaki ATCC 30864
gb|KJB23305.1|  hypothetical protein B456_004G091200                    243   2e-78    Gossypium raimondii
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like          245   2e-78    Microplitis demolitor
gb|EPZ37075.1|  60S ribosomal protein L18-2                             244   2e-78    Rozella allomycis CSF55
gb|AAN73381.1|  ribosomal protein L18                                   244   3e-78    Branchiostoma lanceolatum [common lancelet]
gb|KJE95959.1|  ribosomal protein L18e                                  245   3e-78    Capsaspora owczarzaki ATCC 30864
gb|KDD74971.1|  hypothetical protein H632_c955p1                        243   3e-78    Helicosporidium sp. ATCC 50920
gb|KJB22517.1|  hypothetical protein B456_004G052100                    242   4e-78    Gossypium raimondii
dbj|BAN21088.1|  ribosomal protein L18                                  244   4e-78    Riptortus pedestris
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                  243   5e-78    
gb|KCW85063.1|  hypothetical protein EUGRSUZ_B01908                     241   1e-77    Eucalyptus grandis [rose gum]
ref|XP_009834317.1|  hypothetical protein H257_09702                    243   1e-77    Aphanomyces astaci
ref|XP_002161036.1|  PREDICTED: 60S ribosomal protein L18-like          243   1e-77    
ref|XP_008876054.1|  hypothetical protein H310_11242                    242   3e-77    Aphanomyces invadans
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18         241   4e-77    Diaphorina citri
ref|XP_010550998.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    240   4e-77    Tarenaya hassleriana [spider flower]
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like          241   7e-77    Amphimedon queenslandica
ref|XP_005312106.1|  PREDICTED: 60S ribosomal protein L18               239   2e-76    Chrysemys picta bellii
gb|KDO39192.1|  hypothetical protein CISIN_1g030771mg                   238   3e-76    Citrus sinensis [apfelsine]
ref|XP_003977661.1|  PREDICTED: 60S ribosomal protein L18-like          239   3e-76    
gb|ADV03016.1|  ribosomal protein L18                                   239   3e-76    Karlodinium veneficum
gb|ABW23172.1|  ribosomal protein rpl18                                 239   3e-76    Arenicola marina [rock worm]
gb|AAN73382.1|  ribosomal protein L18                                   239   3e-76    Petromyzon marinus [marine lamprey]
ref|XP_009036910.1|  hypothetical protein AURANDRAFT_37496              239   3e-76    Aureococcus anophagefferens
gb|EFX65754.1|  hypothetical protein DAPPUDRAFT_303528                  239   4e-76    Daphnia pulex
gb|ELT99918.1|  hypothetical protein CAPTEDRAFT_159560                  238   6e-76    Capitella teleta
ref|XP_007722189.1|  large subunit ribosomal protein L18e               238   6e-76    Capronia coronata CBS 617.96
ref|XP_002595537.1|  hypothetical protein BRAFLDRAFT_275280             238   6e-76    Branchiostoma floridae
gb|AEE61752.1|  unknown                                                 238   6e-76    
ref|XP_008607735.1|  60S ribosomal protein                              238   7e-76    
ref|XP_009158973.1|  50S ribosomal protein L18e                         238   1e-75    
gb|EWM27599.1|  Ribosomal protein L18e/L15P                             238   1e-75    
ref|XP_011449585.1|  PREDICTED: 60S ribosomal protein L18-like          237   1e-75    
sp|Q56FG8.1|RL18_LYSTE  RecName: Full=60S ribosomal protein L18         237   2e-75    
ref|XP_008843215.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    237   2e-75    
ref|NP_001011030.1|  60S ribosomal protein L18                          237   2e-75    
sp|Q4PM04.1|RL18_IXOSC  RecName: Full=60S ribosomal protein L18         237   2e-75    
ref|XP_008843214.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    236   3e-75    
gb|AAW25981.1|  SJCHGC06655 protein                                     236   3e-75    
emb|CAX79061.1|  ribosomal protein L18                                  236   3e-75    
ref|XP_005336693.1|  PREDICTED: 60S ribosomal protein L18               236   3e-75    
gb|AGH70165.1|  60S ribosomal protein L18                               236   3e-75    
ref|NP_648091.1|  ribosomal protein L18, isoform A                      236   4e-75    
ref|NP_112364.1|  60S ribosomal protein L18                             236   4e-75    
ref|XP_004526749.1|  PREDICTED: 60S ribosomal protein L18-like          236   5e-75    
ref|XP_007779084.1|  60S ribosomal protein L18-B                        236   5e-75    
ref|XP_004061142.1|  PREDICTED: 60S ribosomal protein L18               236   5e-75    
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...    236   5e-75    
ref|XP_005190752.1|  PREDICTED: 60S ribosomal protein L18               236   6e-75    
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                   235   6e-75    
ref|XP_002423194.1|  60S ribosomal protein L18, putative                236   7e-75    
ref|XP_001209532.1|  60S ribosomal protein L18                          235   7e-75    
ref|XP_008567503.1|  PREDICTED: 60S ribosomal protein L18               235   8e-75    
emb|CCD58684.1|  60S ribosomal protein L18, putative                    235   8e-75    
ref|XP_002047296.1|  GJ13360                                            235   9e-75    
ref|XP_002733428.1|  PREDICTED: 60S ribosomal protein L18-like          235   1e-74    
ref|XP_010277700.1|  PREDICTED: uncharacterized protein LOC104612082    245   1e-74    
ref|XP_002035667.1|  GM13785                                            235   1e-74    
ref|XP_003801570.1|  PREDICTED: ribosomal protein L18-like              235   1e-74    
ref|XP_006160253.1|  PREDICTED: 60S ribosomal protein L18               235   1e-74    
emb|CAX72134.1|  ribosomal protein L18                                  235   1e-74    
gb|EKC43150.1|  60S ribosomal protein L18                               235   1e-74    
ref|XP_010786834.1|  PREDICTED: 60S ribosomal protein L18               235   1e-74    
ref|XP_010385886.1|  PREDICTED: 60S ribosomal protein L18               234   2e-74    
ref|XP_007074184.1|  PREDICTED: ribosomal protein L18-like              234   2e-74    
ref|XP_002130217.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    234   2e-74    
gb|KFM61778.1|  60S ribosomal protein L18                               234   2e-74    
ref|NP_000970.1|  60S ribosomal protein L18 isoform 1                   234   2e-74    
gb|ACD65168.1|  putative 60S ribosomal protein RPL18                    233   2e-74    
ref|XP_004089423.1|  PREDICTED: 60S ribosomal protein L18               234   2e-74    
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                   234   2e-74    
ref|XP_011184309.1|  PREDICTED: 60S ribosomal protein L18               234   2e-74    
ref|XP_002094010.1|  GE20435                                            234   2e-74    
ref|NP_001182442.1|  60S ribosomal protein L18                          234   2e-74    
ref|NP_001187045.1|  60S ribosomal protein L18                          234   3e-74    
emb|CCQ18599.1|  60S ribosomal protein L18                              234   3e-74    
ref|XP_002109185.1|  expressed hypothetical protein                     234   3e-74    
ref|NP_001003432.1|  60S ribosomal protein L18                          234   3e-74    
ref|XP_004451162.1|  PREDICTED: ribosomal protein L18-like              234   3e-74    
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                   234   4e-74    
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                   234   4e-74    
ref|XP_007536290.1|  PREDICTED: 60S ribosomal protein L18               234   4e-74    
ref|XP_006229223.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    234   4e-74    
ref|XP_004694311.1|  PREDICTED: 60S ribosomal protein L18               233   5e-74    
gb|EYE97298.1|  ribosomal protein L18e                                  234   5e-74    
gb|KIY03022.1|  60S ribosomal protein L18-A                             233   5e-74    
emb|CCU77907.1|  putative 60S ribosomal protein L18                     233   5e-74    
gb|KIW75160.1|  60S ribosomal protein L18-A                             233   6e-74    
ref|XP_010366954.1|  PREDICTED: 60S ribosomal protein L18               233   6e-74    
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                    233   6e-74    
ref|XP_006109734.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    233   7e-74    
emb|CAD91422.1|  ribosomal protein L18                                  233   7e-74    
ref|NP_001015556.1|  60S ribosomal protein L18                          233   8e-74    
gb|EPS29111.1|  hypothetical protein PDE_04060                          233   8e-74    
gb|AEE62646.1|  unknown                                                 233   8e-74    
ref|XP_001550924.1|  60S ribosomal protein L18                          233   8e-74    
gb|KIW89279.1|  60S ribosomal protein L18-A                             233   9e-74    
gb|KIV82136.1|  60S ribosomal protein L18-A                             233   9e-74    
ref|XP_001971483.1|  GG14989                                            233   1e-73    
ref|XP_008046837.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    233   1e-73    
ref|NP_001082683.1|  60S ribosomal protein L18-B                        233   1e-73    
ref|XP_008152619.1|  PREDICTED: 60S ribosomal protein L18               232   1e-73    
gb|EJD73862.1|  hypothetical protein, variant                           232   1e-73    
gb|AAH21743.1|  Ribosomal protein L18                                   232   2e-73    
gb|KIW69267.1|  hypothetical protein PV04_05151                         232   2e-73    
gb|KIW11507.1|  60S ribosomal protein L18-A                             232   2e-73    
gb|ABZ04231.1|  ribosomal protein rpl18                                 232   2e-73    
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                  232   2e-73    
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                  231   2e-73    
gb|EFB23978.1|  hypothetical protein PANDA_006316                       231   2e-73    
ref|XP_004271135.1|  PREDICTED: 60S ribosomal protein L18 isoform 1     231   2e-73    
ref|XP_005589842.1|  PREDICTED: uncharacterized LOC101867006 isof...    232   3e-73    
gb|KIW61527.1|  hypothetical protein PV05_01638                         231   3e-73    
ref|NP_001082681.1|  60S ribosomal protein L18-A                        231   4e-73    
ref|XP_006026818.1|  PREDICTED: 60S ribosomal protein L18               231   5e-73    
ref|XP_002771969.1|  60S ribosomal protein L18, putative                231   5e-73    
gb|ACO51847.1|  60S ribosomal protein L18                               231   5e-73    
gb|KIW28110.1|  60S ribosomal protein L18-A                             231   5e-73    
ref|XP_006266602.1|  PREDICTED: 60S ribosomal protein L18               233   5e-73    
gb|KIW43484.1|  60S ribosomal protein L18-B                             232   6e-73    
ref|XP_006868227.1|  PREDICTED: ribosomal protein L18-like              231   6e-73    
emb|CEP17694.1|  hypothetical protein                                   230   7e-73    
sp|P02412.4|RL18B_XENLA  RecName: Full=60S ribosomal protein L18-...    230   7e-73    
ref|XP_005798872.1|  PREDICTED: 60S ribosomal protein L18-like          230   7e-73    
gb|ELR56635.1|  60S ribosomal protein L18                               230   8e-73    
ref|XP_008727056.1|  hypothetical protein G647_04492                    230   9e-73    
ref|XP_007742086.1|  large subunit ribosomal protein L18e               230   9e-73    
ref|XP_008714847.1|  hypothetical protein HMPREF1541_02269              230   9e-73    
ref|XP_001082813.1|  PREDICTED: 60S ribosomal protein L18-like is...    230   1e-72    
ref|XP_001092745.1|  PREDICTED: 60S ribosomal protein L18-like          230   1e-72    
gb|ELR09673.1|  hypothetical protein GMDG_04159                         231   1e-72    
gb|KEF62683.1|  large subunit ribosomal protein L18e                    230   1e-72    
ref|XP_001588139.1|  60S ribosomal protein L18                          229   1e-72    
ref|XP_011372891.1|  PREDICTED: 60S ribosomal protein L18               230   1e-72    
ref|XP_001897286.1|  60S ribosomal protein L18                          229   2e-72    
gb|ACR35483.1|  unknown                                                 228   2e-72    
emb|CBN08626.1|  ribosomal protein L18                                  229   2e-72    
ref|XP_008429815.1|  PREDICTED: 60S ribosomal protein L18               229   2e-72    
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                  229   2e-72    
gb|EFQ34059.1|  eukaryotic ribosomal protein L18                        229   2e-72    
ref|XP_006298641.1|  hypothetical protein CARUB_v10014730mg             227   2e-72    
gb|KDN61013.1|  putative eukaryotic ribosomal protein L18               229   2e-72    
ref|XP_006894610.1|  PREDICTED: ribosomal protein L18-like              229   3e-72    
ref|XP_006840598.1|  hypothetical protein AMTR_s00343p00015240          228   3e-72    
gb|KHJ35313.1|  putative 60s ribosomal protein l18                      229   3e-72    
ref|XP_007550032.1|  PREDICTED: 60S ribosomal protein L18               229   3e-72    
ref|XP_007756404.1|  60S ribosomal protein L18-B                        229   3e-72    
emb|CEP19927.1|  hypothetical protein                                   228   4e-72    
dbj|GAN04379.1|  60S ribosomal protein L18                              228   4e-72    
emb|CAB40827.1|  unnamed protein product                                228   5e-72    
gb|EJW88057.1|  50S ribosomal protein L18                               228   5e-72    
ref|XP_004358287.1|  eukaryotic ribosomal protein L18, putative         228   6e-72    
gb|ELW47918.1|  60S ribosomal protein L18                               228   6e-72    
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                    228   6e-72    
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882             228   6e-72    
gb|AAS49555.1|  ribosomal protein L18                                   227   6e-72    
ref|XP_005561217.1|  PREDICTED: 60S ribosomal protein L18-like          228   6e-72    
ref|XP_004619784.1|  PREDICTED: 60S ribosomal protein L18               230   6e-72    
ref|XP_011211055.1|  PREDICTED: 60S ribosomal protein L18               228   8e-72    
ref|XP_006138489.1|  PREDICTED: 60S ribosomal protein L18-like          228   8e-72    
ref|XP_010883138.1|  PREDICTED: 60S ribosomal protein L18               228   8e-72    
ref|XP_755074.1|  60S ribosomal protein L18                             227   1e-71    
gb|EMR82472.1|  putative 60s ribosomal protein l18 protein              228   1e-71    
ref|XP_008891573.1|  hypothetical protein PPTG_02269                    227   1e-71    
ref|XP_007804599.1|  hypothetical protein EPUS_07572                    237   1e-71    
gb|ABO26684.1|  ribosomal protein l18                                   227   1e-71    
ref|XP_001260260.1|  60S ribosomal protein L18                          227   1e-71    
ref|XP_011125411.1|  hypothetical protein AOL_s00112g79                 227   1e-71    
ref|XP_003142248.1|  hypothetical protein LOAG_06664                    228   2e-71    
gb|KIJ19828.1|  hypothetical protein PAXINDRAFT_166053                  227   2e-71    
ref|XP_007879935.1|  hypothetical protein PFL1_04221                    227   2e-71    
ref|XP_002371723.1|  60S ribosomal protein L18, putative                227   2e-71    
emb|CEP15166.1|  hypothetical protein                                   228   2e-71    
ref|XP_009176548.1|  hypothetical protein T265_11593                    226   2e-71    
emb|CAA28689.1|  ribosomal protein L14                                  226   2e-71    
emb|CCI45423.1|  unnamed protein product                                227   2e-71    
emb|CCV00013.1|  unnamed protein product                                227   3e-71    
emb|CDP94036.1|  Protein BM-RPL-18, isoform b                           228   3e-71    
gb|EPB85693.1|  50S ribosomal protein L18e                              227   3e-71    
ref|XP_002901873.1|  60S ribosomal protein L18-2                        226   3e-71    
ref|XP_008888411.1|  ribosomal protein RPL18                            226   4e-71    
ref|XP_006735598.1|  PREDICTED: ribosomal protein L18-like              228   5e-71    
ref|XP_004780465.1|  PREDICTED: ribosomal protein L18-like              226   6e-71    
ref|XP_010455078.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    224   6e-71    
ref|XP_002722941.1|  PREDICTED: 60S ribosomal protein L18               225   6e-71    
ref|XP_002558988.1|  Pc13g05540                                         225   7e-71    
sp|Q962Y8.1|RL18_SPOFR  RecName: Full=60S ribosomal protein L18         225   7e-71    
gb|EPB87658.1|  60S ribosomal protein L18-A                             225   7e-71    
gb|EPB81859.1|  50S ribosomal protein L18e                              226   7e-71    
ref|XP_011387324.1|  ribosomal 60S subunit protein L18                  225   8e-71    
ref|XP_007143771.1|  hypothetical protein PHAVU_007G100200g             224   8e-71    
dbj|GAN01748.1|  60S ribosomal protein L18                              226   8e-71    
emb|CCA16204.1|  60S ribosomal protein L182 putative                    225   8e-71    
ref|XP_007862613.1|  60S ribosomal protein L18                          225   9e-71    
gb|KHN77912.1|  60S ribosomal protein L18                               226   1e-70    
gb|KII96054.1|  hypothetical protein PLICRDRAFT_48977                   225   1e-70    
gb|EST06100.1|  armadillo                                               225   1e-70    
dbj|GAA55611.1|  large subunit ribosomal protein L18e                   226   1e-70    
gb|EMD40971.1|  hypothetical protein CERSUDRAFT_80614                   224   1e-70    
gb|EKG21215.1|  Ribosomal protein L18e                                  224   1e-70    
gb|KIV96156.1|  60S ribosomal protein L18-B                             224   1e-70    
gb|ESZ97529.1|  60S ribosomal protein L18                               224   2e-70    
ref|XP_007315262.1|  hypothetical protein SERLADRAFT_381487             224   2e-70    
gb|ADV03044.1|  ribosomal protein L18                                   224   2e-70    
dbj|GAN11649.1|  60S ribosomal protein L18                              226   2e-70    
gb|EHH30225.1|  hypothetical protein EGK_10844                          224   2e-70    
ref|XP_007677109.1|  hypothetical protein BAUCODRAFT_122987             224   2e-70    
ref|XP_007586342.1|  putative 60s ribosomal protein l18 protein         224   2e-70    
gb|AFW77276.1|  hypothetical protein ZEAMMB73_917876                    223   3e-70    
ref|XP_007833554.1|  60S ribosomal protein L18-B                        224   3e-70    
ref|XP_003886070.1|  Ribosomal protein L18, related                     224   3e-70    
ref|NP_001018228.1|  60S ribosomal protein L18                          224   3e-70    
emb|CDO74156.1|  hypothetical protein BN946_scf185043.g207              224   3e-70    
ref|XP_007067265.1|  PREDICTED: 60S ribosomal protein L18               224   4e-70    
ref|XP_663404.1|  hypothetical protein AN5800.2                         223   4e-70    
emb|CDI57167.1|  probable 60S ribosomal protein L18                     223   5e-70    
gb|ACN41161.1|  unknown                                                 221   5e-70    
ref|XP_001267682.1|  60S ribosomal protein L18                          223   5e-70    
gb|EYC13586.1|  hypothetical protein Y032_0043g800                      223   5e-70    
gb|ETN74514.1|  eukaryotic ribosomal protein L18                        223   6e-70    
dbj|BAJ97000.1|  predicted protein                                      223   7e-70    
emb|CCF54530.1|  probable 60S ribosomal protein L18                     223   7e-70    
sp|P09897.2|RL18A_XENLA  RecName: Full=60S ribosomal protein L18-...    223   8e-70    
ref|XP_006903368.1|  PREDICTED: ribosomal protein L18-like              223   9e-70    
gb|ERG80123.1|  60s ribosomal protein l18                               224   9e-70    
ref|XP_002378206.1|  60S ribosomal protein L18                          222   9e-70    
gb|KIM67674.1|  hypothetical protein SCLCIDRAFT_13851                   222   1e-69    
ref|XP_001956062.1|  GF24783                                            222   1e-69    
emb|CDH60299.1|  60s ribosomal protein l18                              222   1e-69    
ref|XP_002007966.1|  GI12089                                            222   1e-69    
ref|XP_007364417.1|  60S ribosomal protein L18                          222   1e-69    
ref|XP_007381758.1|  60S ribosomal protein L18                          222   1e-69    
ref|XP_308294.3|  AGAP007580-PB                                         222   1e-69    
ref|XP_007392123.1|  hypothetical protein PHACADRAFT_181562             222   1e-69    
emb|CCX32543.1|  Similar to 60S ribosomal protein L18-B; acc. no....    222   1e-69    
dbj|GAD98621.1|  60S ribosomal protein L18                              222   1e-69    
gb|EPT03125.1|  hypothetical protein FOMPIDRAFT_1022488                 222   2e-69    
ref|XP_006157526.1|  PREDICTED: 60S ribosomal protein L18-like          223   2e-69    
ref|XP_007847122.1|  60s ribosomal protein l18                          221   2e-69    
gb|AAN73352.1|  ribosomal protein L18                                   221   2e-69    
emb|CDS08904.1|  Putative 50S ribosomal protein L18e                    221   2e-69    
ref|XP_005704346.1|  60S ribosomal protein L18e                         221   2e-69    
gb|KIK65689.1|  hypothetical protein GYMLUDRAFT_70778                   221   2e-69    
gb|KIX00906.1|  60S ribosomal protein L18-A                             221   2e-69    
ref|XP_002068278.1|  GK13159                                            221   2e-69    
ref|XP_009543935.1|  hypothetical protein HETIRDRAFT_472767             221   3e-69    
gb|ERG81080.1|  60s ribosomal protein l18                               222   3e-69    
gb|EIE90592.1|  60S ribosomal protein L18-B                             221   3e-69    
ref|XP_001659268.1|  AAEL008481-PA                                      221   4e-69    



