BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN017O16

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011003162.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    230   6e-73   Populus euphratica
gb|AAZ83341.1|  ubiquitin extension protein                             228   7e-73   Gossypium hirsutum [American cotton]
ref|XP_006488031.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    228   8e-73   Citrus sinensis [apfelsine]
gb|KJB06862.1|  hypothetical protein B456_001G146500                    229   1e-72   Gossypium raimondii
ref|XP_006424488.1|  hypothetical protein CICLE_v10029476mg             227   2e-72   Citrus clementina [clementine]
gb|KJB49764.1|  hypothetical protein B456_008G136200                    229   2e-72   Gossypium raimondii
ref|XP_002279878.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    227   3e-72   Vitis vinifera
ref|XP_008389677.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    227   3e-72   Malus domestica [apple tree]
ref|NP_001275598.1|  ubiquitin-40S ribosomal protein S27a-like          227   3e-72   Solanum tuberosum [potatoes]
ref|XP_007157375.1|  hypothetical protein PHAVU_002G065000g             227   3e-72   Phaseolus vulgaris [French bean]
ref|XP_006374591.1|  ubiquitin/ribosomal protein 27a                    226   4e-72   Populus trichocarpa [western balsam poplar]
gb|ABN72579.1|  ubiquitin extension protein                             226   4e-72   Hevea brasiliensis [jebe]
ref|XP_003613203.1|  Ubiquitin                                          226   5e-72   Medicago truncatula
gb|ACJ83917.1|  unknown                                                 226   5e-72   Medicago truncatula
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    229   5e-72   
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    229   6e-72   Eucalyptus grandis [rose gum]
gb|AFK49579.1|  unknown                                                 226   6e-72   Lotus japonicus
ref|XP_003629895.1|  Ubiquitin                                          229   6e-72   
ref|XP_008358198.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    226   6e-72   
ref|XP_011040332.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    226   7e-72   Populus euphratica
ref|XP_003634320.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    226   7e-72   Vitis vinifera
ref|XP_004504241.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    226   8e-72   
gb|AAZ53360.1|  ubiquitin extension protein                             226   8e-72   Nicotiana tabacum [American tobacco]
ref|XP_004288657.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    226   8e-72   Fragaria vesca subsp. vesca
ref|XP_004489824.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    225   9e-72   Cicer arietinum [garbanzo]
ref|XP_002270170.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    225   1e-71   Vitis vinifera
ref|XP_002525394.1|  ubiquitin, putative                                225   1e-71   Ricinus communis
gb|ABK42077.1|  ubiquitin extension protein                             226   1e-71   Capsicum annuum
gb|ABI84265.1|  ubiquitin/ribosomal protein S27a                        225   1e-71   Arachis hypogaea [goober]
ref|XP_006492389.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    225   1e-71   
gb|AIX10775.1|  ubiquitin                                               225   1e-71   Panax notoginseng [san-qi]
ref|XP_008781194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    225   1e-71   Phoenix dactylifera
gb|KDP26615.1|  hypothetical protein JCGZ_17773                         225   1e-71   Jatropha curcas
ref|XP_011082406.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    225   1e-71   Sesamum indicum [beniseed]
ref|NP_001269170.1|  ubiquitin-40S ribosomal protein S27a-like          225   1e-71   Cucumis sativus [cucumbers]
ref|XP_002320950.1|  ubiquitin/ribosomal protein 27a                    225   1e-71   Populus trichocarpa [western balsam poplar]
gb|KGN51791.1|  hypothetical protein Csa_5G600925                       226   2e-71   Cucumis sativus [cucumbers]
ref|XP_010040181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    224   2e-71   Eucalyptus grandis [rose gum]
ref|XP_004142977.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    224   2e-71   Cucumis sativus [cucumbers]
gb|ADF36485.1|  ubiquitin extension protein                             224   2e-71   Ageratina adenophora
ref|XP_008793306.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    224   2e-71   Phoenix dactylifera
emb|CAN80663.1|  hypothetical protein VITISV_036195                     224   2e-71   Vitis vinifera
gb|ACJ84122.1|  unknown                                                 224   3e-71   Medicago truncatula
gb|AAL66206.1|AF386524_1  ubiquitin extension protein                   224   3e-71   Pyrus communis
sp|P62980.2|RS27A_SOLLC  RecName: Full=Ubiquitin-40S ribosomal pr...    224   4e-71   Solanum lycopersicum
gb|AFK43562.1|  unknown                                                 224   5e-71   Medicago truncatula
ref|XP_001774978.1|  predicted protein                                  224   5e-71   
ref|XP_010941490.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    223   6e-71   Elaeis guineensis
ref|XP_011079491.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    223   6e-71   Sesamum indicum [beniseed]
gb|AHA83529.1|  ubiquitin extension protein                             223   7e-71   Hevea brasiliensis [jebe]
ref|XP_003535084.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    223   8e-71   Glycine max [soybeans]
ref|XP_010248517.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    223   8e-71   Nelumbo nucifera [Indian lotus]
emb|CAA80334.1|  ubiquitin extension protein                            223   9e-71   Lupinus albus
ref|NP_001238181.1|  uncharacterized protein LOC100527579               223   9e-71   Glycine max [soybeans]
ref|XP_010270924.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    223   9e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008776477.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    223   1e-70   Phoenix dactylifera
ref|XP_004229050.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    223   2e-70   
gb|AAO38879.1|  ubiquitin/ribosomal fusion protein                      222   2e-70   Malus domestica [apple tree]
gb|AAG13985.1|AF298826_1  ubiquitin/ribosomal protein 27a               222   2e-70   Prunus avium [gean]
gb|EYU38434.1|  hypothetical protein MIMGU_mgv1a015486mg                222   3e-70   Erythranthe guttata [common monkey flower]
gb|AER12038.1|  ubiquitin extension protein                             221   3e-70   Paeonia suffruticosa [moutan peony]
ref|XP_010270921.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    222   3e-70   Nelumbo nucifera [Indian lotus]
sp|P47905.2|RS27A_LUPAL  RecName: Full=Ubiquitin-40S ribosomal pr...    221   4e-70   Lupinus albus
ref|NP_001238483.1|  uncharacterized protein LOC100527854               221   4e-70   
ref|XP_006402395.1|  hypothetical protein EUTSA_v10006290mg             221   4e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010506742.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    221   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006397903.1|  hypothetical protein EUTSA_v10001668mg             221   5e-70   Eutrema salsugineum [saltwater cress]
ref|XP_001762629.1|  predicted protein                                  221   5e-70   
gb|ABR16172.1|  unknown                                                 221   6e-70   Picea sitchensis
ref|NP_566095.1|  ubiquitin-40S ribosomal protein S27a-2                221   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104378.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    221   7e-70   Brassica rapa
ref|XP_010507927.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    221   7e-70   Camelina sativa [gold-of-pleasure]
gb|EPS73110.1|  hypothetical protein M569_01646                         221   8e-70   Genlisea aurea
ref|XP_010413295.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    221   8e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009133797.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    221   8e-70   Brassica rapa
gb|AFX96040.1|  ubiquitin extension protein                             221   8e-70   Grimmia pilifera
ref|XP_010675161.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    221   9e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001754264.1|  predicted protein                                  221   9e-70   
ref|NP_191784.1|  ubiquitin-40S ribosomal protein S27a-3                221   9e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABH08969.1|  ubiquitin extension protein                             220   1e-69   Morus bombycis
gb|EYU46866.1|  hypothetical protein MIMGU_mgv1a015483mg                220   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_002876668.1|  hypothetical protein ARALYDRAFT_486730             220   1e-69   
ref|XP_006832935.1|  hypothetical protein AMTR_s00095p00146440          220   2e-69   Amborella trichopoda
ref|XP_010251196.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    219   2e-69   Nelumbo nucifera [Indian lotus]
gb|KFK35409.1|  hypothetical protein AALP_AA5G280900                    219   4e-69   Arabis alpina [alpine rockcress]
ref|XP_009416508.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    218   8e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009772672.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    218   1e-68   Nicotiana sylvestris
ref|XP_009116899.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    217   2e-68   Brassica rapa
ref|XP_009414918.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    217   2e-68   
gb|AIH15195.1|  ubiquitin-40S ribosomal protein S27a-like protein       216   3e-68   Hedychium coronarium
ref|XP_009383724.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    216   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846976.1|  hypothetical protein AMTR_s00017p00094950          215   1e-67   Amborella trichopoda
ref|NP_001275323.1|  putative ubiquitin extension protein               215   1e-67   Solanum tuberosum [potatoes]
ref|XP_003568865.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    215   2e-67   Brachypodium distachyon [annual false brome]
ref|NP_001042915.1|  Os01g0328400                                       214   2e-67   
ref|XP_004968668.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    214   2e-67   Setaria italica
ref|XP_003567648.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    214   2e-67   Brachypodium distachyon [annual false brome]
gb|AEE98366.1|  ubiquitin                                               214   4e-67   Deschampsia antarctica
sp|P0CG86.1|RS271_HORVU  RecName: Full=Ubiquitin-40S ribosomal pr...    213   6e-67   Hordeum vulgare [barley]
ref|XP_004977103.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    213   6e-67   Setaria italica
gb|AFI60245.1|  ubiquitin                                               213   6e-67   Panicum virgatum
gb|ABR29645.1|  ubiquitin                                               213   7e-67   Lolium perenne [perennial ryegrass]
gb|ACA24140.1|  ubiquitin                                               213   7e-67   Lolium temulentum
ref|XP_002457768.1|  hypothetical protein SORBIDRAFT_03g013260          213   8e-67   Sorghum bicolor [broomcorn]
ref|XP_009385375.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    213   9e-67   
gb|AEO11783.1|  ubiquitin                                               212   1e-66   Lolium perenne [perennial ryegrass]
ref|XP_010544941.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    212   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_006306408.1|  hypothetical protein CARUB_v10012327mg             211   3e-66   Capsella rubella
ref|NP_001131602.1|  ubiquitin                                          211   3e-66   Zea mays [maize]
ref|XP_010519353.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    211   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_006654079.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    211   5e-66   Oryza brachyantha
ref|NP_001054720.2|  Os05g0160200                                       211   5e-66   
ref|XP_010914703.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    213   6e-66   
ref|XP_010914705.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    212   7e-66   Elaeis guineensis
ref|XP_010914702.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    213   7e-66   Elaeis guineensis
ref|XP_008649366.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    210   8e-66   Zea mays [maize]
ref|XP_009103181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    210   1e-65   Brassica rapa
gb|AFX60090.1|  ribosomal protein S27a                                  210   1e-65   Brassica oleracea
ref|XP_010914704.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    211   1e-65   Elaeis guineensis
ref|XP_002890580.1|  hypothetical protein ARALYDRAFT_472603             210   1e-65   
ref|NP_173755.1|  40S ribosomal protein S27a-1                          209   2e-65   Arabidopsis thaliana [mouse-ear cress]
gb|ACG31121.1|  40S ribosomal protein S27a                              209   3e-65   Zea mays [maize]
gb|AAA70104.1|  ubiquitin fusion protein                                209   3e-65   Zea mays [maize]
ref|XP_006416085.1|  hypothetical protein EUTSA_v10008988mg             209   4e-65   Eutrema salsugineum [saltwater cress]
ref|NP_001150700.1|  40S ribosomal protein S27a                         209   4e-65   Zea mays [maize]
ref|XP_010914701.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    211   4e-65   
gb|KHN22999.1|  Ubiquitin-40S ribosomal protein S27a                    208   4e-65   Glycine soja [wild soybean]
gb|ADE58112.1|  ubiquitin/ribosomal fusion protein                      208   5e-65   Citrus trifoliata [hardy orange]
ref|XP_010498849.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    208   5e-65   Camelina sativa [gold-of-pleasure]
emb|CDY04715.1|  BnaC05g18740D                                          208   7e-65   
gb|AAW56553.1|  ubiquitin/s27a 40s ribosomal protein                    208   7e-65   Nicotiana benthamiana
gb|ADU04750.1|  ubiquitin extension protein                             207   1e-64   Mesostigma viride
ref|XP_010460127.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    207   2e-64   Camelina sativa [gold-of-pleasure]
ref|NP_001105472.1|  ubiquitin-40S ribosomal protein S27a               207   2e-64   
ref|XP_010477636.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    207   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_008347677.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    209   2e-64   
gb|KFK44432.1|  hypothetical protein AALP_AA1G255700                    206   4e-64   Arabis alpina [alpine rockcress]
ref|XP_006349858.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    206   7e-64   Solanum tuberosum [potatoes]
ref|XP_007051235.1|  Ribosomal protein S27a / Ubiquitin family pr...    204   5e-63   
ref|XP_007514688.1|  predicted protein                                  204   6e-63   Bathycoccus prasinos
gb|KCW58175.1|  hypothetical protein EUGRSUZ_H00892                     202   6e-63   Eucalyptus grandis [rose gum]
ref|XP_010552656.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    203   8e-63   Tarenaya hassleriana [spider flower]
gb|AGC65581.1|  UBQ5                                                    202   1e-62   Agrostis stolonifera [creeping bent grass]
gb|KGL79724.1|  Ubiquitin-40S ribosomal protein S27a                    201   3e-62   Tinamus guttatus
gb|KDO86852.1|  hypothetical protein CISIN_1g031604mg                   201   3e-62   Citrus sinensis [apfelsine]
ref|XP_010216499.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    201   3e-62   Tinamus guttatus
ref|XP_004644620.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    201   3e-62   
gb|KFV78322.1|  Ubiquitin-40S ribosomal protein S27a                    200   5e-62   Struthio camelus australis
gb|EHH55578.1|  hypothetical protein EGM_04813                          201   5e-62   Macaca fascicularis [crab eating macaque]
ref|XP_003216177.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    200   9e-62   Anolis carolinensis [Carolina anole]
ref|XP_009667383.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    201   1e-61   Struthio camelus australis