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score =   348 bits (894),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+  GKEDK+ V+VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEDKVVVIVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKP+VR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPFVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score =   348 bits (893),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLISFT GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLISFTKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   347 bits (891),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+  GKEDKIAV+VGTITDDVRAY+VP LKVCAL+FTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEDKIAVIVGTITDDVRAYDVPTLKVCALKFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   347 bits (889),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEVP L VCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEVPTLMVCALRFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   345 bits (885),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI+F  GKEDKIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKEDKIAVVVGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   345 bits (885),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFN VILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEVP L VCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEVPTLMVCALRFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score =   344 bits (882),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   343 bits (881),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VG ITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGNITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score =   343 bits (880),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VGTITDD+R +EVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTQGKEDKIAVVVGTITDDIRVHEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   343 bits (880),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTG KFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGCKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+  GKE KIAV+VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEGKIAVIVGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score =   343 bits (880),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRK+ERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKYERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score =   342 bits (878),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++  GKE KIAV+VGTITDD+R YEVPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEGKIAVVVGTITDDIRVYEVPAIKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   342 bits (877),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PL+LSRLI++  GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLALSRLITYMKGKEGKIAVVVGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score =   342 bits (877),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI+F  GKE+KIAV+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKENKIAVIVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   342 bits (877),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   342 bits (876),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKL+VKLYRFLV+RTGSKFN VILK LFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLIVKLYRFLVQRTGSKFNTVILKWLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+  GKEDKI V+VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEDKIVVIVGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score =   345 bits (885),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  88   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  147

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  148  PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  207

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  208  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  267

Query  608  NS  613
            NS
Sbjct  268  NS  269



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score =   342 bits (876),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score =   342 bits (878),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP
Sbjct  42   GIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  101

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
            LSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLT
Sbjct  102  LSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLT  161

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  610
            FDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+RN
Sbjct  162  FDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRN  221

Query  611  S  613
            S
Sbjct  222  S  222



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score =   341 bits (874),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG++
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRK  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score =   341 bits (874),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+  GK DK  VLVGT+TDDVRAYEVP LKVCAL+FTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEVPKLKVCALKFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score =   341 bits (874),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR++GRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSRGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   340 bits (873),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+  GK DK  VLVGT+TDDVRAYEVP LKVCAL+FTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEVPKLKVCALKFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score =   340 bits (873),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYAKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score =   340 bits (872),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+ GRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSNGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score =   340 bits (872),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VG+ITDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEVPPLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score =   340 bits (872),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARI+KAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIDKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score =   340 bits (871),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE+KIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKENKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSH+KPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHSKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   339 bits (870),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKP+VRAKGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPFVRAKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score =   339 bits (870),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKT  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRFMKGKESKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score =   339 bits (870),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGKESKIAVVVGTITDDIRVYEVPALKVAALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFERARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   339 bits (870),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKP+VRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPFVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score =   339 bits (869),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
             MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK
Sbjct  57   VMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNK  116

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PPLSLSRLI FT GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGEC
Sbjct  117  PPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEVPALKVAALRFTETARARIEKAGGEC  176

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFERARGK
Sbjct  177  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFERARGK  236

Query  605  RNS  613
            RNS
Sbjct  237  RNS  239



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score =   338 bits (867),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI +  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLIKYMKGKEAKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score =   338 bits (866),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI + +GKE +IAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLIKYMNGKEGRIAVIVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score =   338 bits (866),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
             GIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    QGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VG+ITDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEVPPLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   337 bits (865),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPTLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   337 bits (864),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ AL+FT+ ARARIEKAGGECL
Sbjct  61   PISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVPALKITALKFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFD+LALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDELALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score =   337 bits (865),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFM K NKP
Sbjct  21   MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMCKVNKP  80

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFTKTARARI+KAGGECL
Sbjct  81   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRIYEVPALKVTALRFTKTARARIDKAGGECL  140

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+K RKFERARG+R
Sbjct  141  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKARKFERARGRR  200

Query  608  NS  613
            NS
Sbjct  201  NS  202



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score =   337 bits (863),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VGT+TDD+R Y+VPALKV ALRFT+T RARIEKAGGECL
Sbjct  61   PLSLSRLIRYTQGKEDKIAVVVGTVTDDIRVYDVPALKVTALRFTETVRARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score =   337 bits (863),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score =   337 bits (863),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKPP
Sbjct  12   GIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKPP  71

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
            LSLSRLI F  GKEDK+AV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLT
Sbjct  72   LSLSRLIRFMKGKEDKVAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLT  131

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  610
            FDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRN
Sbjct  132  FDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRN  191

Query  611  S  613
            S
Sbjct  192  S  192



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKP
Sbjct  48   MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNVVILKRLFMSKINKP  107

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
             LSLSRLI++T GKEDKIAV+VGT+TDD R YEVP+LKV ALRFT+TARARIEKAGGECL
Sbjct  108  ALSLSRLITYTKGKEDKIAVVVGTVTDDTRVYEVPSLKVTALRFTETARARIEKAGGECL  167

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHS+TKPYVR+ GRKFERARG+R
Sbjct  168  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVRSSGRKFERARGRR  227

Query  608  NS  613
            NS
Sbjct  228  NS  229



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score =   337 bits (863),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKP
Sbjct  28   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNKP  87

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ AL+FT+ ARARIEKAGGECL
Sbjct  88   PISLSRLIKYTKGKEDKIAVVVGTVTDDIRVYEVPALKITALKFTERARARIEKAGGECL  147

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  148  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  207

Query  608  NS  613
            NS
Sbjct  208  NS  209



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score =   335 bits (860),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score =   335 bits (860),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRVAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRL+ F  GKEDK+AV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLVRFMQGKEDKVAVIVGTVTDDLRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   335 bits (860),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSHTKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score =   335 bits (859),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE KIAV+VGTITDD+R YEVP+LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEGKIAVVVGTITDDIRVYEVPSLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   335 bits (859),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GKED+I V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKEDQIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score =   335 bits (858),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPTLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPH HTKPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHGHTKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   335 bits (858),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVTYMTGKEDNIAVIVGTVTDDVRAYEVPKIKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFERARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score =   334 bits (857),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKR APKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRIAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI +  GKEDK+ V+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLIKYAKGKEDKVVVIVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEMARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score =   342 bits (877),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
             MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK
Sbjct  202  VMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNK  261

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PPLSLSRLI FT GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGEC
Sbjct  262  PPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEVPALKVAALRFTETARARIEKAGGEC  321

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFERARGK
Sbjct  322  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFERARGK  381

Query  605  RNS  613
            RNS
Sbjct  382  RNS  384



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   334 bits (856),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GKED I V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMEGKEDNIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   334 bits (856),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GK+DKI V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 3/182 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI+F  GK   IAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGK---IAVVVGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  117

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+KGRKFE+ARGKR
Sbjct  118  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKR  177

Query  608  NS  613
            NS
Sbjct  178  NS  179



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            TMGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK
Sbjct  62   TMGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNK  121

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGEC
Sbjct  122  PPLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGEC  181

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVR+KGRKFERARG+
Sbjct  182  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGR  241

Query  605  RNS  613
            RNS
Sbjct  242  RNS  244



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI + +GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEVPCLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKEDKIAV+VGTITDD+R YEVP LK+ AL+FT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGTITDDIRVYEVPQLKITALKFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI +  GKEDKIAVLVGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PMSLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEVPTLKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   333 bits (854),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F  GKED+I V+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVRFMQGKEDQIGVIVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   335 bits (859),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGK K+TKRTAPKS D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMSKTNKP
Sbjct  57   MGIDLKAGGKVKKTKRTAPKSHDIYLKLLVKLYRFLVRRTGSRFNAVLLKRLFMSKTNKP  116

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F  GKEDKIAVLVGT+TDD R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  117  PLSLSRLVKFMEGKEDKIAVLVGTVTDDTRVYEVPTLKVAALRFTERARARIEKAGGECL  176

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA GRKFERARG+R
Sbjct  177  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRATGRKFERARGRR  236

Query  608  NS  613
            NS
Sbjct  237  NS  238



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   333 bits (853),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MG+DLK GGKSK+TKRT PKSDDVYLKLLVKLYRF VRRT SKFNAVILKRLFMSKTNKP
Sbjct  1    MGVDLKVGGKSKKTKRTTPKSDDVYLKLLVKLYRFFVRRTESKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS+  GKE+KIAV+VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYVKGKENKIAVIVGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LL+GPKN+REAVKHFGPAPGVPHSHTKPY+ +KGRKFERARG R
Sbjct  121  TFDQLALRAPLGQNTLLLKGPKNAREAVKHFGPAPGVPHSHTKPYMHSKGRKFERARGIR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score =   333 bits (853),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP
Sbjct  13   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPP  72

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
            LSLSRLI F  GKE KIAV+VGT+TDD+R Y+VPALKV ALRFT+TARARIEKAGGECLT
Sbjct  73   LSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDVPALKVTALRFTETARARIEKAGGECLT  132

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  610
            FDQLAL+APLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRN
Sbjct  133  FDQLALKAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRN  192

Query  611  S  613
            S
Sbjct  193  S  193



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score =   332 bits (852),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GK++KIAV+VGT+TDD+R YEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKDNKIAVVVGTVTDDIRVYEVPQMKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   332 bits (852),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GK+ KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKDSKIAVVVGTVTDDIRVYEVPQLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score =   332 bits (851),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFSAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI + +GK+ KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMNGKDGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   332 bits (851),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ +  GK+ +IAVLVGTITDD+R YEVP +KVCALRFT+TARARIEKAGGEC+
Sbjct  61   PLSLSRLVKYMEGKDGRIAVLVGTITDDIRVYEVPTMKVCALRFTETARARIEKAGGECI  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVRA GRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRANGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   332 bits (850),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTSSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI + +GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEVPCLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score =   332 bits (850),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLL +LYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLL-QLYRFLVRRTGSKFNAVILKRLFMSKVNKP  59

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  60   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  119

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  120  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  179

Query  608  NS  613
            NS
Sbjct  180  NS  181



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score =   332 bits (852),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP
Sbjct  24   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPP  83

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
            LSLSRLI F  GKE KIAV+VGT+TDD+R Y+VPALKV ALRFT+TARARIEKAGGECLT
Sbjct  84   LSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDVPALKVTALRFTETARARIEKAGGECLT  143

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  610
            FDQLAL+APLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKRN
Sbjct  144  FDQLALKAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRN  203

Query  611  S  613
            S
Sbjct  204  S  204



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score =   332 bits (850),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI + +GKE KIAV+VGT+TDD+R Y+VP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYDVPCLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score =   332 bits (850),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GK++KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKDNKIAVVVGTVTDDIRVYEVPQLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQN VLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   331 bits (849),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTASKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GK++KIAV+VGTITDD+R YEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKDNKIAVVVGTITDDIRVYEVPQMKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   331 bits (849),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGS FN V+LKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSSFNGVVLKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKIAVIVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVRA GRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRANGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score =   331 bits (848),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYR LVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRSLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ AL+ T+ ARARIEKAGGECL
Sbjct  61   PISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVPALKITALKSTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFD+LALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDELALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score =   330 bits (845),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS  +GKEDKIAVLVG++TDD+R +EVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLISLMNGKEDKIAVLVGSVTDDIRVHEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRG + +REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGSRKAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score =   330 bits (845),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRT S F+ VILKRLFMSK NKP
Sbjct  1    MGIDLIAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFDKVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRL  F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PMSLSRLTKFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score =   330 bits (845),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMS+ NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSRVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI F  GKEDKIAV+VG +TDD R YE+PALKV ALRFT+TARARI KAGGECL
Sbjct  61   PISLSRLIKFMKGKEDKIAVVVGAVTDDTRVYELPALKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   329 bits (844),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLISF  GKEDKIAV+VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PMSLSRLISFMKGKEDKIAVIVGTVTDDTRVYEVPALKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score =   329 bits (844),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLIS  +GKEDKIAVLVG++TDD+R +EVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLISLMNGKEDKIAVLVGSVTDDMRVHEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRG + +REAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGSRKAREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score =   329 bits (844),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 3/182 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GK   IAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGK---IAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  117

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR++GRKFERARG+R
Sbjct  118  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSRGRKFERARGRR  177

Query  608  NS  613
            NS
Sbjct  178  NS  179



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            +MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK
Sbjct  216  SMGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINK  275

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
             PLSLSRLI+F  GKE K AV+VGT+TDD+R YEVPALKV AL+FT+TARARIEKAGGEC
Sbjct  276  APLSLSRLITFMKGKESKTAVVVGTVTDDIRVYEVPALKVTALKFTETARARIEKAGGEC  335

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLA+RAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+
Sbjct  336  LTFDQLAMRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGR  395

Query  605  RNS  613
            RNS
Sbjct  396  RNS  398



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   329 bits (843),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESSFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRFMKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score =   330 bits (845),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK
Sbjct  26   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNK  85

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
             PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGEC
Sbjct  86   APLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGEC  145

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGK
Sbjct  146  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGK  205

Query  605  RNS  613
            R S
Sbjct  206  RKS  208



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score =   328 bits (842),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FN+VILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNSVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPALKVAALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+ GRKFE+ARGKR
Sbjct  121  TFDQLALIAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSNGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   328 bits (841),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEVPCLKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score =   328 bits (840),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score =   328 bits (840),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVIL+RLFMSK NKP
Sbjct  1    MGIDLKAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILRRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSL RL++F  GKEDKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PLSLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARIVKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   328 bits (840),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score =   327 bits (837),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK N+ 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNRA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score =   327 bits (837),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RLI F  GKEDKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI +AGGECL
Sbjct  61   PISLKRLIRFMEGKEDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILQAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   326 bits (835),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGT+TDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTVTDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRGKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score =   326 bits (835),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSDSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL  F  GKEDKIAVLVGTITDD+R +E+PALKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLAEFLKGKEDKIAVLVGTITDDLRVHEIPALKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  63   MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  122

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  123  PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  182

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR
Sbjct  183  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKR  242

Query  608  NS  613
             S
Sbjct  243  KS  244



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score =   325 bits (834),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL +LI+F  GKEDKIAVLVGT+TDD R YEVPA+ V ALRFT+TARARI KAGGEC 
Sbjct  61   PISLKKLITFMEGKEDKIAVLVGTVTDDKRVYEVPAMTVTALRFTETARARILKAGGECW  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +2

Query  74   IDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPL  253
            IDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP+
Sbjct  70   IDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPM  129

Query  254  SLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTF  433
            SLSRLI +  GKEDKIAVLVGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECLTF
Sbjct  130  SLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEVPTLKVTALRFTERARARIEKAGGECLTF  189

Query  434  DQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNS  613
            DQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+RNS
Sbjct  190  DQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNS  249



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK
Sbjct  40   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNK  99

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
             PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGEC
Sbjct  100  APLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGEC  159

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSH+KPYVR+KGRKFE+ARGK
Sbjct  160  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRAPGVPHSHSKPYVRSKGRKFEKARGK  219

Query  605  RNS  613
            R S
Sbjct  220  RKS  222



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   329 bits (843),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  111  MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  170

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  171  PLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEVPCLKVTALRFTERARARIEKAGGECL  230

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  231  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  290

Query  608  NS  613
            NS
Sbjct  291  NS  292



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   325 bits (832),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL +PLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALSSPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score =   324 bits (831),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSDFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSL RL++F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSLRRLVNFMKGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETARARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   324 bits (831),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRLI +  GKE+KIAVLVGT+TDD R Y+VPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PMSLSRLIRYMEGKENKIAVLVGTVTDDTRVYDVPALKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score =   324 bits (830),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSL RL++F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSLRRLVNFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETARARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   324 bits (830),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHS TKPYVR KGRKFE+ARGKR
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSSTKPYVRHKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score =   323 bits (829),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ S FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GK+DKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKDDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHS+TKPYVR KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVRHKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   323 bits (827),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score =   323 bits (827),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  14   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  73

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F +GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  74   PLSLSKLVEFMNGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  133

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR
Sbjct  134  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKR  193

Query  608  NS  613
             S
Sbjct  194  KS  195



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score =   322 bits (825),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFL RRT SKFN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLFRRTNSKFNGVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+ GRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSTGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   322 bits (825),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RLI F  GKEDKI V+VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PISLKRLIRFMEGKEDKIVVIVGTVTDDKRVYEVPAMKVTALRFTETARARILNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   322 bits (825),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RLI+F +GK++KIAV+VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEVPALKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFG APGVPHSHTKPY+R+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYIRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score =   322 bits (824),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVKFMEGKSDQIAVIVGTVTDDKRINEVPAMKVCALRFTETARARIINAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score =   321 bits (823),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RL  F  GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+T RARI KAGGECL
Sbjct  61   PISLKRLAKFMEGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETVRARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS TKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSRTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score =   323 bits (827),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  95