ref|XP_005486911.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    201   1e-61   
ref|XP_009945702.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   1e-61   Leptosomus discolor
gb|KFP24383.1|  Ubiquitin-40S ribosomal protein S27a                    199   2e-61   Colius striatus
ref|XP_009286758.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-61   Aptenodytes forsteri
ref|XP_005513215.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-61   Columba livia [carrier pigeon]
gb|KFV68543.1|  Ubiquitin-40S ribosomal protein S27a                    199   2e-61   Picoides pubescens
ref|XP_010146975.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    199   2e-61   Eurypyga helias
ref|NP_990284.1|  ubiquitin-40S ribosomal protein S27a                  199   2e-61   
ref|XP_010283844.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    199   2e-61   Phaethon lepturus
ref|XP_005238671.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-61   
emb|CCA70746.1|  probable ubiquitin/ribosomal protein S27a fusion...    199   2e-61   Serendipita indica DSM 11827
ref|XP_006122235.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-61   
gb|KFP00438.1|  Ubiquitin-40S ribosomal protein S27a                    199   2e-61   Calypte anna
ref|XP_010194368.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-61   Colius striatus
gb|EMC80037.1|  40S ribosomal protein S27a                              199   2e-61   
ref|XP_010401401.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-61   Corvus cornix cornix
ref|XP_009480940.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    198   2e-61   Pelecanus crispus
ref|XP_006068942.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    199   2e-61   
ref|XP_009929631.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-61   Opisthocomus hoazin [hoatzin]
gb|EOB01801.1|  Ubiquitin                                               198   3e-61   Anas platyrhynchos [duck]
ref|XP_009884369.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   3e-61   Charadrius vociferus
ref|XP_007400915.1|  hypothetical protein PHACADRAFT_213544             199   3e-61   Phanerochaete carnosa HHB-10118-sp
ref|NP_002945.1|  ubiquitin-40S ribosomal protein S27a precursor        199   3e-61   Homo sapiens [man]
ref|XP_005018946.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   3e-61   
gb|AAA36788.1|  pro-ubiquitin                                           198   3e-61   Homo sapiens [man]
gb|AAA57047.1|  ubiquitin                                               199   4e-61   synthetic construct
ref|XP_008640291.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   4e-61   
ref|XP_007400913.1|  hypothetical protein PHACADRAFT_264025             199   4e-61   Phanerochaete carnosa HHB-10118-sp
gb|AAH53371.1|  Ribosomal protein S27a                                  198   4e-61   Homo sapiens [man]
ref|XP_006001599.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    198   4e-61   Latimeria chalumnae
ref|XP_008365153.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    199   4e-61   
gb|EGN96831.1|  hypothetical protein SERLA73DRAFT_185014                198   4e-61   Serpula lacrymans var. lacrymans S7.3
gb|KIO10764.1|  hypothetical protein M404DRAFT_20998                    198   4e-61   Pisolithus tinctorius Marx 270
ref|XP_011482499.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    198   4e-61   
gb|ACH71005.1|  ribosomal protein S27-3                                 198   5e-61   Salmo salar
ref|XP_005575916.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    199   6e-61   
ref|XP_008065389.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    198   6e-61   Carlito syrichta
ref|XP_007343921.1|  ubiquitin-domain-containing protein                198   6e-61   
ref|XP_002733357.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    198   6e-61   Saccoglossus kowalevskii
ref|XP_008923123.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   6e-61   
ref|XP_010573169.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    198   6e-61   Haliaeetus leucocephalus
ref|XP_010003219.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    201   6e-61   Chaetura pelagica
ref|XP_010704696.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    200   6e-61   
gb|KIM34102.1|  hypothetical protein M408DRAFT_19058                    198   7e-61   Serendipita vermifera MAFF 305830
ref|XP_009549036.1|  hypothetical protein HETIRDRAFT_441019             198   7e-61   Heterobasidion irregulare TC 32-1
ref|XP_009317915.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    197   7e-61   Pygoscelis adeliae
ref|XP_007304445.1|  ubiquitin/40s ribosomal protein S27a fusion        198   8e-61   Stereum hirsutum FP-91666 SS1
ref|XP_010595590.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    197   8e-61   
ref|XP_009926111.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    197   8e-61   Haliaeetus albicilla
ref|XP_007865027.1|  ubiquitin-domain-containing protein                197   9e-61   Gloeophyllum trabeum ATCC 11539
emb|CCO31835.1|  Ubiquitin-40S ribosomal protein S27a AltName: Fu...    197   9e-61   Rhizoctonia solani AG-1 IB
gb|ACO51599.1|  Ubiquitin                                               197   9e-61   Rana catesbeiana [bullfrog]
gb|AGO97083.1|  ubiquitin                                               197   9e-61   Cymbidium faberi
gb|KDQ26602.1|  hypothetical protein PLEOSDRAFT_1113129                 197   1e-60   Pleurotus ostreatus PC15
ref|XP_003758323.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    200   1e-60   
gb|KIP07142.1|  hypothetical protein PHLGIDRAFT_106094                  197   1e-60   Phlebiopsis gigantea 11061_1 CR5-6
gb|KFP93009.1|  Ubiquitin-40S ribosomal protein S27a                    197   1e-60   Haliaeetus albicilla
gb|KIY63590.1|  ubiquitin-domain-containing protein                     197   1e-60   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_004396839.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    197   1e-60   
gb|AAM27203.1|AF502248_1  40s ribosomal protein S27a                    197   1e-60   Epinephelus coioides [estuary cod]
gb|KDQ61543.1|  hypothetical protein JAAARDRAFT_30995                   197   1e-60   Jaapia argillacea MUCL 33604
ref|NP_956796.1|  ubiquitin-40S ribosomal protein S27a                  197   1e-60   Danio rerio [leopard danio]
gb|KIM90371.1|  hypothetical protein PILCRDRAFT_812107                  197   1e-60   Piloderma croceum F 1598
gb|KDR80707.1|  hypothetical protein GALMADRAFT_241118                  197   1e-60   Galerina marginata CBS 339.88
gb|KFW64033.1|  Ubiquitin-40S ribosomal protein S27a                    197   1e-60   Pygoscelis adeliae
gb|KIY49962.1|  ubiquitin/40s ribosomal protein S27a fusion             197   1e-60   Fistulina hepatica ATCC 64428
ref|XP_010376465.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    197   1e-60   Rhinopithecus roxellana
ref|XP_007771051.1|  ubiquitin-domain-containing protein                197   1e-60   Coniophora puteana RWD-64-598 SS2
ref|XP_009235580.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   1e-60   
ref|XP_003032858.1|  ubiquitin-40S ribosomal protein S31 fusion p...    197   1e-60   Schizophyllum commune H4-8
sp|P59272.2|RS27A_DAUCA  RecName: Full=Ubiquitin-40S ribosomal pr...    196   1e-60   Daucus carota [carrots]
gb|ABV58643.1|  ubquitin                                                196   1e-60   Catharanthus roseus [chatas]
gb|KII87325.1|  hypothetical protein PLICRDRAFT_42950                   197   1e-60   Plicaturopsis crispa FD-325 SS-3
gb|KFP78128.1|  Ubiquitin-40S ribosomal protein S27a                    196   1e-60   Acanthisitta chloris
gb|EMD39293.1|  hypothetical protein CERSUDRAFT_112941                  197   2e-60   Gelatoporia subvermispora B
gb|KIM66010.1|  hypothetical protein SCLCIDRAFT_1211653                 197   2e-60   Scleroderma citrinum Foug A
ref|XP_009070695.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    196   2e-60   Acanthisitta chloris
ref|XP_003504023.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    196   2e-60   Cricetulus griseus [Chinese hamsters]
ref|XP_001104764.1|  PREDICTED: hypothetical protein LOC709143          196   2e-60   
ref|XP_006738708.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    196   2e-60   Leptonychotes weddellii
ref|XP_006083528.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    199   2e-60   
ref|XP_009639081.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    197   2e-60   Egretta garzetta
ref|NP_077239.1|  ubiquitin-40S ribosomal protein S27a precursor        196   2e-60   Mus musculus [mouse]
ref|XP_003125184.2|  PREDICTED: ubiquitin-40S ribosomal protein S27a    198   3e-60   
ref|XP_004643097.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    196   3e-60   
gb|KIK50599.1|  hypothetical protein GYMLUDRAFT_51110                   196   3e-60   Gymnopus luxurians FD-317 M1
ref|XP_006888789.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    196   3e-60   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AAA74960.1|  ribosomal protein-linked ubiquitin                      196   3e-60   Oryza sativa [red rice]
gb|KIK48311.1|  hypothetical protein CY34DRAFT_705963                   196   4e-60   Suillus luteus UH-Slu-Lm8-n1
gb|AAH49478.1|  Zgc:66168 protein                                       196   4e-60   Danio rerio [leopard danio]
gb|KIK23888.1|  hypothetical protein PISMIDRAFT_678904                  196   5e-60   Pisolithus microcarpus 441
ref|XP_002469300.1|  ubiquitin/40s ribosomal protein S27a fusion        196   5e-60   
gb|KIO29915.1|  hypothetical protein M407DRAFT_242430                   196   5e-60   Tulasnella calospora MUT 4182
ref|XP_001831329.1|  ubiquitin-40S ribosomal protein S31 fusion p...    196   6e-60   Coprinopsis cinerea okayama7#130
ref|XP_007855532.1|  ubiquitin                                          196   6e-60   
ref|XP_004411170.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    195   6e-60   
ref|XP_004092958.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    195   6e-60   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_001874554.1|  ubiquitin-40S ribosomal protein S31 fusion p...    195   6e-60   Laccaria bicolor S238N-H82
ref|XP_006887475.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    195   7e-60   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EUC60885.1|  ubiquitin/40S ribosomal protein S27a fusion protein     195   7e-60   Rhizoctonia solani AG-3 Rhs1AP
gb|ELU44102.1|  ubiquitin                                               197   7e-60   Rhizoctonia solani AG-1 IA
ref|XP_005365195.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    195   7e-60   Microtus ochrogaster [prairie voles]
gb|KIJ65589.1|  hypothetical protein HYDPIDRAFT_39518                   195   8e-60   Hydnomerulius pinastri MD-312
ref|XP_006860476.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    195   9e-60   Chrysochloris asiatica
gb|AEI29168.1|  ubiquitin-like protein                                  194   1e-59   Phragmipedium longifolium
gb|EJU03816.1|  ubiquitin                                               195   1e-59   Dacryopinax primogenitus
gb|KIK67659.1|  hypothetical protein GYMLUDRAFT_215796                  195   1e-59   Gymnopus luxurians FD-317 M1
gb|KIJ55337.1|  hypothetical protein M422DRAFT_23939                    195   1e-59   Sphaerobolus stellatus SS14
gb|ACO08409.1|  Ubiquitin                                               194   1e-59   Oncorhynchus mykiss
gb|AEA51100.1|  ubiquitin                                               195   1e-59   Oryzias melastigma [Java medaka]
ref|XP_007261488.1|  ubiquitin-domain-containing protein                194   2e-59   Fomitiporia mediterranea MF3/22
ref|XP_007368145.1|  ubiquitin/40s ribosomal protein S27a fusion        194   2e-59   Dichomitus squalens LYAD-421 SS1
ref|XP_008038358.1|  ubiquitin/40s ribosomal protein S27a fusion        194   2e-59   Trametes versicolor FP-101664 SS1
gb|AGO97081.1|  ubiquitin                                               194   2e-59   Cymbidium faberi
gb|EPT02993.1|  hypothetical protein FOMPIDRAFT_1142989                 194   2e-59   Fomitopsis pinicola FP-58527 SS1
gb|KDQ06872.1|  hypothetical protein BOTBODRAFT_39300                   194   2e-59   Botryobasidium botryosum FD-172 SS1
gb|KIK08837.1|  hypothetical protein K443DRAFT_671895                   194   2e-59   Laccaria amethystina LaAM-08-1
emb|CAG12343.1|  unnamed protein product                                193   2e-59   Tetraodon nigroviridis
emb|CCM02543.1|  predicted protein                                      194   3e-59   Fibroporia radiculosa
ref|XP_002501200.1|  predicted protein                                  193   4e-59   Micromonas commoda
ref|XP_006461860.1|  hypothetical protein AGABI2DRAFT_193235            193   5e-59   Agaricus bisporus var. bisporus H97
ref|NP_476778.1|  ribosomal protein S27A                                193   5e-59   Drosophila melanogaster
gb|ACO08429.1|  Ubiquitin                                               193   5e-59   Oncorhynchus mykiss
ref|XP_007185405.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    193   5e-59   
ref|XP_004663256.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    193   5e-59   
ref|XP_004579614.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    193   6e-59   
gb|AAV84206.1|  unknown                                                 193   6e-59   Culicoides sonorensis
ref|XP_006901676.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    193   6e-59   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AGF25315.1|  ubiquitin 2                                             192   6e-59   
ref|XP_005175708.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    193   6e-59   
ref|XP_007382777.1|  ubiquitin-domain-containing protein                192   7e-59   
gb|ERE90935.1|  ubiquitin-40S ribosomal protein S27a-like protein       192   8e-59   
ref|XP_006890603.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    192   8e-59   
ref|XP_005345114.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    192   8e-59   
ref|XP_002002882.1|  GI10618                                            192   9e-59   
ref|XP_006889610.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    192   1e-58   
ref|XP_005352920.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    192   1e-58   
gb|ADV40075.1|  60S ribosomal protein L40A                              192   1e-58   
ref|XP_011194777.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    192   2e-58   
ref|XP_004015152.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    191   2e-58   
ref|NP_001133210.1|  ribosomal protein S27-3                            191   2e-58   
gb|KIJ20902.1|  hypothetical protein PAXINDRAFT_165728                  192   2e-58   
ref|XP_007410422.1|  hypothetical protein MELLADRAFT_71955              191   2e-58   
gb|AGO97082.1|  ubiquitin                                               191   2e-58   
gb|AEI29167.1|  ubiquitin-like protein                                  190   2e-58   
ref|XP_004629417.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    191   2e-58   
gb|ADF45325.1|  ubiquitin/ribosomal S27 fusion protein 1                191   3e-58   
gb|KDE06402.1|  ubiquitin-40S ribosomal protein S27a-1                  192   3e-58   
gb|ACQ59064.1|  Ubiquitin                                               191   3e-58   
ref|XP_004519374.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    191   3e-58   
gb|KIK98182.1|  hypothetical protein PAXRUDRAFT_824145                  191   3e-58   
ref|XP_002825892.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    191   4e-58   
ref|NP_001279942.1|  ribosomal protein S27a                             191   4e-58   
ref|XP_004652431.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    191   4e-58   
ref|XP_011208987.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    191   4e-58   
gb|AFM90373.1|  ubiquitin-40S ribosomal protein S27a-like protein       191   5e-58   
gb|AFK10704.1|  ubiquitin-40S ribosomal protein S27a-like protein       191   5e-58   
ref|NP_001292281.1|  ubiquitin-40S ribosomal protein S27a               191   5e-58   
emb|CCQ18633.1|  Ubiquitin and ubiquitin-like proteins                  193   5e-58   
ref|XP_006729877.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    191   5e-58   