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  96   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  155

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR
Sbjct  156  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKR  215

Query  608  NS  613
             S
Sbjct  216  KS  217



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   321 bits (823),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GKE KI V+VG +TDD+R Y+VPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKEGKIGVVVGAVTDDIRVYDVPAIKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   321 bits (823),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RLI+F +GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMNGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   321 bits (822),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score =   321 bits (822),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F  GKEDKIAVLVGT+TDDVR +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMEGKEDKIAVLVGTVTDDVRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score =   321 bits (822),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+ RL+ F  GKEDKIAV+VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKEDKIAVIVGTITDDQRVYEIPAMKVAALRFTETARARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score =   322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  29   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  88

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  89   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  148

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKR
Sbjct  149  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKR  208

Query  608  NS  613
             S
Sbjct  209  KS  210



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   321 bits (822),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RL++F  GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLVTFMQGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL++PLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALQSPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   320 bits (820),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRL+ F SGKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PISLSRLVEFMSGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   320 bits (820),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RLI+F +GK++KIAV+VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEVPALKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSNTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score =   320 bits (820),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score =   321 bits (822),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  24   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  83

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  84   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  143

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRAKGRKFE+ARGKR
Sbjct  144  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKR  203

Query  608  NS  613
             S
Sbjct  204  KS  205



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score =   319 bits (818),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 167/182 (92%), Gaps = 7/182 (4%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT       NSREAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNT-------NSREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  173

Query  608  NS  613
            NS
Sbjct  174  NS  175



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   320 bits (819),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEIPAMKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   320 bits (819),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ +RTA +SDDVYLKLLVKLYRFLVRRTGSKFNAVIL+RLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTASRSDDVYLKLLVKLYRFLVRRTGSKFNAVILRRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RLI+F  GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMQGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRK+ERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKYERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score =   319 bits (818),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+ AGGKSK+T RTAPKS DVYLK+LVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDIVAGGKSKKTHRTAPKSGDVYLKILVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F +GKEDK+AV+VGT+TDD R YEVPALKV ALRFT+ ARARI KAGGECL
Sbjct  61   PLSLSRLIKFMAGKEDKVAVIVGTVTDDTRVYEVPALKVTALRFTERARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFD LALRAPLG+NTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDDLALRAPLGRNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score =   319 bits (817),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTVTDDKRISEVPAMKVCALRFTETARARIINAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score =   320 bits (821),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+GSKFNAVILKRLFMSK NK 
Sbjct  44   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSGSKFNAVILKRLFMSKVNKA  103

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL++F  GKE KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  104  PLSLSRLVTFMKGKEGKIAVLVGTITDDLRIHEIPAMKVTALRFTERARARIEKAGGECL  163

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFG APGVPHS+TKPYVR+KGRKFE+ARG+R
Sbjct  164  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGLAPGVPHSNTKPYVRSKGRKFEKARGRR  223

Query  608  NS  613
             S
Sbjct  224  KS  225



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   318 bits (815),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE KIAV+VG ITDD+R YEVPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEGKIAVVVGAITDDIRVYEVPAIKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRAKGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score =   318 bits (815),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+ RL+ F  GK DKIAV+VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKADKIAVIVGTITDDQRVYEIPAMKVAALRFTETARARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score =   318 bits (814),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+SF  GK+ KI VLVGTITDD+R  E+PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVSFMEGKDGKIGVLVGTITDDLRIQEIPAMKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHS TKPYVRAKGRKFE+ARG+R
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSSTKPYVRAKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score =   317 bits (813),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+SF +GK+ KI VLVGTITDD+R +++PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDIPAMKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR +GRKFE+ARG+R
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRGRGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score =   317 bits (813),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+SF +GK+ KI VLVGTITDD+R +++PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDIPAMKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR KGRKFE+ARG+R
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRGKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score =   317 bits (813),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+   SGK+DKIAVLVGTITDDVR +++PA+KV ALRFT+ ARARI KAGGECL
Sbjct  61   PLSLSRLVELMSGKDDKIAVLVGTITDDVRVHDIPAIKVAALRFTERARARIVKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   317 bits (812),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTESKFNAVILKRLFMSKNNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RLI+F   K+DKIAV+VGT+TDD R Y+VPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMERKDDKIAVIVGTVTDDKRVYDVPAMKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score =   318 bits (816),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  46   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  105

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  106  PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  165

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSH+KPYVR+KGRKFE+ARGKR
Sbjct  166  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGLAPGVPHSHSKPYVRSKGRKFEKARGKR  225

Query  608  NS  613
             S
Sbjct  226  KS  227



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score =   317 bits (812),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  11   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  70

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L  F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  71   PLSLSKLAEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  130

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSH+KPYVR+KGRKFE+ARGKR
Sbjct  131  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGLAPGVPHSHSKPYVRSKGRKFEKARGKR  190

Query  608  NS  613
             S
Sbjct  191  KS  192



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score =   317 bits (811),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSKQT+RTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLIAGGKSKQTRRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL  +  GKEDKIAV+VGTITDD R YE+P +K+ ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSRLARYMQGKEDKIAVVVGTITDDNRVYELPPVKITALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPK+ REAVKHFG APGVPHSHTKPYVR+KGRK+E ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKSHREAVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score =   316 bits (809),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSL RL+ F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI   GGECL
Sbjct  61   PLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETARARIVNTGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_003591163.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES61414.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=187

 Score =   315 bits (808),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGK+K+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T+GKE KIAV+VG ITDDVR  EVPA+KV ALRFT+ ARARIE AGGECL
Sbjct  61   PLSLSRLIKYTNGKEGKIAVVVGAITDDVRVNEVPAIKVTALRFTERARARIESAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVP SHTKPYVR K RK E+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPQSHTKPYVRGKSRKIEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score =   315 bits (807),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+ RL+ F  GK D+IAV+VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTITDDKRVYEIPAMKVAALRFTETARARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVRHFGAAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score =   315 bits (806),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT + FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKNHFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSL RL+ F  GKE++IAV+VGTITDD + YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSLRRLVKFMEGKENQIAVIVGTITDDKKVYEVPAMKVAALRFTETARARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALHAPLGQNTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score =   314 bits (804),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+ 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSPFNAVILKRLFMSKANRS  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVKFMEGKGDQIAVIVGTVTDDKRITEVPAMKVCALRFTETARARIINAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTV+LRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVILRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score =   314 bits (804),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSEDIYLKLLVKLYRFLVRRTSSSFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL  +  GK+DKIAV+VGTITDD R YE+P +KV ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSRLARYMQGKDDKIAVVVGTITDDNRVYELPPVKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPK+ REAVKHFG APGVPHSHTKPYVR+KGRK+E ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKSHREAVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  95

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  96   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  155

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRAKGRKFE+ARGKR
Sbjct  156  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKR  215

Query  608  NS  613
             S
Sbjct  216  KS  217



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score =   313 bits (803),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++  GKEDK+AV+VGT+TDDVRAYEVP+LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKVAVVVGTVTDDVRAYEVPSLKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRAPGVPHSHTKPYVRAKGRKFERARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   313 bits (803),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSL RL+ F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+T RARI  AGGECL
Sbjct  61   PLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETVRARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score =   313 bits (803),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 172/217 (79%), Gaps = 35/217 (16%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID KAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDFKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGK-----------------------------------EDKIAVLVGTI  322
            PLSLSRLI +T GK                                   EDKIAV+VGTI
Sbjct  61   PLSLSRLIRYTKGKVCLSIFFTSCTGVASSHIVLLIIAYISTFYFCQMLEDKIAVVVGTI  120

Query  323  TDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSR  502
            TDD+R YEVP LK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLGQNTVL RGPKN+R
Sbjct  121  TDDIRVYEVPQLKITALKFTERARARIEKAGGECLTFDQLALRAPLGQNTVLFRGPKNAR  180

Query  503  EAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNS  613
            EAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARG+RNS
Sbjct  181  EAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRNS  217



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score =   312 bits (799),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSKQTKRTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLIAGGKSKQTKRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL  +  GK+DK+AV+VGTITDD R YE+P +KV ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSRLARYMQGKDDKVAVVVGTITDDNRVYELPPVKVTALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL APLGQNTVLLRGPK+ REAVKHFG APGVPHSHTKPYVR+KGRK+E ARG+R
Sbjct  121  TFDQLALCAPLGQNTVLLRGPKSHREAVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score =   311 bits (797),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLSRRTGSKFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVTYMTGKEDNIAVVVGTVTDDVRAYEVPKIKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRAKGRKFERARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   311 bits (797),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ F  GKEDKI V+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVRFMQGKEDKIGVVVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_003626231.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|ACJ85938.1| unknown [Medicago truncatula]
 gb|AES82449.1| 60S ribosomal protein L18-3 [Medicago truncatula]
 gb|AFK48984.1| unknown [Medicago truncatula]
Length=187

 Score =   311 bits (796),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK TKRT PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLKAGGKSKNTKRTEPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLS++I +  GK+ KI V+VG +TDD+R YEVP LK+ ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSKMIEYMKGKDGKIGVVVGAVTDDIRVYEVPVLKIAALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSH+KPYVR+KGRK E+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSHSKPYVRSKGRKQEKARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score =   311 bits (796),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT SKFN V+LKRLFMS+ N+PP
Sbjct  1    GIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESKFNGVVLKRLFMSRVNRPP  60

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
            L LSRLI+   GKEDKIAVLVGTITDD R +EVP LKV ALRFT+T RARIEKAGGECLT
Sbjct  61   LRLSRLIAHMKGKEDKIAVLVGTITDDNRIHEVPPLKVTALRFTETVRARIEKAGGECLT  120

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  610
            FDQLALRAPLGQNTVLLRG +N+REAV+HFGPAPGVPHS TKPYVR+KGRKFERARG+RN
Sbjct  121  FDQLALRAPLGQNTVLLRGSRNAREAVRHFGPAPGVPHSSTKPYVRSKGRKFERARGRRN  180

Query  611  S  613
            S
Sbjct  181  S  181



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  36   MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  95

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECL
Sbjct  96   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECL  155

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  156  TFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  215

Query  608  NS  613
            NS
Sbjct  216  NS  217



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score =   311 bits (796),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   310 bits (793),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAP+S+DVY+KLLVKLYRFL RRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYVKLLVKLYRFLERRTKSHFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+ RL+ F  GK D+IAV+VGT+TDD R YEVPA+KV ALRFT+TA+ARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTVTDDKRVYEVPAMKVAALRFTETAKARIINAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score =   311 bits (797),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GIDL AGGKSK+TKRTAPKSDDVYL      YRFLVRRT SKFNAVILKRLFMSK NK P
Sbjct  38   GIDLIAGGKSKKTKRTAPKSDDVYLSSPESFYRFLVRRTQSKFNAVILKRLFMSKVNKAP  97

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
            LSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARA IEKAGGECLT
Sbjct  98   LSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARASIEKAGGECLT  157

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  610
            FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+KGRKFE+ARGKR 
Sbjct  158  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRK  217

Query  611  S  613
            S
Sbjct  218  S  218



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score =   310 bits (793),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            P+SL RL+ F  GKE+K IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score =   309 bits (792),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            P+SL RL+ F  GKE+K IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLG+NTVL+RGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPLGENTVLMRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score =   309 bits (791),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL++F  GKEDKI V+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR  GRKFERARG+R
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRYTGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|AFK34017.1| unknown [Medicago truncatula]
Length=188

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA-KGRKFERARGK  604
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR  K RK E ARGK
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSNTKPYVRGKKSRKVEAARGK  180

Query  605  RNS  613
            R S
Sbjct  181  RKS  183



>gb|KEH24393.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=188

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA-KGRKFERARGK  604
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR  K RK E ARGK
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSNTKPYVRGKKSRKVEAARGK  180

Query  605  RNS  613
            R S
Sbjct  181  RKS  183



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score =   316 bits (810),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            + GIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+
Sbjct  211  SQGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINR  270

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PP+SL RL++F  GK DKIAV+VGT+TDD R Y+VPALKV ALRFT+TARARI KAGGEC
Sbjct  271  PPISLKRLVTFMEGKGDKIAVIVGTVTDDKRVYDVPALKVTALRFTETARARILKAGGEC  330

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFD LALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  331  LTFDHLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  390

Query  605  RNS  613
            RNS
Sbjct  391  RNS  393



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score =   307 bits (786),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTALRFTETARARIINAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   306 bits (785),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEIPAMKVTALRFTETARARIVNAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+TN+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRTNRA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+SRL+ + +GKE KIAVLVGTITDDVR +EVPALKVCALRFT+TARARI KAGGECL
Sbjct  61   PLSMSRLVKYMTGKEGKIAVLVGTITDDVRQFEVPALKVCALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAP G NTVLLRGPKN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPTGSNTVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
            NS
Sbjct  180  NS  181



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 169/183 (92%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYL+LLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLRLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PLS+ RL +F  GK++K IAV+VGTITDD R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKDEKSIAVIVGTITDDKRIQEIPAMKVTALRFTETARARIINAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAP+G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPMGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 169/190 (89%), Gaps = 8/190 (4%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGK--------EDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARI  403
            PLS+ RL+ F  GK         D+IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI
Sbjct  61   PLSMRRLVRFMEGKVPDRHAISGDQIAVIVGTVTDDKRIYEVPAMKVAALRFTETARARI  120

Query  404  EKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRK  583
              AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+KGRK
Sbjct  121  INAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRK  180

Query  584  FERARGKRNS  613
            FE+ARG+RNS
Sbjct  181  FEKARGRRNS  190



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAP+SDDVYLKL+VKLYRFL RRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLIVKLYRFLYRRTKSKFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PLSL RL  F  GKE+K IAV+VGT+TDD R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSLRRLAKFMEGKEEKNIAVIVGTVTDDKRIQEIPAMKVTALRFTETARARIVNAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EVPALKVCALRFT+TARARI KAGGECL
Sbjct  61   PLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEVPALKVCALRFTETARARIVKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAP G NTVLLRGPKN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPTGANTVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
            NS
Sbjct  180  NS  181



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSSFNAVILKRLFMSKANRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            P+SL RL +F  GKE+K IAV+VGT+TDD R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PISLRRLANFMKGKEEKNIAVIVGTVTDDKRIQEIPAMKVTALRFTETARARIINAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score =   305 bits (781),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTALRFTETARARIINAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ RG+
Sbjct  121  LTFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKVRGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+VILKRLFMS+TN+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNSVILKRLFMSRTNRA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEVPALKVAALRFTETARARILKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAP G NTVLLRGPKN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPTGANTVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
            NS
Sbjct  180  NS  181



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+TKRTAP+SDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PLSL RL  F  GKE+  IAV+VGT+TDD R  E+P +KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSLRRLAKFMEGKEENNIAVIVGTVTDDKRIQEIPKMKVTALRFTETARARIVNAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR  180

Query  605  RNS  613
            RNS
Sbjct  181  RNS  183



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   303 bits (775),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TK TAPKS DVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKCTAPKSGDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++  GKEDK+ V+VGT+TDDVRAYEVP+LKV ALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKVVVVVGTVTDDVRAYEVPSLKVTALRFTKTARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFG APGVPHSHTKPYVRAKGRKFERARGKR
Sbjct  121  TFDQLALRAPLGQNMVLLRGPKNSREAVKHFGRAPGVPHSHTKPYVRAKGRKFERARGKR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score =   304 bits (778),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GIDL AGG++K+TKR APKS+DVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PP
Sbjct  8    GIDLVAGGRNKRTKRVAPKSNDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPP  67

Query  251  LSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            LS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGECL
Sbjct  68   LSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTALRFTETARARIVNAGGECL  127

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  128  TFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  187

Query  608  NS  613
            NS
Sbjct  188  NS  189



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score =   302 bits (773),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRT PKSDD+Y+KLLVKLY FLVRRTGSKFN V+ KRL MS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTKPKSDDIYIKLLVKLYSFLVRRTGSKFNEVVRKRLTMSRVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL +   GKE++IAVLVG++TDD+R +E+PA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLSALMKGKENQIAVLVGSVTDDIRVHEIPAMKVAALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTV+LRG + +REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPLGQNTVILRGSRKAREAVRHFGAAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score =   325 bits (832),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+P
Sbjct  802  MGIDLIAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKVNRP  861

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SL RL++F  GKEDKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGEC 
Sbjct  862  PISLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECF  921

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALR+PLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  922  TFDQLALRSPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRR  981

Query  608  NS  613
            NS
Sbjct  982  NS  983



>gb|ACJ85943.1| unknown [Medicago truncatula]
 gb|AFK48653.1| unknown [Medicago truncatula]
Length=174

 Score =   298 bits (763),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAK  574
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR K
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSNTKPYVRGK  169



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score =   296 bits (759),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = +2

Query  77   DLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLS  256
            DLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+PPLS
Sbjct  1    DLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRPPLS  60

Query  257  LSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFD  436
            LSRLI +  GKE KI V+VG +TDD+R Y+VP +KV AL+FT+TARARI+KAGGECLTFD
Sbjct  61   LSRLIKYMQGKEGKIGVVVGAVTDDIRVYDVPTIKVTALKFTETARARIQKAGGECLTFD  120

Query  437  QLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNS  613
            QLALR PL  +TVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R S
Sbjct  121  QLALRLPL-TDTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRKS  178



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score =   296 bits (759),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK T+RT+P+S D+YLKL VKLY F+ RRT S F+ VI  RL MSK NK 
Sbjct  1    MGIDLVAGGKSKNTRRTSPRSQDIYLKLTVKLYDFIHRRTKSHFSKVIRHRLCMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL  +  G EDKIAVLVGT+TDDVR  EVPALKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLCRYMQGHEDKIAVLVGTVTDDVRIAEVPALKVTALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTMLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score =   296 bits (759),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRTGSKFN  +LKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRNKKTSRTAPKSDNVYLKLLVKLYRFLARRTGSKFNETVLKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L  F  GKE K+A +VGTITDDVR ++VP LKVCALRFT+TARARI KAGGEC+
Sbjct  61   PLSLSKLAKFMKGKEGKVAAVVGTITDDVRMFDVPKLKVCALRFTETARARIIKAGGECM  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL AP G+  VLLRGPKNSREAVKHFG APG+P SH KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALAAPTGEGVVLLRGPKNSREAVKHFG-APGIPGSHAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
            NS
Sbjct  180  NS  181



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   296 bits (759),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+P
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+S+SRL+ + +GKE KIAV+VGT+TDD R YEVPALKV ALRFT+TARARI K+GGE L
Sbjct  61   PISMSRLVKYMTGKEGKIAVIVGTVTDDTRIYEVPALKVAALRFTETARARILKSGGEVL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAP G N VLLRGPKN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPTGSNCVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
            NS
Sbjct  180  NS  181



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score =   295 bits (755),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++ +  RTAPKSD+VYLKLLVKLYRFL RRT S FNAV+LKRLFMSK N+P
Sbjct  1    MGIDLVAGGRNTKKHRTAPKSDNVYLKLLVKLYRFLERRTESNFNAVVLKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L  F +GKEDK+AVLVGT+TDDVR +EVP L+V ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSKLAKFMAGKEDKVAVLVGTVTDDVRLHEVPKLRVTALRFTETARARIVKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL  P G++ VLLRGPKN+REAVKHFGPAPGVPHS TKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALERPTGKDCVLLRGPKNNREAVKHFGPAPGVPHSSTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   293 bits (751),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNAVVLKRLFMSRINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+S+SRL+ +  GKEDKIAV+VG++TDD R YEVPALKV ALRFT+TARARI K GGE L
Sbjct  61   PISMSRLVRYMKGKEDKIAVIVGSVTDDTRIYEVPALKVAALRFTETARARILKNGGEVL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAP G N VLLRGPKN+REAVKHFG APGVP SH KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRAPTGSNCVLLRGPKNAREAVKHFG-APGVPRSHAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
            NS
Sbjct  180  NS  181



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score =   291 bits (746),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTESKFNKVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L +F  GKE K+AV+V T+TDDVR +EVP L+VCALRFT+TARARI KAGGECL
Sbjct  61   PLSLSKLAAFMKGKESKVAVIVATVTDDVRLFEVPKLRVCALRFTETARARITKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL+ P G++ VLLRGPK+ REA KHFGPAPGVP S TKPYVRAKGRKFE+ARG+R
Sbjct  121  TFDQLALQRPTGKDCVLLRGPKSQREACKHFGPAPGVPGSTTKPYVRAKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score =   291 bits (745),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAP+S+DVY+KLLVKLYRFL RRTGS FN++ILKRL MS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPRSNDVYIKLLVKLYRFLTRRTGSSFNSIILKRLIMSRVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL S   GKE +IAVLVG+ITDD+R +E+PA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLSSLMKGKEGQIAVLVGSITDDIRVHEIPAMKVAALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRG + +REAV+HFGPAPGVPHSHTKPYVR+KGRKFE+ARGKR
Sbjct  121  TFDQLALRAPLGQNTVLLRGSRKAREAVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGKR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score =   291 bits (744),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTDSKFNKVILKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L +F  GKE+K+AV+V T+TDDVR YEVP L+V ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSKLATFMKGKENKVAVIVATVTDDVRLYEVPKLRVVALRFTETARARITKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL  P G++ VLLRGPK+ REAVKHFGPAPGVP S TKPYVRAKGRKFE+ARG+R
Sbjct  121  TFDQLALERPTGKDCVLLRGPKSHREAVKHFGPAPGVPGSTTKPYVRAKGRKFEKARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>ref|XP_001419602.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97895.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=186

 Score =   291 bits (744),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRT SKFN  +LKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRNKKTNRTAPKSDNVYLKLLVKLYRFLARRTDSKFNDTVLKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS++  F  GKE K+A +VGT+TDDVR ++VPALKVCALRFT+TARARI KAGG+C+
Sbjct  61   PLSLSKVAKFMKGKEGKVAAIVGTVTDDVRLHDVPALKVCALRFTETARARIIKAGGQCM  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL AP G+  VLLRGPKNSREAVKHFG APGVP SH KPYVRAKGRKFE+ARG+R
Sbjct  121  TFDQLALSAPTGEGVVLLRGPKNSREAVKHFG-APGVPGSHAKPYVRAKGRKFEKARGRR  179

Query  608  NS  613
             S
Sbjct  180  AS  181



>gb|AFC88843.1| 60S ribosomal protein L18-3-like protein, partial [Miscanthus 
sinensis]
Length=166

 Score =   290 bits (741),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  122  PKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKI  301
            PKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+ PLS+ RL+ F  GK D+I
Sbjct  1    PKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRAPLSMRRLVKFMEGKGDQI  60

Query  302  AVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLL  481
            AV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLL
Sbjct  61   AVIVGTVTDDKRINEVPAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLL  120

Query  482  RGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNS  613
            RGPKN+REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+RNS
Sbjct  121  RGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNS  164



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score =   290 bits (742),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRL +    K  KIAVLVGT+TDD R   VPA+ V ALRFT+TARARI  AGG+CL
Sbjct  61   PVSLSRLSASMEKKSGKIAVLVGTVTDDPRLATVPAMTVVALRFTRTARARITNAGGKCL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFD+LAL AP G NTVLLRG K++REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDELALLAPTGCNTVLLRGRKSAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score =   290 bits (742),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRL +    K  KIAVLVGT+TDD R   VPA+ V ALRFT+TARARI  AGG+CL
Sbjct  61   PVSLSRLSASMEKKSGKIAVLVGTVTDDPRLAAVPAMTVVALRFTRTARARITNAGGKCL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFD+LAL AP G NTVLLRG K++REAVKHFGPAPGVPHSHTKPYVR+KGRKFE+ARG+R
Sbjct  121  TFDELALLAPTGCNTVLLRGRKSAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRR  180

Query  608  NS  613
            NS
Sbjct  181  NS  182



>gb|KFK32338.1| hypothetical protein AALP_AA6G228700 [Arabis alpina]
Length=197

 Score =   289 bits (740),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK P
Sbjct  14   GIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKAP  73

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
             SLSRL+   SGK+DKIAVLVGTI DDV  +++ A+KV ALRFT+ ARARI KAGG+CLT
Sbjct  74   FSLSRLVELMSGKDDKIAVLVGTIIDDVSVHDILAIKVAALRFTERARARIVKAGGKCLT  133

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            FDQLALRAPLGQNTV LRG KNSREAVKHFGPAPGVPHSH+KPYVR++GRKFE  R K
Sbjct  134  FDQLALRAPLGQNTVFLRGRKNSREAVKHFGPAPGVPHSHSKPYVRSEGRKFETRRRK  191



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score =   287 bits (734),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGG++K+  RTAPKS++ Y+KLLVKLYRFLVRRT S FN V+LKRLFMSKTN+P
Sbjct  1    MGIDLIAGGRNKRVHRTAPKSENPYVKLLVKLYRFLVRRTESDFNKVVLKRLFMSKTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L+ F  GKE K+AVLVGTITDD R +EVP L+VCALR T+TARARI KAGGE +
Sbjct  61   PLSLSKLVKFMEGKEGKLAVLVGTITDDTRLFEVPKLRVCALRVTETARARILKAGGEII  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL AP G NTVLLRGPKNSREAVKHFGPAPGVP S  KPYVRAKGRKFERARG+R
Sbjct  121  TFDQLALIAPTGSNTVLLRGPKNSREAVKHFGPAPGVPGSTAKPYVRAKGRKFERARGRR  180