ref|XP_784247.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a...    191   5e-58   
gb|AFM86275.1|  ubiquitin-40S ribosomal protein S27a-like protein       190   6e-58   
gb|KFB48180.1|  ubiquitin (ribosomal protein L40)                       190   6e-58   
gb|ABX75386.1|  60S ribosomal protein L40A                              190   6e-58   
ref|XP_006871713.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    190   7e-58   
gb|AFM86054.1|  ubiquitin-40S ribosomal protein S27a-like protein       190   7e-58   
gb|AEB54653.1|  ubiquitin                                               190   7e-58   
gb|AAS79344.1|  ribosomal protein S27a                                  190   9e-58   
ref|XP_001663729.1|  AAEL013536-PA                                      190   9e-58   
gb|ACX50289.1|  ubiquitin                                               190   1e-57   
gb|KFP35488.1|  Ubiquitin-40S ribosomal protein S27a                    189   1e-57   
gb|KEZ38887.1|  Ubiquitin-40S ribosomal protein S27a                    189   1e-57   
ref|XP_007913990.1|  putative ubiquitin-40s ribosomal protein s31...    189   1e-57   
ref|XP_005356706.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    189   1e-57   
gb|KJB22478.1|  hypothetical protein B456_004G049300                    188   2e-57   
gb|AFM87647.1|  ubiquitin-40S ribosomal protein S27a-like protein       189   2e-57   
ref|XP_003062279.1|  predicted protein                                  189   2e-57   
dbj|GAD99010.1|  ubiquitin                                              189   2e-57   
ref|XP_006896080.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    189   2e-57   
gb|ACD65153.1|  putative ubiquitin/40S ribosomal protein RPS27A f...    189   2e-57   
ref|XP_001244380.1|  ubiquitin-40S ribosomal protein S31 fusion p...    189   2e-57   
ref|XP_003272229.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    189   2e-57   
gb|ABR23473.1|  ubiquitin/40S ribosomal protein S27a                    189   3e-57   
emb|CEF98605.1|  Ubiquitin supergroup                                   188   3e-57   
ref|XP_003571935.2|  PREDICTED: ubiquitin-40S ribosomal protein S...    188   4e-57   
ref|XP_011123943.1|  hypothetical protein AOL_s00083g462                188   4e-57   
gb|ABD98741.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    188   4e-57   
gb|AGF25314.1|  ubiquitin 1                                             187   4e-57   
ref|XP_003788227.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    188   4e-57   
ref|XP_011116118.1|  hypothetical protein H072_10672                    188   4e-57   
ref|XP_001087600.1|  PREDICTED: hypothetical protein LOC697620          188   4e-57   
gb|ABM74399.1|  ubiquitin                                               188   4e-57   
gb|AAL55470.1|  ubiquitin/ribosomal protein S27a fusion protein         188   5e-57   
gb|AAY66925.1|  ubiquitin/ribosomal protein S27a fusion protein         188   5e-57   
gb|ACD65107.1|  putative ubiquitin/40S ribosomal protein RPS27A f...    188   5e-57   
ref|XP_003263604.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    188   6e-57   
ref|XP_008029241.1|  hypothetical protein SETTUDRAFT_94331              187   6e-57   
gb|ABM55591.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    187   7e-57   
gb|EQB50539.1|  hypothetical protein CGLO_10017                         187   8e-57   
ref|XP_002399366.1|  40S ribosomal protein S27A, putative               188   8e-57   
gb|KIV96259.1|  ubiquitin-40S ribosomal protein S27a                    187   8e-57   
gb|ABW23155.1|  ribosomal protein rps27a                                187   8e-57   
ref|XP_003047931.1|  ubiquitin-40S ribosomal protein S31 fusion p...    187   1e-56   
ref|XP_754493.1|  ubiquitin (UbiC)                                      187   1e-56   
gb|ABI52648.1|  ubiquitin/40S ribosomal protein S27a fusion protein     190   1e-56   
ref|XP_006692377.1|  40S ribosomal protein S27a-like protein            187   1e-56   
ref|XP_002626672.1|  ubiquitin-40S ribosomal protein S31 fusion p...    187   1e-56   
gb|EUC60891.1|  ubiquitin/40S ribosomal protein S27a fusion protein     196   1e-56   
ref|XP_007779099.1|  ubiquitin-40S ribosomal protein S27a               187   1e-56   
ref|XP_011390893.1|  putative ubiquitin-ribosomal 40S subunit pro...    187   1e-56   
emb|CDI55091.1|  probable ubiquitin/ribosomal protein S27a fusion...    187   1e-56   
dbj|BAC06474.1|  ubiquitin                                              187   1e-56   
gb|ACB70325.1|  ubiquitin/40S ribosomal protein S27a                    187   1e-56   
ref|XP_005563631.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    187   1e-56   
ref|XP_007877229.1|  hypothetical protein PFL1_06937                    187   1e-56   
emb|CBQ69010.1|  probable ubiquitin/ribosomal protein S27a fusion...    187   1e-56   
ref|XP_003296988.1|  ubiquitin-40S ribosomal protein S31 fusion p...    187   1e-56   
emb|CCF48698.1|  probable ubiquitin/ribosomal protein S27a fusion...    187   2e-56   
gb|KJA28046.1|  hypothetical protein HYPSUDRAFT_197596                  187   2e-56   
dbj|GAA93464.1|  hypothetical protein E5Q_00105                         192   2e-56   
ref|XP_002582692.1|  ubiquitin                                          186   2e-56   
ref|XP_003326773.1|  ubiquitin-40S ribosomal protein S31 fusion p...    187   2e-56   
ref|XP_008773015.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    186   2e-56   
gb|KIH93873.1|  small subunit ribosomal protein S27Ae                   186   2e-56   
ref|XP_001640566.1|  predicted protein                                  186   2e-56   
gb|ADF45326.1|  ubiquitin/ribosomal S27 fusion protein 2                186   2e-56   
ref|XP_001538961.1|  ubiquitin-40S ribosomal protein S31 fusion p...    186   2e-56   
ref|XP_009859843.1|  PREDICTED: r27a protein isoform X1                 186   2e-56   
ref|XP_574121.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a...    186   2e-56   
gb|EPQ66886.1|  hypothetical protein BGT96224_2407                      186   3e-56   
ref|NP_001027675.1|  r27a protein                                       186   3e-56   
gb|KIW43141.1|  ubiquitin-40S ribosomal protein S27a                    186   3e-56   
ref|XP_007722210.1|  ubiquitin-40S ribosomal protein S27a               186   3e-56   
dbj|BAJ23937.1|  ribosomal protein S27a                                 186   3e-56   
gb|KIY03162.1|  ubiquitin-40S ribosomal protein S27a                    186   3e-56   
gb|KEY73810.1|  hypothetical protein S7711_03110                        186   3e-56   
ref|XP_003839401.1|  similar to ubiquitin / ribosomal protein S27a      186   4e-56   
ref|XP_007875027.1|  hypothetical protein PNEG_02980                    186   4e-56   
gb|KIW11051.1|  ubiquitin-40S ribosomal protein S27a                    186   4e-56   
gb|KEF62640.1|  ubiquitin-40S ribosomal protein S27a                    186   4e-56   
ref|XP_007195197.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    187   4e-56   
tpg|DAA26453.1|  TPA: ubiquitin and ribosomal protein S27a-like         186   5e-56   
gb|ACF35544.1|  ubiquitin/ribosomal protein S27a fusion protein         185   5e-56   
gb|KHJ33942.1|  putative ubiquitin-40s ribosomal protein s31 fusi...    185   5e-56   
gb|KIX00747.1|  ubiquitin-40S ribosomal protein S27a                    185   5e-56   
ref|XP_007583549.1|  putative ubiquitin-40s ribosomal protein s31...    185   6e-56   
ref|XP_005959116.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    188   6e-56   
ref|XP_007841585.1|  Ubiquitin-40S ribosomal protein S27a               185   6e-56   
gb|KIV82057.1|  ubiquitin-40S ribosomal protein S27a                    185   6e-56   
ref|XP_008076828.1|  Ubiquitin-like protein                             185   7e-56   
ref|XP_001941819.1|  ubiquitin-40S ribosomal protein S31 fusion p...    185   8e-56   
ref|XP_009159055.1|  ubiquitin-40S ribosomal protein S27a               185   8e-56   
ref|XP_006901413.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    185   8e-56   
gb|ELR03817.1|  ubiquitin-40S ribosomal protein S27a                    185   9e-56   
ref|XP_007795786.1|  putative ubiquitin-40s ribosomal protein s31...    184   1e-55   
gb|KDN53338.1|  ubiquitin/40s ribosomal protein S27a fusion             184   1e-55   
ref|XP_006101651.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    184   1e-55   
gb|KIW05468.1|  ubiquitin-40S ribosomal protein S27a                    184   2e-55   
dbj|GAK66487.1|  ubiquitin/40S ribosomal protein S27a fusion            184   2e-55   
emb|CCF45248.1|  ubiquitin-40S ribosomal protein S27a                   184   2e-55   
ref|XP_004654621.1|  PREDICTED: uncharacterized protein LOC101599255    190   2e-55   
gb|ABM55417.1|  ribosomal protein S27                                   184   2e-55   
ref|XP_001729434.1|  hypothetical protein MGL_3469                      184   2e-55   
gb|KFH46012.1|  Ubiquitin-40S ribosomal protein-like protein            184   2e-55   
ref|XP_004330561.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    184   2e-55   
gb|AAX62431.1|  ribosomal protein S27a                                  184   2e-55   
sp|P31753.2|RS27A_ASPOF  RecName: Full=Ubiquitin-40S ribosomal pr...    182   2e-55   
ref|XP_009257448.1|  hypothetical protein FPSE_06055                    184   3e-55   
gb|ABX44800.1|  ubiquinated putative 40S ribosomal protein RPS27A       183   3e-55   
dbj|BAK02751.1|  predicted protein                                      183   3e-55   
ref|XP_005864530.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    183   4e-55   
ref|XP_006968883.1|  ubiquitin/small ribosomal subunit protein 31...    183   4e-55   
ref|XP_006866205.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    183   4e-55   
dbj|BAC56381.1|  similar to ubiquitin-S27a fusion protein               182   4e-55   
ref|XP_008216204.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    183   5e-55   
ref|XP_004891890.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    183   5e-55   
gb|AFS89619.1|  ubiquitin ribosomal protein RpS27a                      182   5e-55   
sp|P68202.2|RS27A_PLUXY  RecName: Full=Ubiquitin-40S ribosomal pr...    182   5e-55   
gb|ETN58928.1|  hypothetical protein AND_009492                         191   6e-55   
emb|CCT71659.1|  probable ubiquitin/ribosomal protein S27a fusion...    182   6e-55   
gb|KDN42452.1|  hypothetical protein RSAG8_06769                        182   6e-55   
gb|EMS21244.1|  small subunit ribosomal protein S27Ae                   182   7e-55   
emb|CAJ01876.1|  ubiquitin/ribosomal protein S27Ae fusion protein       182   1e-54   
gb|AGM32388.1|  ubiquitin-40S ribosomal protein                         182   1e-54   
ref|XP_003400429.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    182   1e-54   
emb|CAJ01879.1|  ubiquitin/ribosomal protein S27Ae fusion protein       182   1e-54   
gb|KDR17238.1|  Ubiquitin                                               182   1e-54   
ref|XP_007453416.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    182   1e-54   
ref|XP_007166707.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    182   1e-54   
emb|CAH04128.1|  ubiquitin/ribosomal protein S27Ae fusion protein       182   1e-54   
sp|P29504.2|RS27A_MANSE  RecName: Full=Ubiquitin-40S ribosomal pr...    182   1e-54   
gb|EHJ77179.1|  Ubiquitin-40S ribosomal protein S27a                    181   2e-54   
sp|P68203.2|RS27A_SPOFR  RecName: Full=Ubiquitin-40S ribosomal pr...    181   2e-54   
emb|CAH04347.1|  ubiquitin/S27Ae ribosomal protein                      181   2e-54   
gb|AGH68503.1|  ubiquitin extension protein                             181   2e-54   
ref|XP_003707148.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    182   2e-54   
ref|XP_003799950.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    181   3e-54   
ref|XP_969023.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a       181   3e-54   
gb|KIL69292.1|  hypothetical protein M378DRAFT_775165                   181   3e-54   
ref|XP_011142713.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    181   4e-54   
gb|AGN29644.1|  40S ribosomal protein S27a                              180   4e-54   
ref|XP_004637391.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    180   5e-54   
dbj|BAD05031.1|  ubiquitin                                              180   5e-54   
ref|XP_006833816.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    180   6e-54   
ref|XP_007115679.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    180   6e-54   
ref|NP_001091826.1|  ubiquitin and ribosomal protein S27a               180   6e-54   
ref|XP_011159939.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    180   6e-54   
gb|ABG46422.1|  ubiquitin/ribosomal protein S27 fusion protein          180   7e-54   
ref|XP_004269939.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    180   7e-54   
gb|ESA15414.1|  hypothetical protein GLOINDRAFT_346052                  180   7e-54   
ref|XP_006731505.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    180   8e-54   
emb|CAJ01880.1|  ubiquitin/ribosomal protein S27Ae fusion protein       179   1e-53   
ref|XP_003851546.1|  ubiquitin-40S ribosomal protein S31                179   1e-53   
ref|XP_008875293.1|  ubiquitin-40S ribosomal protein S27a               179   1e-53   
gb|ABN54483.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    179   1e-53   
emb|CAJ01881.1|  ubiquitin/ribosomal protein S27Ae fusion protein       179   1e-53   
ref|XP_007295337.1|  putative ubiquitin / ribosomal protein S27a        184   1e-53   
ref|XP_008362581.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    177   2e-53   
ref|XP_397323.2|  PREDICTED: ribosome biogenesis protein NSA2 hom...    179   2e-53   
ref|XP_007928008.1|  hypothetical protein MYCFIDRAFT_54296              179   2e-53   
gb|AGN29645.1|  40S ribosomal protein S27a                              179   2e-53   
gb|AAX48904.1|  S27a-ubiquitin                                          178   2e-53   
emb|CAA76578.1|  ubiquitin                                              178   2e-53   
gb|EEH04179.1|  ubiquitin                                               178   3e-53   
ref|XP_009531416.1|  hypothetical protein PHYSODRAFT_355036             178   3e-53   
ref|XP_005586401.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    177   5e-53   
ref|XP_006675175.1|  hypothetical protein BATDEDRAFT_18421              178   6e-53   
ref|XP_002173465.1|  ribomal-ubiquitin fusion protein Ubi5              177   6e-53   
ref|NP_001155610.1|  ribosomal protein S27A-like                        177   6e-53   
ref|XP_001746700.1|  hypothetical protein                               177   7e-53   
ref|XP_001418619.1|  Ribosomal protein S27a, component of cytosol...    177   8e-53   
ref|XP_002902716.1|  ubiquitin, putative                                177   8e-53   
ref|XP_006747376.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    177   8e-53   
gb|EHH24108.1|  hypothetical protein EGK_07704                          176   9e-53   
ref|XP_011062194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    177   1e-52   
ref|XP_004318058.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    179   1e-52   
ref|XP_002172480.1|  ribomal-ubiquitin fusion protein Ubi5              176   2e-52   
ref|XP_008608418.1|  ubiquitin-40S ribosomal protein S27a               176   2e-52   
gb|EHH58652.1|  hypothetical protein EGM_08555                          176   2e-52   
ref|XP_009266087.1|  Ubiquitin-40S ribosomal protein S27a               176   2e-52   
ref|XP_001904865.1|  hypothetical protein                               176   3e-52   
gb|AIY34646.1|  ribosomal protein                                       176   3e-52   
ref|XP_006960084.1|  ubiquitin/40s ribosomal protein S27a fusion        175   6e-52   
ref|XP_001091566.2|  PREDICTED: hypothetical protein LOC703267          176   6e-52   
ref|XP_011352403.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    175   7e-52   
gb|ABZ04273.1|  ribosomal protein rps27a                                174   7e-52   
ref|XP_004348414.1|  ubiquitin/ribosomal protein S27a fusion protein    174   8e-52   
pdb|3U5G|FF  Chain f, The Structure Of The Eukaryotic Ribosome At...    174   1e-51   
ref|XP_006082981.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    174   1e-51   