Query  608  NS  613
             S
Sbjct  181  KS  182



>gb|AAO46881.1| 60S ribosomal protein [Medicago sativa]
Length=164

 Score =   285 bits (730),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTK  556
            TFDQLAL+APLGQNTVLLRGPKN+REAVKHFG APGVPHS TK
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSSTK  163



>sp|O22254.3|RL181_ARATH RecName: Full=Putative 60S ribosomal protein L18-1 [Arabidopsis 
thaliana]
Length=188

 Score =   285 bits (729),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRT PKSDDVYLKLLVK  R+LVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTEPKSDDVYLKLLVKANRYLVRRTESKFNAVILKRLFMSKVNKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRL+ +  GK+ KIAV+VGT+TDDVR  +VPAL V ALRFT++ARARI KAGGECL
Sbjct  61   PLSLSRLVRYMDGKDGKIAVIVGTVTDDVRIEDVPALTVTALRFTESARARIHKAGGECL  120

Query  428  TFDQLALRAP-LGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            TFDQLAL  P   +NTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR  G+K E ARG+
Sbjct  121  TFDQLALPCPTWSENTVLLRGPKNTREAVKHFGPAPGVPHSHTKPYVRQTGKKIEIARGR  180

Query  605  RNS  613
            R S
Sbjct  181  RRS  183



>ref|XP_007510670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18203.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score =   285 bits (729),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GIDL+AGG++K+TKRT+ KS++VYL LLVKLYRFL RRT SKFN  +LKRLFMSKTN+PP
Sbjct  56   GIDLEAGGRNKKTKRTSQKSENVYLALLVKLYRFLARRTDSKFNQTVLKRLFMSKTNRPP  115

Query  251  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  430
            LSLS+L  F  GKE K+A +VGTITDDVR +EVP L VCALRFT TARARI KAGGECLT
Sbjct  116  LSLSKLAKFMKGKEGKVACVVGTITDDVRMFEVPKLTVCALRFTATARARIVKAGGECLT  175

Query  431  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRN  610
            FDQLAL+AP G+  VLLRGPKNSREAVKHFG APGVPHSH KPYV+ KGRKFE+ARG+R 
Sbjct  176  FDQLALKAPTGEGVVLLRGPKNSREAVKHFG-APGVPHSHAKPYVQHKGRKFEKARGRRA  234

Query  611  S  613
            S
Sbjct  235  S  235



>ref|XP_005643635.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19091.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=186

 Score =   279 bits (713),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL+AGG++K+T RTAPKS++VYLKLLVKLY FLVRRT SKFN V+LKRLFMS+TN+P
Sbjct  1    MGIDLEAGGRNKKTWRTAPKSENVYLKLLVKLYTFLVRRTESKFNKVVLKRLFMSRTNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L +F  GKEDK AVL+GTITDDVR +EVP L V ALR T+TARARI  AGG+ L
Sbjct  61   PLSLSKLATFMKGKEDKTAVLIGTITDDVRLFEVPKLTVVALRVTETARARILGAGGKIL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL AP G N VLLRGPKNSREAVKH G APGVPHSH KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALLAPTGSNCVLLRGPKNSREAVKHRG-APGVPHSHAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
             S
Sbjct  180  KS  181



>gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum]
Length=154

 Score =   276 bits (707),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  167  RFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYE  346
            RFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R Y+
Sbjct  1    RFLVRRTGSSFNAVILKRLFMSKVNKPPLSLSRLIRFTKGKEGKIAVVVGTITDDIRVYD  60

Query  347  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  526
            VPA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGP
Sbjct  61   VPAMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGP  120

Query  527  APGVPHSHTKPYVRAKGRKFERARGKRNS  613
            APGVPHSHTKPYVR+KGRKFE+ARG+RNS
Sbjct  121  APGVPHSHTKPYVRSKGRKFEKARGRRNS  149



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score =   276 bits (707),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 155/182 (85%), Gaps = 14/182 (8%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRT P+SDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTTPQSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI++  GKEDK+AV+                 V ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKVAVV--------------VGTVTALRFTETARARIEKAGGECL  106

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGV HSHTKPYVRAKGRKFERARGKR
Sbjct  107  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRAPGVSHSHTKPYVRAKGRKFERARGKR  166

Query  608  NS  613
             S
Sbjct  167  KS  168



>gb|KHG01788.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=160

 Score =   275 bits (702),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 147/173 (85%), Gaps = 13/173 (8%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GK              +  YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGK-------------GLWVYEVPALKVTALRFTETARARIEKAGGECL  107

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  586
            +FDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS  KPYVR+KGRK 
Sbjct  108  SFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSLYKPYVRSKGRKL  160



>gb|KJB26287.1| hypothetical protein B456_004G239000 [Gossypium raimondii]
Length=224

 Score =   273 bits (698),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 156/205 (76%), Gaps = 31/205 (15%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRR GS FNAVILKRLFM K NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRAGSNFNAVILKRLFMRKVNKP  60

Query  248  PLSLSRL--------ISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARI  403
            PLSL  +        +++    EDKI V+VGT+TDD+R YEVPAL V ALRFT+TARARI
Sbjct  61   PLSLYFICGSGFLGSLNYCWFGEDKIGVVVGTVTDDIRVYEVPALTVTALRFTETARARI  120

Query  404  EKAGGECLTFDQLALRAPLGQNT-----------------------VLLRGPKNSREAVK  514
            EKAGGECLTFDQLALRAPLG                          VLLRGPKN+REAVK
Sbjct  121  EKAGGECLTFDQLALRAPLGVEMPVLLPCTIKNVTGMISRKHNVPEVLLRGPKNAREAVK  180

Query  515  HFGPAPGVPHSHTKPYVRAKGRKFE  589
            HFGPAPGVPHSH+KPYVR+KGRKFE
Sbjct  181  HFGPAPGVPHSHSKPYVRSKGRKFE  205



>dbj|BAJ93091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = +2

Query  137  VYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDK-IAVLV  313
            VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+V
Sbjct  48   VYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVV  107

Query  314  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  493
            GTITDD+R  E+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPK
Sbjct  108  GTITDDMRIQEIPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRGPK  167

Query  494  NSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNS  613
            N+REAV+HFG APGVPHSHTKPYVR+KGRKFE+ARG+RNS
Sbjct  168  NAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNS  207



>ref|XP_011396696.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
 gb|KFM23818.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
Length=187

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL+AGG++ +  RTAPKS + Y+KLLVKLYRFLVRRT S FN VILKRLFMSK N+P
Sbjct  1    MGIDLRAGGRNTKVHRTAPKSQNPYVKLLVKLYRFLVRRTESDFNKVILKRLFMSKVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L  FT+G+  KIAVLVGT+TDD+R +EVP ++V ALR T+TARARI  AGGE L
Sbjct  61   PLSLSKLAKFTAGQPGKIAVLVGTVTDDIRLHEVPKIRVAALRVTETARARIVAAGGEVL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFE  589
            T DQLAL AP G NTVLLRGPKNSREAVKHFGPAPGVP S TKPYVR+KGRKFE
Sbjct  121  TLDQLALLAPTGSNTVLLRGPKNSREAVKHFGPAPGVPGSSTKPYVRSKGRKFE  174



>ref|XP_003056676.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58321.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 150/182 (82%), Gaps = 4/182 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL+AGG++K   RTAPKS++VYLKLLVKLYRFL RRT S FN  +LKRLFMSK N+P
Sbjct  1    MGIDLEAGGRNKVKHRTAPKSENVYLKLLVKLYRFLARRTDSDFNKTVLKRLFMSKINRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L  F  G    ++ +VGT+TDD R +EVPA+KVCALRFT+TARARI KAGGEC+
Sbjct  61   PLSLSKLAKFHKGG---VSAIVGTVTDDARMFEVPAMKVCALRFTETARARIIKAGGECM  117

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLAL AP G    LLRGPKNSREAVKHFG APGVP SH KPYVR KGRKFE+ARG+R
Sbjct  118  TFDQLALSAPTGDGVTLLRGPKNSREAVKHFG-APGVPGSHAKPYVRHKGRKFEKARGRR  176

Query  608  NS  613
             S
Sbjct  177  KS  178



>ref|XP_002506220.1| ribosomal protein L18 [Micromonas sp. RCC299]
 gb|ACO67478.1| ribosomal protein L18 [Micromonas sp. RCC299]
Length=386

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +2

Query  65   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            + GID++AGG++K+  RTAPKS++VYLKLLVKLYRFLVRRT SK N  ILKRLFMSK N+
Sbjct  202  SQGIDIEAGGRNKKKSRTAPKSENVYLKLLVKLYRFLVRRTDSKVNETILKRLFMSKINR  261

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PPLSLS+L  F   K  +I+ +VGTITDD R +EVPAL+VCALRFT+TARARI KAGGEC
Sbjct  262  PPLSLSKLAKFA--KPGQISAVVGTITDDARMFEVPALRVCALRFTETARARIVKAGGEC  319

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            +TFDQLAL+AP G+N  LLRGPK+ REAVKHFG APGVP SH KPYVR KGRKFE+ARG+
Sbjct  320  ITFDQLALQAPTGENVCLLRGPKSHREAVKHFG-APGVPGSHAKPYVRHKGRKFEKARGR  378

Query  605  RNS  613
            R S
Sbjct  379  RKS  381



>ref|XP_011255380.1| PREDICTED: 60S ribosomal protein L18 [Camponotus floridanus]
 gb|EFN68908.1| 60S ribosomal protein L18 [Camponotus floridanus]
Length=188

 Score =   258 bits (660),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +IL+RLFMSK N+P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNQIILRRLFMSKINRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F    G+E+ +AV+VG++TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENCVAVIVGSVTDDARIFEIPKLTVCALRVTERARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G+ TVL++GP+ +RE+VKHFGPAPGVPHSH+KPYVR+KGRKFERARG
Sbjct  120  IITFDQLALRAPTGKRTVLMQGPRKARESVKHFGPAPGVPHSHSKPYVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>ref|XP_001745439.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90017.1| predicted protein [Monosiga brevicollis MX1]
Length=185

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 152/182 (84%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID++    +K+ +RTAP+S+D YL+LLVKLYRFL RRT S FN V+L+RLFMS+ N+P
Sbjct  1    MGIDIRHH-HAKKGRRTAPESEDPYLRLLVKLYRFLARRTESSFNKVVLRRLFMSRINRP  59

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLS+L++    +E KIAV+VGT+TDDVR  EVP L VCALR T++AR RI  AGGE +
Sbjct  60   PLSLSKLMTHMKKQESKIAVIVGTVTDDVRVIEVPKLTVCALRVTESARKRILAAGGEIM  119

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALRAP GQNTVLL+GP+ SREAVKHFG APGVPHSH KPYVR+KGRKFE+ARG+R
Sbjct  120  TFDQLALRAPTGQNTVLLQGPRKSREAVKHFG-APGVPHSHVKPYVRSKGRKFEKARGRR  178

Query  608  NS  613
             S
Sbjct  179  AS  180



>ref|XP_011351685.1| PREDICTED: 60S ribosomal protein L18 [Cerapachys biroi]
 gb|EZA61183.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 153/184 (83%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS+DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSEDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSKIHRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F    G+E+ IAV+VGT+TDD R +E+P L VCALR T  ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENCIAVIVGTVTDDARIFEIPKLTVCALRVTTRARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +T DQLALRAP G++TVL++GP+ +RE+VKHFGPAPGVPHSH+KPYVR+KGRKFERARG
Sbjct  120  IITLDQLALRAPTGKHTVLMQGPRKARESVKHFGPAPGVPHSHSKPYVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>ref|XP_968042.1| PREDICTED: 60S ribosomal protein L18 [Tribolium castaneum]
 gb|EFA00786.1| hypothetical protein TcasGA2_TC003672 [Tribolium castaneum]
Length=188

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYR+L RRTGSKFN +ILKRLFMSK NKP
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRYLARRTGSKFNKIILKRLFMSKINKP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++      G+E   AV+VGT+TDD R +EVP L +CALR T TARARI KAGGE
Sbjct  60   PISLARVVRAMKKPGREGLTAVIVGTVTDDARIWEVPKLSICALRVTGTARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G  TVLL+G +N+REAVKHFGPAPGVPHSHTKP+VR KGRKFERARG
Sbjct  120  VITFDQLALRAPTGAKTVLLQGRRNAREAVKHFGPAPGVPHSHTKPFVRTKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>emb|CBK21900.2| Ribosomal protein L18e [Blastocystis hominis]
Length=189