>ref|XP_011003162.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=202

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  65   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  124

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  125  KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  184

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  185  HYCGKCGLTYVYQKAG  200



>gb|AAZ83341.1| ubiquitin extension protein [Gossypium hirsutum]
 gb|KJB41754.1| hypothetical protein B456_007G119500 [Gossypium raimondii]
 gb|KJB69904.1| hypothetical protein B456_011G049100 [Gossypium raimondii]
Length=156

 Score =   228 bits (582),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_006488031.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
Length=164

 Score =   228 bits (582),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  27   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  86

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  87   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  146

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  147  HYCGKCGLTYVYQKAG  162



>gb|KJB06862.1| hypothetical protein B456_001G146500 [Gossypium raimondii]
Length=183

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  46   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  105

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  106  KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  165

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  166  HYCGKCGLTYVYQKAG  181



>ref|XP_006424488.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
 gb|ESR37728.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
Length=156

 Score =   227 bits (579),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|KJB49764.1| hypothetical protein B456_008G136200, partial [Gossypium raimondii]
Length=210

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  73   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  132

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  133  KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  192

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  193  HYCGKCGLTYVYQKAG  208



>ref|XP_002279878.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN71283.1| hypothetical protein VITISV_027093 [Vitis vinifera]
 emb|CAN70884.1| hypothetical protein VITISV_029192 [Vitis vinifera]
 gb|KDP28317.1| hypothetical protein JCGZ_14088 [Jatropha curcas]
Length=156

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_008389677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008389867.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008343199.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008350959.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008353873.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008360710.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_009363083.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009367168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009376181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
Length=156

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|NP_001275598.1| ubiquitin-40S ribosomal protein S27a-like [Solanum tuberosum]
 ref|XP_002297752.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_002301539.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 ref|XP_002515213.1| ubiquitin, putative [Ricinus communis]
 ref|XP_004252948.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252949.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252950.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_006376957.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_006438329.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 ref|XP_006483898.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 ref|XP_007044700.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 ref|XP_007221513.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 ref|XP_007223652.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 ref|XP_008227802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Prunus mume]
 ref|XP_009609224.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609225.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609226.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009775091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_009775093.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_010044607.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eucalyptus grandis]
 ref|XP_010999619.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Populus euphratica]
 emb|CAA71132.1| ubiquitin extension protein [Solanum tuberosum]
 gb|ABA46785.1| ubiquitin extension protein-like protein [Solanum tuberosum]
 gb|ABK92566.1| unknown [Populus trichocarpa]
 gb|ABK93901.1| unknown [Populus trichocarpa]
 gb|ABK94236.1| unknown [Populus trichocarpa]
 gb|ABK94239.1| unknown [Populus trichocarpa]
 gb|ABK94284.1| unknown [Populus trichocarpa]
 gb|ACG70965.1| ubiquitin extensive-like protein [Ziziphus jujuba]
 gb|EEE80812.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 gb|EEE82557.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|EEF47197.1| ubiquitin, putative [Ricinus communis]
 gb|EMJ22712.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 gb|EMJ24851.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 gb|EOY00532.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|ERP54754.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ESR51569.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 gb|KCW86699.1| hypothetical protein EUGRSUZ_B03309 [Eucalyptus grandis]
 gb|KDO60231.1| hypothetical protein CISIN_1g031613mg [Citrus sinensis]
 emb|CDO98715.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_007157375.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 ref|XP_007157378.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
 gb|ESW29369.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 gb|ESW29372.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
Length=155

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_006374591.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ERP52388.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|ABN72579.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_003613203.1| Ubiquitin [Medicago truncatula]
 gb|AES96161.1| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   226 bits (577),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/135 (98%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>gb|ACJ83917.1| unknown [Medicago truncatula]
 gb|ACJ86209.1| unknown [Medicago truncatula]
 gb|AET04371.2| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   226 bits (576),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/135 (98%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/137 (97%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  95   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  154

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAECGAGTFMANHFDR
Sbjct  155  KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDR  214

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKCGLTYVYQK GD
Sbjct  215  HYCGKCGLTYVYQKAGD  231


 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  175
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  76



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  95   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  154

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  155  KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  214

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  215  HYCGKCGLTYVYQKAG  230


 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  175
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  76



>gb|AFK49579.1| unknown [Lotus japonicus]
Length=155

 Score =   226 bits (576),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCGLTYVYQK
Sbjct  139  HYCGKCGLTYVYQK  152



>ref|XP_003629895.1| Ubiquitin [Medicago truncatula]
Length=232

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/135 (98%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  96   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  155

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  156  KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  215

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  216  HYCGKCGLTYVYQKA  230



>ref|XP_008358198.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=156

 Score =   226 bits (576),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQ+ G
Sbjct  139  HYCGKCGLTYVYQRAG  154



>ref|XP_011040332.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=156

 Score =   226 bits (576),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_003634320.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN75420.1| hypothetical protein VITISV_037877 [Vitis vinifera]
Length=156

 Score =   226 bits (576),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPN+ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNSECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_004504241.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   226 bits (575),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/135 (99%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>gb|AAZ53360.1| ubiquitin extension protein [Nicotiana tabacum]
Length=156

 Score =   226 bits (575),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAG+FMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGSFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_004288657.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 ref|XP_004297391.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 gb|AEQ75492.1| ubiquitin extension protein [Rosa multiflora]
Length=156

 Score =   226 bits (575),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQ+LRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQKLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_004489824.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   225 bits (574),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 133/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCGLTYVYQK
Sbjct  139  HYCGKCGLTYVYQK  152



>ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
Length=156

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_002525394.1| ubiquitin, putative [Ricinus communis]
 ref|XP_009617530.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009629268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009761349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 ref|XP_009773069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 emb|CAA11268.1| ubiquitin extension protein [Nicotiana tabacum]
 gb|AAX07419.1| ubiquitin/s27a 40S ribosomal protein [Nicotiana benthamiana]
 gb|EEF37032.1| ubiquitin, putative [Ricinus communis]
Length=156