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 2/183 (1%)
 Frame = +2

Query  68   MGIDLKAGGKS-KQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            MGIDL AGG++    KR APKS++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+
Sbjct  3    MGIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINR  62

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC
Sbjct  63   PPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCALRFTETARARILKAGGEC  122

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            +T DQLALRAP G NTVLL+G +++REAV+HFG  PG P S  +PYVR+ GRKFERARG+
Sbjct  123  ITLDQLALRAPTGANTVLLQGHRSAREAVRHFG-TPGTPGSKARPYVRSTGRKFERARGR  181

Query  605  RNS  613
            R S
Sbjct  182  RAS  184



>ref|XP_006677675.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82239.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
Length=186

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MG+DL+     K+  R APKSD+VYL+LLVKLYRFL RRT SKFN V+LKRLFMS+ N+P
Sbjct  1    MGVDLQKKHHQKKGARVAPKSDNVYLRLLVKLYRFLARRTNSKFNQVVLKRLFMSRVNRP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+S+SRL  + SGKE+KIAV+VGT+TDD R  EVP + V ALR T +ARARI KAGGE L
Sbjct  61   PISISRLSKYLSGKENKIAVVVGTVTDDNRLLEVPKISVAALRVTNSARARILKAGGEIL  120

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALR+PLG+ TVLLRGPKNSREAVKHFG  PG P S  KPYVR+KGRKFE+ARG+R
Sbjct  121  TFDQLALRSPLGKGTVLLRGPKNSREAVKHFG-TPGKPGSTAKPYVRSKGRKFEKARGRR  179

Query  608  NS  613
             S
Sbjct  180  AS  181



>ref|XP_003707499.1| PREDICTED: 60S ribosomal protein L18-like [Megachile rotundata]
Length=218

 Score =   257 bits (657),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK ++P
Sbjct  31   MGIDIN-HKHDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNAKFNKIILKRLFMSKIHRP  89

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F    G+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  90   PISLARVVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRITEKARARILKAGGE  149

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G+ TVL++G +N+REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  150  LITFDQLALRAPTGRRTVLMQGRRNAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARG  209

Query  602  KRNS  613
            +R S
Sbjct  210  RRRS  213



>ref|XP_011135288.1| PREDICTED: 60S ribosomal protein L18 [Harpegnathos saltator]
Length=188

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK NKP
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKINKP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++   S   +E+ IAV+VGTITDD R +E+P L VCALR T+ AR RI KAGGE
Sbjct  60   PISLARIVRLMSKSHRENCIAVVVGTITDDARIFEIPKLTVCALRVTEKARGRILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G+ TVLL+GP+ +REA KHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  120  LITFDQLALRAPTGKRTVLLQGPRKAREAQKHFGPAPGVPHSHTKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>ref|XP_006561192.1| PREDICTED: 60S ribosomal protein L18-like [Apis mellifera]
 ref|XP_006622209.1| PREDICTED: 60S ribosomal protein L18-like [Apis dorsata]
Length=188

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 151/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F    G+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRITERARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             ++FDQLALRAP G+ TVL++G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  120  LISFDQLALRAPTGKRTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>ref|XP_003691391.1| PREDICTED: 60S ribosomal protein L18-like [Apis florea]
Length=188

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 151/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F    G+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRVTERARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             ++FDQLALRAP G+ TVL++G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  120  LISFDQLALRAPTGKRTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>emb|CBK22327.2| unnamed protein product [Blastocystis hominis]
Length=194

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = +2

Query  71   GIDLKAGGKS-KQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            GIDL AGG++    KR APKS++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+P
Sbjct  9    GIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINRP  68

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC+
Sbjct  69   PMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCALRFTETARARILKAGGECI  128

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            T DQLALRAP G NTVLL+G +++REAV+HFG  PG P S  +PYVR+ GRKFERARG+R
Sbjct  129  TLDQLALRAPTGANTVLLQGHRSAREAVRHFG-TPGTPGSKARPYVRSTGRKFERARGRR  187

Query  608  NS  613
             S
Sbjct  188  AS  189



>ref|XP_011497333.1| PREDICTED: 60S ribosomal protein L18 [Ceratosolen solmsi marchali]
Length=188

 Score =   253 bits (647),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTRSKFNRIILKRLFMSRIHRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R+  F    G+ED IAV+VGT+TDD R +EVP L +CALR T+ AR RI KAGGE
Sbjct  60   PISLARITRFMKKPGREDCIAVIVGTVTDDARIFEVPKLTICALRVTEKARGRILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALR+P G+ TVL++GP+ +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  120  IITFDQLALRSPTGRKTVLIQGPRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>gb|KDR14978.1| 60S ribosomal protein L18 [Zootermopsis nevadensis]
Length=188

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK N+P
Sbjct  1    MGIDINHKW-DRKVRRTEPKSQDVYLRLLVKLYRFLTRRTKSKFNKIILKRLFMSKINRP  59

Query  248  PLSLSRLISFTSGKE--DKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++      E  + IAV+VGTITDD R +EVP L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARVVHLMKDPERANLIAVIVGTITDDQRIFEVPKLTVCALRVTERARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G+ TVL++G +N+REAVKHFG APGVPHSHTKPYVR+KGRKFERARG
Sbjct  120  IITFDQLALRAPTGKKTVLIQGRRNAREAVKHFGLAPGVPHSHTKPYVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>gb|EFN87206.1| 60S ribosomal protein L18 [Harpegnathos saltator]
Length=187

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 148/183 (81%), Gaps = 3/183 (2%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK NKPP
Sbjct  1    GIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKINKPP  59

Query  251  LSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            +SL+R++   S   +E+ IAV+VGTITDD R +E+P L VCALR T+ AR RI KAGGE 
Sbjct  60   ISLARIVRLMSKSHRENCIAVVVGTITDDARIFEIPKLTVCALRVTEKARGRILKAGGEL  119

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            +TFDQLALRAP G+ TVLL+GP+ +REA KHFGPAPGVPHSHTKP VR+KGRKFERARG+
Sbjct  120  ITFDQLALRAPTGKRTVLLQGPRKAREAQKHFGPAPGVPHSHTKPLVRSKGRKFERARGR  179

Query  605  RNS  613
            R S
Sbjct  180  RRS  182



>ref|XP_011062886.1| PREDICTED: 60S ribosomal protein L18 [Acromyrmex echinatior]
 gb|EGI60312.1| 60S ribosomal protein L18 [Acromyrmex echinatior]
Length=232

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  45   MGIDIN-HKHDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRP  103

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F     +E+ +AV+VGTITDD R +EVP L VCALR T+ ARARI K GGE
Sbjct  104  PISLARIVRFMKKPNRENCVAVIVGTITDDARIFEVPKLTVCALRVTEKARARILKNGGE  163

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALR+P G  TVL++GP+N+RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG
Sbjct  164  IITFDQLALRSPTGSRTVLMQGPRNARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARG  223

Query  602  KRNS  613
            +R S
Sbjct  224  RRRS  227



>gb|AAX48850.1| L18 [Suberites domuncula]
Length=187

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+  G K ++  R  PKSDD YL+L+VKLYRFL RRT + FN V+LKRL+MSKTN+P
Sbjct  1    MGIDV--GHKQRKVVRKDPKSDDPYLRLIVKLYRFLARRTDAPFNKVVLKRLYMSKTNRP  58

Query  248  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            PLS++R++     + +  KIAV+VGT+T+DVR +++P + +CAL+FT+ ARAR+ KAGGE
Sbjct  59   PLSIARIVRQMKPADRTTKIAVVVGTVTNDVRIFDIPKMTICALKFTEAARARVLKAGGE  118

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             LTFDQLALRAP GQNT++L+GP+ +REAV+HFG APGVPHSH+KPYVR+KGRKFERARG
Sbjct  119  VLTFDQLALRAPKGQNTIILQGPRRAREAVRHFGRAPGVPHSHSKPYVRSKGRKFERARG  178

Query  602  KRNS  613
            +RNS
Sbjct  179  RRNS  182



>gb|KJB41868.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=178

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTV  475
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>ref|XP_011351645.1| PREDICTED: 60S ribosomal protein L18-like [Cerapachys biroi]
 gb|EZA61166.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK + P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSKIHLP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F    G+E+ IAV+VGT+TDD R +E+P L +CALR T+ AR RI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENCIAVIVGTVTDDSRIFEIPKLTICALRVTEKARGRILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G+ TVL++GP+ +RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG
Sbjct  120  IITFDQLALRAPTGKRTVLMQGPRKARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>gb|KJB45331.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=195

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTV  475
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>emb|CAJ17294.1| ribosomal protein L18e [Hister sp. APV-2005]
Length=188

 Score =   251 bits (641),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT P+S DVYL+LLVKLYR+L RRT SKFN +IL+RLFMS+ N+ 
Sbjct  1    MGIDINHK-HDRKVRRTEPRSQDVYLRLLVKLYRYLARRTNSKFNKIILRRLFMSRINRA  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F    G+E  +AV+VGT+TDD R +EVP L VCALR T+ ARARI KAGGE
Sbjct  60   PMSLARIVRFMKKPGREGLMAVVVGTVTDDQRIWEVPKLTVCALRITEKARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             LTFDQLALRAP G  TVL++G + +REAVKHFGPAPGVPHSHTKP+VR+KGRKFERARG
Sbjct  120  ILTFDQLALRAPTGNKTVLMQGKRTAREAVKHFGPAPGVPHSHTKPFVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>ref|XP_005787945.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
 gb|EOD35516.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
Length=190

 Score =   251 bits (640),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 154/186 (83%), Gaps = 5/186 (3%)
 Frame = +2

Query  68   MGIDLKAGGK--SKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTN  241
            MGID+KAGG+  +K++ RTAP S+++YL+L+VKLYRFL RRT +KFN V+LKRLF SKTN
Sbjct  1    MGIDIKAGGRKATKKSGRTAPVSENLYLRLIVKLYRFLARRTDAKFNKVVLKRLFTSKTN  60

Query  242  KPPLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAG  415
            +PP+S+  +  F +  G E KIAV+VG++TDDVR  +VP L VCALRFT TARARI KAG
Sbjct  61   RPPMSIKSIAKFMAREGNEGKIAVVVGSVTDDVRFLDVPKLTVCALRFTATARARIVKAG  120

Query  416  GECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERA  595
            GECLT DQLAL++PLG+ TVLLRG K+ RE+ KHFG APGVPHS  KPYVR+KGRKFE+A
Sbjct  121  GECLTLDQLALKSPLGEGTVLLRGCKSRRESAKHFG-APGVPHSSVKPYVRSKGRKFEKA  179

Query  596  RGKRNS  613
            RG+R S
Sbjct  180  RGRRAS  185



>ref|XP_008201914.1| PREDICTED: 60S ribosomal protein L18 [Nasonia vitripennis]
Length=188

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R+  F    G+E+ IAV+VGT+TDD R +EVP L VCALR T+ AR RI KAGGE
Sbjct  60   PISLARVTRFMKKPGRENCIAVIVGTVTDDARIFEVPKLTVCALRVTEKARGRILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLAL++P G+ TVL++GP+  REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  120  IITFDQLALKSPTGRKTVLIQGPRKGREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>gb|KJB23304.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=159

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARI+KAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIDKAGGECL  120

Query  428  TFDQLALRAPLGQNTV  475
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>gb|ABR23470.1| 60s ribosomal protein L18 [Ornithodoros parkeri]
Length=188

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+ +    ++  R  PKS +VYL LLVK+YRFL RRT +KFN VILKRLFMS+ N+P
Sbjct  1    MGIDI-SHKHDRKVARKRPKSKNVYLGLLVKVYRFLARRTDAKFNRVILKRLFMSRINRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P++LS+++ F    G+E+KIAV+VGTITDDVR YEVP L+VCAL  T  ARARI KAGGE
Sbjct  60   PMALSKVVRFMKKPGRENKIAVVVGTITDDVRLYEVPKLRVCALHVTDRARARIHKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             + FD+LA+++P GQNTVL++G + +REA +HFGPAPGVPHSHTKPYVR+KGRKFERARG
Sbjct  120  IMNFDELAVKSPRGQNTVLIQGRRTAREACRHFGPAPGVPHSHTKPYVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRKS  183



>ref|XP_008546759.1| PREDICTED: 60S ribosomal protein L18 [Microplitis demolitor]
Length=188

 Score =   249 bits (636),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT P S D+YL+LLVKLYRFL RRTGSKFN +ILKRLFMS+ NKP
Sbjct  1    MGIDINHK-HDRKVRRTEPASQDIYLRLLVKLYRFLARRTGSKFNKIILKRLFMSRINKP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F     +E+ IAV+VGT+TDD R +E P L VCALR T  AR RI KAGGE
Sbjct  60   PISLARVVRFMKKPHRENCIAVIVGTVTDDARIFECPKLTVCALRVTDKARGRILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFD+LALR+P G  TVL++G +N+REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  120  VITFDELALRSPTGSKTVLMQGRRNAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>emb|CBJ25909.1| cytoplasmic ribosomal protein L18 [Ectocarpus siliculosus]
Length=192