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>gb|ABK42077.1| ubiquitin extension protein [Capsicum annuum]
Length=179

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  42   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  101

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  102  KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  161

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  162  HYCGKCGLTYVYNKAG  177



>gb|ABI84265.1| ubiquitin/ribosomal protein S27a [Arachis hypogaea]
Length=155

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLA+LQFYK+D+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAILQFYKIDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK  
Sbjct  139  HYCGKCGLTYVYQKAA  154



>ref|XP_006492389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 gb|KDO86853.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=156

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|AIX10775.1| ubiquitin, partial [Panax notoginseng]
Length=155

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  18   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  77

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKV++SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  78   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDR  137

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  138  HYCGKCGLTYVYQKAG  153



>ref|XP_008781194.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_008810072.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_010921349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Elaeis guineensis]
Length=156

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|KDP26615.1| hypothetical protein JCGZ_17773 [Jatropha curcas]
Length=156

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY KPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYPKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>ref|XP_011082406.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
 gb|AFJ42574.1| ubiquitin extension protein 5 [Sesamum indicum]
 gb|KDP45613.1| hypothetical protein JCGZ_17220 [Jatropha curcas]
Length=156

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>ref|NP_001269170.1| ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus]
 ref|XP_008446192.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cucumis melo]
 gb|AAQ76040.1| ubiquitin extension protein [Cucumis sativus]
 gb|ADN33826.1| ubiquitin extension protein [Cucumis melo subsp. melo]
Length=156

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>ref|XP_002320950.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_011040582.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
 gb|ABK92725.1| unknown [Populus trichocarpa]
 gb|EEE99265.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQ  G
Sbjct  139  HYCGKCGLTYVYQTAG  154



>gb|KGN51791.1| hypothetical protein Csa_5G600925 [Cucumis sativus]
Length=188

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  51   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  110

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  111  KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  170

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  171  HYCGKCGLTYVYNKAG  186



>ref|XP_010040181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
 gb|KCW45422.1| hypothetical protein EUGRSUZ_L00891 [Eucalyptus grandis]
Length=156

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNGECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_004142977.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 ref|XP_004172998.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 gb|KGN62301.1| Ubiquitin extension protein [Cucumis sativus]
Length=156

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/138 (97%), Positives = 136/138 (99%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKL+VLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLSVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQK-GGD  412
            HYCGKCGLTYVYQK GGD
Sbjct  139  HYCGKCGLTYVYQKPGGD  156



>gb|ADF36485.1| ubiquitin extension protein [Ageratina adenophora]
 gb|AID52926.1| ubiquitin [Carthamus tinctorius]
Length=153

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/135 (98%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>ref|XP_008793306.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Phoenix dactylifera]
Length=156

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD++GKV RLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDTGKVTRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>emb|CAN80663.1| hypothetical protein VITISV_036195 [Vitis vinifera]
Length=156

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNXKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|ACJ84122.1| unknown [Medicago truncatula]
Length=155

 Score =   224 bits (571),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SG VQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGTVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>gb|AAL66206.1|AF386524_1 ubiquitin extension protein [Pyrus communis]
Length=154

 Score =   224 bits (571),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+S KVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSRKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>sp|P62980.2|RS27A_SOLLC RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum lycopersicum]
 sp|P62981.2|RS27A_SOLTU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum tuberosum]
 emb|CAA41207.1| ubiquitin [Solanum lycopersicum]
 emb|CAA77735.1| ubiquitin monomer/ribosomal protein [Solanum tuberosum]
 gb|AAA19247.1| ubiquitin/ribosomal fusion protein [Solanum tuberosum]
Length=156

 Score =   224 bits (570),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD++GKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>gb|AFK43562.1| unknown [Medicago truncatula]
Length=155

 Score =   224 bits (570),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCG TYVYQK 
Sbjct  139  HYCGKCGPTYVYQKA  153



>ref|XP_001774978.1| predicted protein [Physcomitrella patens]
 gb|EDQ60244.1| predicted protein [Physcomitrella patens]
Length=156

 Score =   224 bits (570),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_010941490.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=156

 Score =   223 bits (569),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_011079491.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
Length=156

 Score =   223 bits (569),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLR+ECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLREECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>gb|AHA83529.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   223 bits (569),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKV++SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>ref|XP_003535084.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
Length=155

 Score =   223 bits (568),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGK+QRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLALLQFYKVDDSGKLQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCGLTYVYQK
Sbjct  139  HYCGKCGLTYVYQK  152



>ref|XP_010248517.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nelumbo nucifera]
Length=156

 Score =   223 bits (568),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLA+LQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLALLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>emb|CAA80334.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   223 bits (568),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 132/135 (98%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCG TYVYQK 
Sbjct  139  HYCGKCGQTYVYQKA  153



>ref|NP_001238181.1| uncharacterized protein LOC100527579 [Glycine max]
 ref|XP_003517689.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
 gb|ACU16690.1| unknown [Glycine max]
 gb|KHN00366.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
 gb|KHN14565.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=155

 Score =   223 bits (568),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKL +LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLGILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>ref|XP_010270924.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   223 bits (568),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKL VLQFYKVD+SGKVQRLRKECPNA+CGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLPVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_008776477.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Phoenix 
dactylifera]
Length=162

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKV RLRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVTRLRKECPNVECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_004229050.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Solanum lycopersicum]
Length=156

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKL VLQFYKVD++GKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLTVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus domestica]
Length=156

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSD+IDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDSIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SG+VQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGQVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|AAG13985.1|AF298826_1 ubiquitin/ribosomal protein 27a [Prunus avium]
Length=156

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYK D+SGKVQ+LRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKGDDSGKVQKLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|EYU38434.1| hypothetical protein MIMGU_mgv1a015486mg [Erythranthe guttata]
Length=156

 Score =   222 bits (565),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKL+VLQ+YK+D+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLSVLQYYKIDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYAKAG  154



>gb|AER12038.1| ubiquitin extension protein, partial [Paeonia suffruticosa]
Length=140

 Score =   221 bits (563),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  3    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  62

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDR
Sbjct  63   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNGDCGAGTFMANHFDR  122

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKCGLTYVY+K  D
Sbjct  123  HYCGKCGLTYVYKKAAD  139



>ref|XP_010270921.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   222 bits (565),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKL VLQFYKVD+SGKVQRLRKECPNA+CGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLPVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>sp|P47905.2|RS27A_LUPAL RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Lupinus albus]
 emb|CAA80333.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECPNTECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCG TYVYQK 
Sbjct  139  HYCGKCGKTYVYQKA  153



>ref|NP_001238483.1| uncharacterized protein LOC100527854 [Glycine max]
 gb|ACU17047.1| unknown [Glycine max]
Length=155

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFD 
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLALLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDP  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>ref|XP_006402395.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
 gb|ESQ43848.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
Length=157

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>ref|XP_010506742.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>ref|XP_006397903.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
 gb|ESQ39356.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
Length=157

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>ref|XP_001762629.1| predicted protein [Physcomitrella patens]
 gb|EDQ72428.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPDCGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>gb|ABR16172.1| unknown [Picea sitchensis]
 gb|ABR16495.1| unknown [Picea sitchensis]
 gb|ABR16621.1| unknown [Picea sitchensis]
Length=156

 Score =   221 bits (563),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKLAVLQ+YKVD+SGKVQRLRKECPN +CGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLAVLQYYKVDDSGKVQRLRKECPNQDCGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK  
Sbjct  139  HYCGKCGLTYVYQKAA  154



>ref|NP_566095.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|NP_001189768.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|XP_002880283.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006296217.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
 sp|P59232.2|R27AB_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK53000.1|AF375416_1 At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAA32907.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAC34235.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM65909.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM98297.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAN28749.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|EFH56542.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10801.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|AEC10802.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|EOA29115.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
Length=157

 Score =   221 bits (562),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>ref|XP_009104378.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3 [Brassica rapa]
 emb|CDY66301.1| BnaA04g27270D [Brassica napus]
 emb|CDY25100.1| BnaC06g18420D [Brassica napus]
 emb|CDY11410.1| BnaA09g39760D [Brassica napus]
 emb|CDX93983.1| BnaC04g21420D [Brassica napus]
 emb|CDX76623.1| BnaC08g32090D [Brassica napus]
 emb|CDX67885.1| BnaA07g19250D [Brassica napus]
Length=157

 Score =   221 bits (562),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>ref|XP_010507927.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010518402.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   221 bits (562),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCGLTYVYQK
Sbjct  139  HYCGKCGLTYVYQK  152



>gb|EPS73110.1| hypothetical protein M569_01646, partial [Genlisea aurea]
Length=157

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  20   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  79

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLA+L FYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  80   KRKKKTYTKPKKIKHKKKKVKLAILHFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  139

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKC LTYVY K G
Sbjct  140  HYCGKCNLTYVYNKAG  155



>ref|XP_010413295.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
Length=157

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 135/138 (98%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKH+KVKLAVLQFYK+D SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHRKVKLAVLQFYKIDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK-GGD  412
            HYCGKCGLTYVYQK GGD
Sbjct  139  HYCGKCGLTYVYQKEGGD  156



>ref|XP_009133797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
 emb|CDY50916.1| BnaC03g72450D [Brassica napus]
 emb|CDX83344.1| BnaA03g21620D [Brassica napus]
Length=157

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>gb|AFX96040.1| ubiquitin extension protein [Grimmia pilifera]
Length=156

 Score =   221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPDCGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK  
Sbjct  139  HYCGKCGLTYVYQKAA  154



>ref|XP_010675161.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Beta vulgaris 
subsp. vulgaris]
Length=156

 Score =   221 bits (562),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKL VLQFYKV +S K+QRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLPVLQFYKVSDSAKIQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_001754264.1| predicted protein [Physcomitrella patens]
 ref|XP_001762712.1| predicted protein [Physcomitrella patens]
 gb|EDQ72511.1| predicted protein [Physcomitrella patens]
 gb|EDQ80714.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   221 bits (562),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNPDCGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCGLTYVYQK 
Sbjct  139  HYCGKCGLTYVYQKA  153



>ref|NP_191784.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
 sp|P59233.2|R27AC_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-3; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32906.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 emb|CAB71885.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 gb|AAK97689.1| AT3g62250/T17J13_210 [Arabidopsis thaliana]
 gb|AAM61537.1| ubiquitin extension protein UBQ5 [Arabidopsis thaliana]
 gb|AAM98116.1| At3g62250/T17J13_210 [Arabidopsis thaliana]
 dbj|BAE98979.1| ubiquitin extension protein [Arabidopsis thaliana]
 gb|AEE80327.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
Length=157

 Score =   221 bits (562),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYK+D SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKIDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>gb|ABH08969.1| ubiquitin extension protein [Morus bombycis]
Length=156

 Score =   220 bits (561),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLA LQFYK+D+SGKV RLRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAALQFYKIDDSGKVSRLRKECPNDECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|EYU46866.1| hypothetical protein MIMGU_mgv1a015483mg [Erythranthe guttata]
Length=156

 Score =   220 bits (561),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKL+VLQ+YK+D+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLSVLQYYKIDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCGLTYVY K
Sbjct  139  HYCGKCGLTYVYAK  152



>ref|XP_002876668.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006293091.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
 ref|XP_010512610.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010468976.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 gb|EFH52927.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA25989.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
Length=157

 Score =   220 bits (561),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/138 (96%), Positives = 135/138 (98%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYK+D SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKIDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK-GGD  412
            HYCGKCGLTYVYQK GGD
Sbjct  139  HYCGKCGLTYVYQKEGGD  156



>ref|XP_006832935.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
 gb|ERM98213.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
Length=156

 Score =   220 bits (560),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKL +LQFYKVD+SGKVQ++RKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLPILQFYKVDDSGKVQKIRKECPNQECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|XP_010251196.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKL++LQFYKVD+SGKVQ+LRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLSLLQFYKVDDSGKVQKLRKECPNQECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>gb|KFK35409.1| hypothetical protein AALP_AA5G280900 [Arabis alpina]
 gb|KFK37468.1| hypothetical protein AALP_AA4G260800 [Arabis alpina]
Length=157

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHKHKKVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKLKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>ref|XP_009416508.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391524.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414159.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   218 bits (555),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 132/136 (97%), Gaps = 1/136 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQKG  406
            RHYCGKCGLTYVYQK 
Sbjct  139  RHYCGKCGLTYVYQKA  154



>ref|XP_009772672.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
Length=156

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYN+QKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDDRTLADYNLQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HY GKCGLTYVY K G
Sbjct  139  HYYGKCGLTYVYNKAG  154



>ref|XP_009116899.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
Length=157

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN QKESTLHLVL LRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNTQKESTLHLVLPLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK + KHKKVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKNERKHKKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKEG  154



>ref|XP_009414918.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=167

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVYQK
Sbjct  139  RHYCGKCGLTYVYQK  153



>gb|AIH15195.1| ubiquitin-40S ribosomal protein S27a-like protein [Hedychium 
coronarium]
Length=157

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 1/137 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHK KKVKLAVLQ+YKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQYYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQKGG  409
            RHYCGKCGLTYVY K G
Sbjct  139  RHYCGKCGLTYVYNKAG  155



>ref|XP_009383724.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 131/136 (96%), Gaps = 1/136 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVSRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQKG  406
            RHYCGKCGLTYVY K 
Sbjct  139  RHYCGKCGLTYVYTKA  154



>ref|XP_006846976.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
 gb|ERN08557.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
Length=156

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHK KKVKL VLQFYKVD+SGKVQ+LRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKLKHKKKKVKLPVLQFYKVDDSGKVQKLRKECPNQECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  139  HYCGKCGLTYVYQKAG  154



>ref|NP_001275323.1| putative ubiquitin extension protein [Solanum tuberosum]
 gb|ABY21245.1| putative ubiquitin extension protein [Solanum tuberosum]
Length=156

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY KPKKIK K KKVKLAVLQFYKVD++GKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYAKPKKIKPKKKKVKLAVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVY K G
Sbjct  139  HYCGKCGLTYVYNKAG  154



>ref|XP_003568865.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Brachypodium 
distachyon]
 dbj|BAJ88878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|NP_001042915.1| Os01g0328400 [Oryza sativa Japonica Group]
 ref|XP_006644130.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Oryza 
brachyantha]
 sp|Q9ARZ9.1|R27AA_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB39294.1| ubiquitin / ribosomal protein S27a.1 [Oryza sativa Japonica Group]
 dbj|BAF04829.1| Os01g0328400 [Oryza sativa Japonica Group]
 gb|EAY73811.1| hypothetical protein OsI_01687 [Oryza sativa Indica Group]
 gb|EAY73815.1| hypothetical protein OsI_01691 [Oryza sativa Indica Group]
 gb|EAZ11698.1| hypothetical protein OsJ_01558 [Oryza sativa Japonica Group]
 dbj|BAG88191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=155

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_004968668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Setaria 
italica]
Length=155

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_003567648.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Brachypodium 
distachyon]
 sp|P0CG87.1|RS272_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62699.1| ubiquitin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92072.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDES-GKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+S GKV RLRKECPNA+CGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDSTGKVTRLRKECPNADCGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>gb|AEE98366.1| ubiquitin [Deschampsia antarctica]
Length=155

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>sp|P0CG86.1|RS271_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62698.1| ubiquitin [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   213 bits (543),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA+CGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNADCGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_004977103.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Setaria 
italica]
Length=155

 Score =   213 bits (543),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA+CGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNADCGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>gb|AFI60245.1| ubiquitin, partial [Panicum virgatum]
Length=153

 Score =   213 bits (542),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  17   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  76

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNA+CGAGTFMANHFD
Sbjct  77   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNADCGAGTFMANHFD  136

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  137  RHYCGKCGLTYVYNQ  151



>gb|ABR29645.1| ubiquitin, partial [Lolium perenne]
Length=155

 Score =   213 bits (542),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDGTGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>gb|ACA24140.1| ubiquitin [Lolium temulentum]
Length=155

 Score =   213 bits (542),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDGTGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_002457768.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 ref|XP_008655871.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|EES02888.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 gb|AFW80667.1| polyubiquitin-like protein isoform 1 [Zea mays]
 gb|AFW80668.1| polyubiquitin-like protein isoform 2 [Zea mays]
Length=155

 Score =   213 bits (542),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAG FMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGVFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_009385375.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=158

 Score =   213 bits (542),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 130/136 (96%), Gaps = 1/136 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSD IDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDAIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQKG  406
            RHYCGKCGLTYVYQK 
Sbjct  139  RHYCGKCGLTYVYQKA  154



>gb|AEO11783.1| ubiquitin [Lolium perenne]
Length=147

 Score =   212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  12   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  71

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  72   KRKKKTYTKPKKQKHKHKKVKLALLQFYKVDDGTGKVTRLRKECPNAECGAGTFMANHFD  131

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  132  RHYCGKCGLTYVYNQ  146



>ref|XP_010544941.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Tarenaya 
hassleriana]
 ref|XP_010523893.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Tarenaya hassleriana]
Length=155

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 133/138 (96%), Gaps = 3/138 (2%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD S KVQRLRKECPN  CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSNKVQRLRKECPN--CGAGTFMASHFDR  136

Query  362  HYCGKCGLTYVYQK-GGD  412
            HYCGKCGLTYVYQK GGD
Sbjct  137  HYCGKCGLTYVYQKDGGD  154



>ref|XP_006306408.1| hypothetical protein CARUB_v10012327mg [Capsella rubella]
 gb|EOA39306.1| hypothetical protein CARUB_v10012327mg [Capsella rubella]
Length=156

 Score =   211 bits (538),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECP+A CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSASCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCG TYV++K
Sbjct  139  HYCGKCGTTYVFKK  152



>ref|NP_001131602.1| ubiquitin [Zea mays]
 ref|XP_002439338.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 sp|P27923.2|RS27A_MAIZE RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Zea mays]
 pir||JS0657 ubiquitin / ribosomal protein S27a - maize
 gb|AAA33519.1| ubiquitin fusion protein [Zea mays]
 gb|AAA70105.1| ubiquitin fusion protein [Zea mays]
 gb|ACF80088.1| unknown [Zea mays]
 gb|EES17768.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 gb|AFW84849.1| ubiquitin-40S ribosomal protein S27a Precursor [Zea mays]
 prf||2211240B ubiquitin fusion protein
Length=155

 Score =   211 bits (538),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN ECGAG FMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNTECGAGVFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_010519353.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2, partial [Tarenaya 
hassleriana]
Length=150

 Score =   211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 130/134 (97%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD S KVQRLRKECPN  CGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSNKVQRLRKECPN--CGAGTFMASHFDR  136

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCGLTYVYQK
Sbjct  137  HYCGKCGLTYVYQK  150



>ref|XP_006654079.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oryza brachyantha]
Length=155

 Score =   211 bits (537),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN +CGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNNDCGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|NP_001054720.2| Os05g0160200 [Oryza sativa Japonica Group]
 sp|P51431.3|R27AB_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Oryza sativa Japonica 
Group]
 pdb|3J60|FF Chain f, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAT93912.1| putative ubiquitin extension protein [Oryza sativa Japonica Group]
 gb|AAV43924.1| putative ubiquitin fusion protein [Oryza sativa Japonica Group]
 gb|ABR25414.1| 40S ribosomal protein S27a [Oryza sativa Indica Group]
 dbj|BAG99770.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62418.1| hypothetical protein OsJ_17209 [Oryza sativa Japonica Group]
 dbj|BAF16634.2| Os05g0160200 [Oryza sativa Japonica Group]
Length=155

 Score =   211 bits (537),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN +CGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNNDCGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_010914703.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X3 [Elaeis guineensis]
Length=207

 Score =   213 bits (541),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  53   SSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  112

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDR
Sbjct  113  KRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDR  172

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKCGL  VYQK G+
Sbjct  173  HYCGKCGLN-VYQKAGE  188



>ref|XP_010914705.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X5 [Elaeis guineensis]
Length=188

 Score =   212 bits (539),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 129/136 (95%), Gaps = 1/136 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  53   SSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  112

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDR
Sbjct  113  KRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDR  172

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGL  VYQK G
Sbjct  173  HYCGKCGLN-VYQKAG  187



>ref|XP_010914702.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Elaeis guineensis]
Length=211

 Score =   213 bits (541),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 129/136 (95%), Gaps = 1/136 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  53   SSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  112

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDR
Sbjct  113  KRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDR  172

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGL  VYQK G
Sbjct  173  HYCGKCGLN-VYQKAG  187



>ref|XP_008649366.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|ACG24702.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG24773.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG36278.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG38230.1| 40S ribosomal protein S27a [Zea mays]
 gb|AFW77223.1| polyubiquitin-like protein [Zea mays]
Length=155

 Score =   210 bits (535),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+ +GKV RLRKECPN ECGAG FMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDATGKVTRLRKECPNTECGAGVFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_009103181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 ref|XP_009115529.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 emb|CDY44146.1| BnaA09g31060D [Brassica napus]
 emb|CDY25783.1| BnaA07g09990D [Brassica napus]
 emb|CDY12472.1| BnaC07g13120D [Brassica napus]
Length=156

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCG TYV++K
Sbjct  139  HYCGKCGTTYVFKK  152



>gb|AFX60090.1| ribosomal protein S27a, partial [Brassica oleracea]
Length=152

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  15   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  74

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  75   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDR  134

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCG TYV++K
Sbjct  135  HYCGKCGTTYVFKK  148



>ref|XP_010914704.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X4 [Elaeis guineensis]
Length=193

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 129/136 (95%), Gaps = 1/136 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  53   SSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  112

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDR
Sbjct  113  KRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDR  172

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGL  VYQK G
Sbjct  173  HYCGKCGLN-VYQKAG  187



>ref|XP_002890580.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66839.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCG TYV++K 
Sbjct  139  HYCGKCGTTYVFKKA  153



>ref|NP_173755.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
 sp|P59271.2|R27AA_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF79581.1|AC007945_1 F28C11.5 [Arabidopsis thaliana]
 gb|AAF87001.1|AC005292_10 F26F24.28 [Arabidopsis thaliana]
 gb|AAM62617.1| ubiquitin extension protein, putative [Arabidopsis thaliana]
 gb|ABD59101.1| At1g23410 [Arabidopsis thaliana]
 gb|AEE30384.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
Length=156

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKH HKKVKLAVLQFYKVD SGKVQRL+KECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHTHKKVKLAVLQFYKVDGSGKVQRLKKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKG  406
            HYCGKCG TYV++K 
Sbjct  139  HYCGKCGTTYVFKKA  153



>gb|ACG31121.1| 40S ribosomal protein S27a [Zea mays]
Length=155

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+ + KV RLRKECPN+ECGAG FMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDTTSKVTRLRKECPNSECGAGVFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>gb|AAA70104.1| ubiquitin fusion protein [Zea mays]
 prf||2211240A ubiquitin fusion protein
Length=155

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKK KHKHKKVKL+VLQFYKVD+ + KV RLRKECPN+ECGAG FMANHFD
Sbjct  79   KRKKKTYTKPKKTKHKHKKVKLSVLQFYKVDDTTSKVTRLRKECPNSECGAGVFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_006416085.1| hypothetical protein EUTSA_v10008988mg [Eutrema salsugineum]
 gb|ESQ34438.1| hypothetical protein EUTSA_v10008988mg [Eutrema salsugineum]
Length=156

 Score =   209 bits (531),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD +GKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGTGKVQRLRKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCG TYV++K
Sbjct  139  HYCGKCGTTYVFKK  152



>ref|NP_001150700.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG40048.1| 40S ribosomal protein S27a [Zea mays]
 tpg|DAA48105.1| TPA: polyubiquitin-like protein [Zea mays]
Length=155

 Score =   209 bits (531),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKL+VLQFYKVD+ + KV RLRKECPN ECGAG FMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLSVLQFYKVDDTTSKVTRLRKECPNTECGAGVFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_010914701.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Elaeis guineensis]
Length=225

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 129/136 (95%), Gaps = 1/136 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  53   SSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  112

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKI HK KKVKL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDR
Sbjct  113  KRKKKTYTKPKKINHKKKKVKLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDR  172

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGL  VYQK G
Sbjct  173  HYCGKCGLN-VYQKAG  187



>gb|KHN22999.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=151

 Score =   208 bits (530),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 130/134 (97%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLALLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGKCGLTYVYQK  403
                KCGLTYVYQK
Sbjct  139  ----KCGLTYVYQK  148



>gb|ADE58112.1| ubiquitin/ribosomal fusion protein [Citrus trifoliata]
Length=156

 Score =   208 bits (530),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            S DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLA+YNIQKESTLH VLR RGGAK
Sbjct  19   SRDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLAEYNIQKESTLHFVLRFRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            K KKKTYTKPKKIKHK KKVKLA LQF KVD+SGKVQRLRKECPNAECGAG FMANHFDR
Sbjct  79   KSKKKTYTKPKKIKHKKKKVKLAFLQFSKVDDSGKVQRLRKECPNAECGAGPFMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
             YCGKCGLTYVYQK G
Sbjct  139  QYCGKCGLTYVYQKAG  154



>ref|XP_010498849.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Camelina sativa]
Length=156

 Score =   208 bits (530),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKH HKKVKLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHVHKKVKLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQ  400
            HYCGKCG TYV++
Sbjct  139  HYCGKCGTTYVFK  151