 Score =   249 bits (635),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 147/187 (79%), Gaps = 5/187 (3%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  244
            MGIDL AGG+    K RT+PKSD+VYL LLVKL+RFL RRT S F  V+LKRL+MSKTN+
Sbjct  1    MGIDLVAGGRRVGHKVRTSPKSDNVYLGLLVKLFRFLARRTDSAFANVVLKRLYMSKTNR  60

Query  245  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
             PLSLSRL  +   KE   AVLVGT+TDDVR  EVP L VCALRFT+TARARI  AGGEC
Sbjct  61   APLSLSRLARYMRNKETSTAVLVGTVTDDVRLLEVPKLSVCALRFTETARARILAAGGEC  120

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHT----KPYVRAKGRKFER  592
            +TFDQLALRAP G NTVLLRGPKN+REAV+HFG    V + HT    KPY+R+KGRKFE+
Sbjct  121  ITFDQLALRAPKGTNTVLLRGPKNAREAVRHFGHRTTVNNLHTHDSVKPYIRSKGRKFEK  180

Query  593  ARGKRNS  613
            ARG+R S
Sbjct  181  ARGRRRS  187



>ref|XP_004991895.1| ribosomal protein l18 [Salpingoeca rosetta]
 gb|EGD75438.1| ribosomal protein l18 [Salpingoeca rosetta]
Length=186

 Score =   248 bits (634),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MG D+      ++ +RTAP S+D YL+LLV+LYRFLVRRT S FN V+LKR+FMSK ++P
Sbjct  1    MGKDI-CHKHDRKRRRTAPVSEDPYLRLLVQLYRFLVRRTNSSFNKVVLKRMFMSKIHRP  59

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            P+SLSR++    G+E  IAV+VGT+TDD R  E+P L VCALRF++TAR RI  AGGECL
Sbjct  60   PMSLSRIVQNMKGREQLIAVIVGTVTDDPRMLELPKLTVCALRFSETARKRILAAGGECL  119

Query  428  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKR  607
            TFDQLALR+P GQNTVL++GP+ +REAVKHFG APG+P SH +PYVRAKGRKFE+ARG+R
Sbjct  120  TFDQLALRSPKGQNTVLMQGPRKAREAVKHFGRAPGLPGSHARPYVRAKGRKFEKARGRR  179

Query  608  NS  613
             S
Sbjct  180  TS  181



>ref|XP_011313252.1| PREDICTED: 60S ribosomal protein L18 [Fopius arisanus]
Length=188

 Score =   248 bits (633),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNAKFNKIILKRLFMSKIHRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SL+R++ F     +E+ IAV+VGT+TDD R +E+P L VCALR T+ AR RI KAGGE
Sbjct  60   PISLARVVRFMKKPTRENCIAVVVGTVTDDARIFEIPKLTVCALRVTEKARGRILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G  TVL++G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG
Sbjct  120  IITFDQLALRAPTGNKTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>ref|XP_011163555.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L18 [Solenopsis 
invicta]
Length=247

 Score =   250 bits (639),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++P
Sbjct  60   MGIDIN-HKHDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRP  118

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+S++R++ F    G+E+ +AV+VG++TDD R +++P L VCALR T+ ARARI KAGGE
Sbjct  119  PISVARIVRFMKKPGRENCVAVIVGSVTDDARIFQIPKLTVCALRVTEKARARILKAGGE  178

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALRAP G+ T+L++G +N+RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG
Sbjct  179  IITFDQLALRAPTGKKTILMQGRRNARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARG  238

Query  602  KRNS  613
            +R S
Sbjct  239  RRRS  242



>ref|XP_001640445.1| predicted protein [Nematostella vectensis]
 gb|EDO48382.1| predicted protein [Nematostella vectensis]
Length=188

 Score =   248 bits (633),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 151/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID++     K  +R  P S +VY++LLVKLYRFL RRT +KFN +++KRL MS+T +P
Sbjct  1    MGIDIEKKHPKKNYRRE-PVSQNVYIRLLVKLYRFLSRRTNAKFNQIVMKRLCMSRTKRP  59

Query  248  PLSLSRLISF--TSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            PLSL+RL+     SG +DKI V+VG+ITDD R +EVPALK+CALRF++TARARI KAGGE
Sbjct  60   PLSLARLVRKMKASGHKDKICVVVGSITDDKRIFEVPALKICALRFSETARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             LTFDQLALRAPLGQNTVLL+GP+ +REA +H G APGVPHS TKP+VR+KGRKFERARG
Sbjct  120  ILTFDQLALRAPLGQNTVLLQGPRKAREAERHMGLAPGVPHSDTKPFVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRKS  183



>ref|XP_002400316.1| ribosomal protein L18, putative [Ixodes scapularis]
 gb|EEC15787.1| ribosomal protein L18, putative [Ixodes scapularis]
Length=188

 Score =   248 bits (633),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      K  +R  PKS++VYL LLVK+YRFL RR+G+KFN ++LKRLFMS+ NKP
Sbjct  1    MGIDINHKYDRKVVRRR-PKSENVYLGLLVKVYRFLARRSGAKFNRIVLKRLFMSRINKP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
             +SL+R+  F    G+E+ IAV+VGT+TDD+R Y+VP L++CALR T+ ARARI KAGGE
Sbjct  60   VISLARVTRFMKKPGRENLIAVVVGTVTDDLRLYDVPKLRLCALRVTERARARILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             LTFDQLA++AP G+ TVL++GP+NSREA +HFGPAPGVPHSHTKPYVR+KGRKFERARG
Sbjct  120  ILTFDQLAVQAPKGKGTVLMQGPRNSREACRHFGPAPGVPHSHTKPYVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRKS  183



>gb|EFZ15690.1| hypothetical protein SINV_04174 [Solenopsis invicta]
Length=187

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++PP
Sbjct  1    GIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRPP  59

Query  251  LSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            +S++R++ F    G+E+ +AV+VG++TDD R +++P L VCALR T+ ARARI KAGGE 
Sbjct  60   ISVARIVRFMKKPGRENCVAVIVGSVTDDARIFQIPKLTVCALRVTEKARARILKAGGEI  119

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            +TFDQLALRAP G+ T+L++G +N+RE+VKHFG APGVPHSHTKPYVR+KGRKFERARG+
Sbjct  120  ITFDQLALRAPTGKKTILMQGRRNARESVKHFGLAPGVPHSHTKPYVRSKGRKFERARGR  179

Query  605  RNS  613
            R S
Sbjct  180  RRS  182



>sp|Q4GXG7.1|RL18_TIMBA RecName: Full=60S ribosomal protein L18 [Timarcha balearica]
 emb|CAJ17295.1| ribosomal protein L18e [Timarcha balearica]
Length=188

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++ +RT PKS DVYL+LLVKLYR+L RRTG+KFN +ILKRLFMSK  +P
Sbjct  1    MGIDINHK-YDRKVRRTEPKSQDVYLRLLVKLYRYLARRTGAKFNKIILKRLFMSKIYRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            P+SLS+++ F    G+E   AV+VGT+TDD R +E+P L +CALR T+TARA I KAGGE
Sbjct  60   PISLSKVVRFMKKPGRELLTAVIVGTVTDDSRIFEIPKLSICALRVTQTARAGILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLALR+P G  TVLL+G +N+REAVKHFGPAPGVPHSH KP VR+KGRKFERARG
Sbjct  120  VITFDQLALRSPTGSKTVLLQGKRNAREAVKHFGPAPGVPHSHAKPLVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRRS  183



>gb|ABW90395.1| putative ribosomal protein L18 [Barentsia elongata]
Length=188

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGID+      ++T RTAPKSDDVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK N+P
Sbjct  1    MGIDINHK-HDRKTGRTAPKSDDVYLRLLVKLYRFLARRTDAKFNKIILKRLFMSKINRP  59

Query  248  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  421
            PLSL+R++  T   G++ K+ V VGT+TDD+R  +VP LK+CAL  T  AR RI KAGGE
Sbjct  60   PLSLARILRQTKKPGRDGKLVVCVGTVTDDLRILDVPKLKICALHVTSGARTRILKAGGE  119

Query  422  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARG  601
             +TFDQLAL+AP G+NT+L++GP+ +REA +HFG APGVPHSHTKP+VR+KGRKFERARG
Sbjct  120  IITFDQLALQAPKGKNTLLIQGPRKAREACRHFGRAPGVPHSHTKPFVRSKGRKFERARG  179

Query  602  KRNS  613
            +R S
Sbjct  180  RRKS  183



>ref|XP_003393579.1| PREDICTED: hypothetical protein LOC100643724 [Bombus terrestris]
Length=409

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN ++LKRLFMSK ++PP
Sbjct  223  GIDIN-HKHDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIVLKRLFMSKIHRPP  281

Query  251  LSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            +SL+R++ F    G+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE 
Sbjct  282  ISLARIVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRVTERARARILKAGGEL  341

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            +TFDQLALR P+G+ TVL++G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+
Sbjct  342  ITFDQLALRTPIGERTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGR  401

Query  605  RNS  613
            R S
Sbjct  402  RRS  404



>ref|XP_003485273.1| PREDICTED: hypothetical protein LOC100746406 [Bombus impatiens]
Length=400

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = +2

Query  71   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  250
            GID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN ++LKRLFMSK ++PP
Sbjct  214  GIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIVLKRLFMSKIHRPP  272

Query  251  LSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  424
            +SL+R++ F    G+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE 
Sbjct  273  ISLARVVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRVTERARARILKAGGEL  332

Query  425  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGK  604
            +TFDQLALR P+G+ TVL++G + +REAVKHFGPAPGVPHSHTKP VR+KGRKFERARG+
Sbjct  333  ITFDQLALRTPIGERTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRSKGRKFERARGR  392

Query  605  RNS  613
            R S
Sbjct  393  RRS  395



>ref|XP_010559184.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=145

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI +  GK+DKI V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTVLLRGP  490
            TFDQLALRAPLGQNTV +  P
Sbjct  121  TFDQLALRAPLGQNTVYIFLP  141



>ref|XP_006433452.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|ESR46692.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|KDO39193.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=171

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +2

Query  68   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  247
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  248  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  427
            PLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEVPALKVTALRFTETARARIEKAGGECL  120

Query  428  TFDQLALRAPLGQNTV  475
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>ref|XP_003081305.1| ribosomal protein L18 (ISS) [Ostreococcus tauri]
Length=181

 Score =   246 bits (627),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +2

Query  155  VKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDV  334
             +LYRFL RRTGSKFN  +LKRLFMSKTN+PPLSLS+L  F  GKE K+A +VGTITDDV
Sbjct  25   TQLYRFLARRTGSKFNETVLKRLFMSKTNRPPLSLSKLAKFMKGKEGKVAAVVGTITDDV  84

Query  335  RAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVK  514
            R ++VP LKVCALRFT+TARARI KAGGEC+TFDQLAL AP G+  VLLRGPKNSREAVK
Sbjct  85   RMFDVPKLKVCALRFTETARARIIKAGGECMTFDQLALAAPTGEGVVLLRGPKNSREAVK  144

Query  515  HFGPAPGVPHSHTKPYVRAKGRKFERARGKRNS  613
            HFG APG+P SH KPYVR+KGRKFE+ARG+RNS
Sbjct  145  HFG-APGIPGSHAKPYVRSKGRKFEKARGRRNS  176



>emb|CBK22442.2| unnamed protein product [Blastocystis hominis]
Length=186

 Score =   245 bits (626),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  KRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGK  289
            KR APKS++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+PP+SLSRL+    GK
Sbjct  15   KRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINRPPMSLSRLMKHMQGK  74

Query  290  EDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQN  469
            EDKIAV+VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC+T DQLALRAP G N
Sbjct  75   EDKIAVIVGTVTDDIRVIEVPALKVCALRFTETARARILKAGGECITLDQLALRAPTGAN  134

Query  470  TVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNS  613
            TVLL+G +++REAV+HFG  PG P S  +PYVR+ GRKFERARG+R S
Sbjct  135  TVLLQGHRSAREAVRHFG-TPGTPGSKARPYVRSTGRKFERARGRRAS  181



>gb|KJB82633.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=134

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  227  MSKTNKPPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIE  406
            MSK NKPPLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIE
Sbjct  1    MSKVNKPPLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIE  60

Query  407  KAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRAKGRKF  586
            KAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR++GRKF
Sbjct  61   KAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSRGRKF  120

Query  587  ERARGKRNS  613
            ERARG+RNS
Sbjct  121  ERARGRRNS  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660