>emb|CDY04715.1| BnaC05g18740D [Brassica napus]
Length=156

 Score =   208 bits (529),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            H+CGKCG TYV++K
Sbjct  139  HHCGKCGTTYVFKK  152



>gb|AAW56553.1| ubiquitin/s27a 40s ribosomal protein [Nicotiana benthamiana]
Length=156

 Score =   208 bits (529),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKI+DKEGIPP QQRLIFAGKQ+EDG TLADYNIQKESTLHLVLRL GGAK
Sbjct  19   SSDTIDNVKAKIEDKEGIPPYQQRLIFAGKQVEDGCTLADYNIQKESTLHLVLRLHGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNA+CGAGT+MANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAKCGAGTYMANHFDR  138

Query  362  HYCGKCGLTYVYQKGG  409
            +YCGKCGLTYVY K G
Sbjct  139  YYCGKCGLTYVYNKAG  154



>gb|ADU04750.1| ubiquitin extension protein, partial [Mesostigma viride]
 gb|ADU04751.1| ubiquitin extension protein, partial [Mesostigma viride]
Length=132

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +2

Query  8    DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkr  187
            DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKR
Sbjct  1    DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKR  60

Query  188  kkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHY  367
            KKKTYTKPKK KHK KKVKLAVLQ+YKVD+SGKVQRLRKECPN +CGAG FMA+H DRHY
Sbjct  61   KKKTYTKPKKNKHKKKKVKLAVLQYYKVDDSGKVQRLRKECPNPDCGAGCFMASHKDRHY  120

Query  368  CGKCGLTYVYQK  403
            CGKCGLTYVYQK
Sbjct  121  CGKCGLTYVYQK  132



>ref|XP_010460127.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Camelina 
sativa]
Length=156

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKH HKKVKLAVLQFY+VD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHVHKKVKLAVLQFYRVDGSGKVQRLRKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQ  400
            HYCGKCG TYV++
Sbjct  139  HYCGKCGTTYVFK  151



>ref|NP_001105472.1| ubiquitin-40S ribosomal protein S27a [Zea mays]
 emb|CAA63150.1| ORF [Zea mays]
Length=155

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            K KKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRK+CPNAEC AG FMANHFD
Sbjct  79   KPKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKDCPNAECHAGVFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  139  RHYCGKCGLTYVYNQ  153



>ref|XP_010477636.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Camelina 
sativa]
Length=156

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKH HKKVKLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHVHKKVKLAVLQFYKVDGSGKVQRLRKECPSVGCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQ  400
            HYCGKCG TYV++
Sbjct  139  HYCGKCGTTYVFK  151



>ref|XP_008347677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=218

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFA KQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  81   SSDTIDNVKAKIQDKEGIPPDQQRLIFADKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  140

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+SGKVQRLRKEC NA+CG GTFMANHF+ 
Sbjct  141  KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDSGKVQRLRKECLNAKCGVGTFMANHFNM  200

Query  362  HYCGKCGLTYVYQKGG  409
            HYC KCGLTYVYQK G
Sbjct  201  HYCDKCGLTYVYQKAG  216



>gb|KFK44432.1| hypothetical protein AALP_AA1G255700 [Arabis alpina]
Length=156

 Score =   206 bits (524),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYSIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK+KHKHKKVKLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKLKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQK  403
            HYCGKCG TYV++K
Sbjct  139  HYCGKCGTTYVFKK  152



>ref|XP_006349858.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
tuberosum]
Length=181

 Score =   206 bits (525),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYCGK  376
            HYCGK
Sbjct  139  HYCGK  143



>ref|XP_007051235.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|EOX95392.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
Length=172

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYC  370
            HYC
Sbjct  139  HYC  141



>ref|XP_007514688.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14928.1| predicted protein [Bathycoccus prasinos]
Length=169

 Score =   204 bits (518),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG K
Sbjct  35   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGK  94

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKH HKK KL  L+ YKVD++GKV RLRKECP  ECGAG FMANHFDR
Sbjct  95   KRKKKTYTKPKKIKHVHKKNKLGFLKLYKVDDAGKVTRLRKECPAPECGAGVFMANHFDR  154

Query  362  HYCGKCGLTYVYQ  400
            HYCGKCGLTYVY+
Sbjct  155  HYCGKCGLTYVYE  167



>gb|KCW58175.1| hypothetical protein EUGRSUZ_H00892 [Eucalyptus grandis]
Length=145

 Score =   202 bits (515),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR  138

Query  362  HYC  370
            HYC
Sbjct  139  HYC  141



>ref|XP_010552656.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Tarenaya hassleriana]
Length=156

 Score =   203 bits (516),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKH  KKVKLAVLQFYKVD S KVQRLRKECP+  CG GTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHTKKKVKLAVLQFYKVDGSCKVQRLRKECPSVGCGPGTFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKCG TY ++   D
Sbjct  139  HYCGKCGTTYAFKAPAD  155



>gb|AGC65581.1| UBQ5, partial [Agrostis stolonifera]
Length=156

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL+LVLRLRGGAK
Sbjct  20   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLYLVLRLRGGAK  79

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKK YTKPKK +HKHKKVKLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFD
Sbjct  80   KRKKKAYTKPKKQRHKHKKVKLALLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD  139

Query  359  RHYCGKCGLTYVYQK  403
            RHYCGKCGLTYVY +
Sbjct  140  RHYCGKCGLTYVYNQ  154



>gb|KGL79724.1| Ubiquitin-40S ribosomal protein S27a, partial [Tinamus guttatus]
Length=158

 Score =   201 bits (512),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  21   SSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  80

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDR
Sbjct  81   KRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDR  140

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKC LTY + K  D
Sbjct  141  HYCGKCCLTYCFNKPED  157



>gb|KDO86852.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=145

 Score =   201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMA+HFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMASHFDR  138

Query  362  HYC  370
            HYC
Sbjct  139  HYC  141



>ref|XP_010216499.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tinamus guttatus]
Length=156

 Score =   201 bits (511),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDR
Sbjct  79   KRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDR  138

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKC LTY + K  D
Sbjct  139  HYCGKCCLTYCFNKPED  155



>ref|XP_004644620.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
Length=156

 Score =   201 bits (511),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K GD
Sbjct  140  YCGKCCLTYCFNKPGD  155



>gb|KFV78322.1| Ubiquitin-40S ribosomal protein S27a, partial [Struthio camelus 
australis]
Length=140

 Score =   200 bits (509),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  3    SSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  62

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDR
Sbjct  63   KRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDR  122

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKC LTY + K  D
Sbjct  123  HYCGKCCLTYCFNKPED  139



>gb|EHH55578.1| hypothetical protein EGM_04813 [Macaca fascicularis]
Length=156

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGA+K
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAQK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+Y+ PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYSTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_003216177.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Anolis carolinensis]
Length=156

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKV LAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVTLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_009667383.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Struthio camelus 
australis]
Length=192

 Score =   201 bits (512),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  55   SSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  114

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDR
Sbjct  115  KRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDR  174

Query  362  HYCGKCGLTYVYQKGGD  412
            HYCGKC LTY + K  D
Sbjct  175  HYCGKCCLTYCFNKPED  191



>ref|XP_005486911.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Zonotrichia 
albicollis]
Length=190

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  54   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  113

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  114  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  173

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  174  YCGKCCLTYCFNKPED  189



>ref|XP_009945702.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Leptosomus discolor]
Length=154

 Score =   199 bits (507),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  18   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  77

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  78   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  137

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  138  YCGKCCLTYCFNKPED  153



>gb|KFP24383.1| Ubiquitin-40S ribosomal protein S27a, partial [Colius striatus]
Length=144

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  8    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  67

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  68   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  127

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  128  YCGKCCLTYCFNKPED  143



>ref|XP_009286758.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Aptenodytes 
forsteri]
Length=144

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  8    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  67

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  68   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  127

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  128  YCGKCCLTYCFNKPED  143



>ref|XP_005513215.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Columba livia]
Length=156

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>gb|KFV68543.1| Ubiquitin-40S ribosomal protein S27a, partial [Picoides pubescens]
Length=157

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  21   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  80

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  81   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  140

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  141  YCGKCCLTYCFNKPED  156



>ref|XP_010146975.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a, partial [Eurypyga helias]
Length=143

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  7    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  66

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  67   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  126

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  127  YCGKCCLTYCFNKPED  142



>ref|NP_990284.1| ubiquitin-40S ribosomal protein S27a [Gallus gallus]
 ref|NP_001274134.1| ubiquitin-40S ribosomal protein S27a [Gallus gallus]
 ref|XP_002199635.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Taeniopygia 
guttata]
 ref|XP_005042727.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Ficedula 
albicollis]
 ref|XP_005144071.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Melopsittacus 
undulatus]
 ref|XP_005299091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chrysemys picta 
bellii]
 ref|XP_005422655.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Geospiza fortis]
 ref|XP_005525525.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pseudopodoces 
humilis]
 ref|XP_006021641.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Alligator sinensis]
 ref|XP_006274498.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Alligator mississippiensis]
 ref|XP_007070121.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chelonia mydas]
 ref|XP_007432077.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Python 
bivittatus]
 ref|XP_007432078.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Python 
bivittatus]
 ref|XP_008491469.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Calypte anna]
 ref|XP_009091973.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Serinus canaria]
 ref|XP_009474412.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nipponia nippon]
 ref|XP_009900360.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Picoides pubescens]
 sp|P79781.3|RS27A_CHICK RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Gallus gallus]
 gb|AAC60279.1| ubiquitin/ribosomal protein [Gallus gallus]
 gb|ADK26674.1| ribosomal protein S27a [Zonotrichia albicollis]
 gb|ADK26767.1| ribosomal protein S27a [Zonotrichia albicollis]
Length=156

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_010283844.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a, partial [Phaethon lepturus]
Length=155

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  19   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  78

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  79   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  138

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  139  YCGKCCLTYCFNKPED  154



>ref|XP_005238671.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Falco peregrinus]
 ref|XP_005445725.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Falco cherrug]
Length=142

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  6    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  65

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  66   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  125

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  126  YCGKCCLTYCFNKPED  141



>emb|CCA70746.1| probable ubiquitin/ribosomal protein S27a fusion protein [Piriformospora 
indica DSM 11827]
Length=158

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKK+KHK KKVK+A+L++YKVD  GK++RLRKECPNAECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRKECPNAECGAGVFMAFHHDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYQFQPG  153



>ref|XP_006122235.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pelodiscus sinensis]
Length=149

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  13   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  72

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  73   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  132

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  133  YCGKCCLTYCFNKPED  148



>gb|KFP00438.1| Ubiquitin-40S ribosomal protein S27a, partial [Calypte anna]
 gb|KFQ92324.1| Ubiquitin-40S ribosomal protein S27a, partial [Nipponia nippon]
Length=160

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  24   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  83

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  84   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  143

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  144  YCGKCCLTYCFNKPED  159



>ref|XP_010194368.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Colius 
striatus]
Length=147

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  11   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  70

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  71   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  130

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  131  YCGKCCLTYCFNKPED  146



>gb|EMC80037.1| 40S ribosomal protein S27a, partial [Columba livia]
Length=160

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  24   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  83

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  84   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  143

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  144  YCGKCCLTYCFNKPED  159



>ref|XP_010401401.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Corvus cornix 
cornix]
Length=153

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  17   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  76

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  77   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  136

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  137  YCGKCCLTYCFNKPED  152



>ref|XP_009480940.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Pelecanus 
crispus]
 ref|XP_009509387.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Phalacrocorax 
carbo]
 ref|XP_009556888.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Cuculus 
canorus]
 ref|XP_009574433.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Fulmarus 
glacialis]
 ref|XP_009814558.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Gavia 
stellata]
 ref|XP_009701052.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Cariama 
cristata]
 ref|XP_009875828.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Apaloderma 
vittatum]
 ref|XP_010011875.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Nestor 
notabilis]
 ref|XP_009978278.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Tauraco 
erythrolophus]
 ref|XP_009960864.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Tyto 
alba]
 ref|XP_010137009.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Buceros 
rhinoceros silvestris]
 ref|XP_010171881.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Caprimulgus 
carolinensis]
 ref|XP_010077283.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Pterocles 
gutturalis]
 ref|XP_010190871.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Mesitornis 
unicolor]
 ref|XP_010115032.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Chlamydotis 
macqueenii]
 ref|XP_010300523.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Balearica 
regulorum gibbericeps]
 gb|KFO04847.1| Ubiquitin-40S ribosomal protein S27a, partial [Balearica regulorum 
gibbericeps]
 gb|KFO65478.1| Ubiquitin-40S ribosomal protein S27a, partial [Corvus brachyrhynchos]
 gb|KFO74445.1| Ubiquitin-40S ribosomal protein S27a, partial [Cuculus canorus]
 gb|KFO91345.1| Ubiquitin-40S ribosomal protein S27a, partial [Buceros rhinoceros 
silvestris]
 gb|KFP59309.1| Ubiquitin-40S ribosomal protein S27a, partial [Cariama cristata]
 gb|KFP79901.1| Ubiquitin-40S ribosomal protein S27a, partial [Apaloderma vittatum]
 gb|KFQ07466.1| Ubiquitin-40S ribosomal protein S27a, partial [Leptosomus discolor]
 gb|KFQ40772.1| Ubiquitin-40S ribosomal protein S27a, partial [Mesitornis unicolor]
 gb|KFQ42387.1| Ubiquitin-40S ribosomal protein S27a, partial [Nestor notabilis]
 gb|KFQ61160.1| Ubiquitin-40S ribosomal protein S27a, partial [Pelecanus crispus]
 gb|KFQ67044.1| Ubiquitin-40S ribosomal protein S27a, partial [Phaethon lepturus]
 gb|KFQ87004.1| Ubiquitin-40S ribosomal protein S27a, partial [Phoenicopterus 
ruber ruber]
 gb|KFR06135.1| Ubiquitin-40S ribosomal protein S27a, partial [Opisthocomus hoazin]
 gb|KFU84604.1| Ubiquitin-40S ribosomal protein S27a, partial [Chaetura pelagica]
 gb|KFU99621.1| Ubiquitin-40S ribosomal protein S27a, partial [Pterocles gutturalis]
 gb|KFV11287.1| Ubiquitin-40S ribosomal protein S27a, partial [Tauraco erythrolophus]
 gb|KFV39162.1| Ubiquitin-40S ribosomal protein S27a, partial [Tyto alba]
 gb|KFV44563.1| Ubiquitin-40S ribosomal protein S27a, partial [Gavia stellata]
 gb|KFV89075.1| Ubiquitin-40S ribosomal protein S27a, partial [Fulmarus glacialis]
 gb|KFV92107.1| Ubiquitin-40S ribosomal protein S27a, partial [Eurypyga helias]
 gb|KFW81760.1| Ubiquitin-40S ribosomal protein S27a, partial [Manacus vitellinus]
 gb|KFW94448.1| Ubiquitin-40S ribosomal protein S27a, partial [Phalacrocorax 
carbo]
 gb|KFZ48189.1| Ubiquitin-40S ribosomal protein S27a, partial [Caprimulgus carolinensis]
 gb|KFZ56250.1| Ubiquitin-40S ribosomal protein S27a, partial [Podiceps cristatus]
 gb|KGL94129.1| Ubiquitin-40S ribosomal protein S27a, partial [Charadrius vociferus]
Length=140

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  4    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  63

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  64   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  123

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  124  YCGKCCLTYCFNKPED  139



>ref|XP_006068942.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
Length=156

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_009929631.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Opisthocomus 
hoazin]
Length=144

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  8    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  67

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  68   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  127

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  128  YCGKCCLTYCFNKPED  143



>gb|EOB01801.1| Ubiquitin, partial [Anas platyrhynchos]
 gb|KFM13706.1| Ubiquitin-40S ribosomal protein S27a, partial [Aptenodytes forsteri]
 gb|KFP47664.1| Ubiquitin-40S ribosomal protein S27a, partial [Cathartes aura]
Length=141

 Score =   198 bits (504),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  5    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  64

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  65   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  124

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  125  YCGKCCLTYCFNKPED  140



>ref|XP_009884369.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Charadrius vociferus]
Length=161

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  25   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  84

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  85   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  144

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  145  YCGKCCLTYCFNKPED  160



>ref|XP_007400915.1| hypothetical protein PHACADRAFT_213544 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM50647.1| hypothetical protein PHACADRAFT_213544 [Phanerochaete carnosa 
HHB-10118-sp]
Length=157

 Score =   199 bits (505),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  17   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  76

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK Y+ PKK+KHK KKVK+A+L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  77   KRKKKQYSTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  136

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  137  QYCGKCGLTYTFQPG  151



>ref|NP_002945.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_777203.1| ubiquitin-40S ribosomal protein S27a [Bos taurus]
 ref|NP_001016172.1| ribosomal protein S27a [Xenopus (Silurana) tropicalis]
 ref|NP_001086065.1| ribosomal protein S27a [Xenopus laevis]
 ref|NP_001129064.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_001166537.1| ubiquitin-40S ribosomal protein S27a [Cavia porcellus]
 ref|NP_001170884.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_001180515.1| 40S ribosomal protein S27a [Macaca mulatta]
 ref|NP_001239157.1| 40S ribosomal protein S27a [Canis lupus familiaris]
 ref|NP_001239528.1| 40S ribosomal protein S27a [Pan troglodytes]
 ref|NP_001271613.1| uncharacterized protein LOC101864869 [Macaca fascicularis]
 ref|XP_001375230.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Monodelphis 
domestica]
 ref|XP_001509244.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ornithorhynchus 
anatinus]
 ref|XP_001496841.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Equus caballus]
 ref|XP_002724420.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryctolagus 
cuniculus]
 ref|XP_002748274.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_002753065.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_002757792.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_003787974.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Otolemur garnettii]
 ref|XP_003830888.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan paniscus]
 ref|XP_003830889.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan paniscus]
 ref|XP_003908711.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Papio anubis]
 ref|XP_003908796.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Papio anubis]
 ref|XP_003949844.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan troglodytes]
 ref|XP_003949845.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan troglodytes]
 ref|XP_003984057.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Felis catus]
 ref|XP_004005993.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ovis aries]
 ref|XP_004029299.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004029300.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004029301.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_004029302.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004284424.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Orcinus orca]
 ref|XP_004322708.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tursiops truncatus]
 ref|XP_004369513.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Trichechus manatus 
latirostris]
 ref|XP_004403712.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Odobenus rosmarus 
divergens]
 ref|XP_004435735.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ceratotherium 
simum simum]
 ref|XP_004462050.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Dasypus novemcinctus]
 ref|XP_004580187.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ochotona princeps]
 ref|XP_004609268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sorex araneus]
 ref|XP_004669012.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Jaculus jaculus]
 ref|XP_004632487.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
 ref|XP_004691463.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Condylura 
cristata]
 ref|XP_004691464.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Condylura 
cristata]
 ref|XP_004775726.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mustela putorius 
furo]
 ref|XP_004806951.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mustela putorius 
furo]
 ref|XP_004889095.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Heterocephalus 
glaber]
 ref|XP_004867330.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Heterocephalus 
glaber]
 ref|XP_005002694.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Cavia 
porcellus]
 ref|XP_005070404.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mesocricetus 
auratus]
 ref|XP_005212615.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Bos 
taurus]
 ref|XP_005322068.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005322069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Ictidomys 
tridecemlineatus]
 ref|XP_005385845.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chinchilla lanigera]
 ref|XP_005575917.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Macaca 
fascicularis]
 ref|XP_005686669.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Capra hircus]
 ref|XP_005884671.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis brandtii]
 ref|XP_005889537.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Bos 
mutus]
 ref|XP_005889538.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Bos 
mutus]
 ref|XP_005968746.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pantholops hodgsonii]
 ref|XP_006108994.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Myotis 
lucifugus]
 ref|XP_006174513.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus ferus]
 ref|XP_006217782.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vicugna pacos]
 ref|XP_006159100.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tupaia chinensis]
 ref|XP_006778654.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis davidii]
 ref|XP_006738706.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006738707.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Leptonychotes weddellii]
 ref|XP_006752156.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Leptonychotes 
weddellii]
 ref|XP_006868070.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Chrysochloris 
asiatica]
 ref|XP_006909658.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pteropus alecto]
 ref|XP_006993251.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Peromyscus maniculatus 
bairdii]
 ref|XP_007075460.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Panthera tigris 
altaica]
 ref|XP_007107112.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Physeter catodon]
 ref|XP_006043311.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
 ref|XP_006071325.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
 ref|XP_007190066.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007465731.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Lipotes vexillifer]
 ref|XP_007532217.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Erinaceus europaeus]
 ref|XP_007532218.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Erinaceus europaeus]
 ref|XP_007636802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cricetulus griseus]
 ref|XP_007936193.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Orycteropus 
afer afer]
 ref|XP_007968797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chlorocebus 
sabaeus]
 ref|XP_008160344.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eptesicus fuscus]
 ref|XP_008577062.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Galeopterus 
variegatus]
 ref|XP_008698096.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ursus maritimus]
 ref|XP_008821230.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nannospalax 
galili]
 ref|XP_008821231.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nannospalax 
galili]
 ref|XP_010331896.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Saimiri boliviensis 
boliviensis]
 ref|XP_010614144.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fukomys damarensis]
 ref|XP_010839969.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Bison bison 
bison]
 ref|XP_010950168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus bactrianus]
 ref|XP_010988045.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus dromedarius]
 ref|XP_011236127.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ailuropoda melanoleuca]
 ref|XP_011362262.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pteropus vampyrus]
 sp|P62979.2|RS27A_HUMAN RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Homo sapiens]
 sp|P62992.2|RS27A_BOVIN RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Bos taurus]
 sp|P62978.2|RS27A_CAVPO RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Cavia porcellus]
 pir||UQHUR7 ubiquitin / ribosomal protein S27a, cytosolic [validated] - human
 pdb|4KZX|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|FF Chain f, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|FF Chain f, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|FF Chain f, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4W23|FF Chain f, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|FF Chain f, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 pdb|4D5L|FF Chain f, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 pdb|4D61|FF Chain f, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 emb|CAA44911.1| ubiquitin [Homo sapiens]
 gb|AAB21188.1| ubiquitin carboxyl extension protein [Homo sapiens]
 dbj|BAA11843.1| ubiquitin extention protein [Cavia porcellus]
 gb|AAC77907.1| ubiquitin-S27a fusion protein [Bos taurus]
 gb|AAH01392.1| Ribosomal protein S27a [Homo sapiens]
 gb|AAH66293.1| Ribosomal protein S27a [Homo sapiens]
 gb|AAH74147.1| MGC81889 protein [Xenopus laevis]
 dbj|BAE01745.1| unnamed protein product [Macaca fascicularis]
 emb|CAJ83451.1| ribosomal protein S27a [Xenopus (Silurana) tropicalis]
 gb|EAX00108.1| ribosomal protein S27a, isoform CRA_c [Homo sapiens]
 gb|EAX00110.1| ribosomal protein S27a, isoform CRA_c [Homo sapiens]
 gb|AAI35494.1| hypothetical protein LOC548926 [Xenopus (Silurana) tropicalis]
 gb|AAI02492.2| Ribosomal protein S27a [Bos taurus]
 dbj|BAG38058.1| unnamed protein product [Homo sapiens]
 gb|ACJ13725.1| epididymis luminal protein 112 [Homo sapiens]
 dbj|BAI47114.1| ribosomal protein S27a [synthetic construct]
 tpg|DAA24675.1| TPA: 40S ribosomal protein S27a [Bos taurus]
 gb|ADQ33198.1| ribosomal protein S27a [synthetic construct]
 gb|EHB05725.1| 40S ribosomal protein S27a [Heterocephalus glaber]
 gb|EHH22128.1| hypothetical protein EGK_05333 [Macaca mulatta]
 gb|AIC49655.1| RPS27A, partial [synthetic construct]
 gb|KFO18488.1| Ubiquitin-40S ribosomal protein S27a [Fukomys damarensis]
Length=156

 Score =   199 bits (505),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_005018946.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Anas platyrhynchos]
Length=159

 Score =   199 bits (505),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  23   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  82

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  83   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  142

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  143  YCGKCCLTYCFNKPED  158



>gb|AAA36788.1| pro-ubiquitin, partial [Homo sapiens]
Length=152

 Score =   198 bits (504),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  16   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  75

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  76   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  135

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  136  YCGKCCLTYCFNKPED  151



>gb|AAA57047.1| ubiquitin, partial [synthetic construct]
Length=157

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_008640291.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Corvus brachyrhynchos]
Length=159

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  23   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  82

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  83   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  142

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  143  YCGKCCLTYCFNKPED  158



>ref|XP_007400913.1| hypothetical protein PHACADRAFT_264025 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM50644.1| hypothetical protein PHACADRAFT_264025 [Phanerochaete carnosa 
HHB-10118-sp]
Length=159

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK Y+ PKK+KHK KKVK+A+L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKQYSTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>gb|AAH53371.1| Ribosomal protein S27a [Homo sapiens]
Length=156

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+ T PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_006001599.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Latimeria chalumnae]
Length=156

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPSEECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQK  403
            YCGKC LTY + K
Sbjct  140  YCGKCCLTYCFNK  152



>ref|XP_008365153.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=180

 Score =   199 bits (506),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIP DQQRLIFA KQLEDG+TLADYNIQKESTLHLVL LRGGAK
Sbjct  43   SSDTIDNVKAKIQDKEGIPWDQQRLIFASKQLEDGQTLADYNIQKESTLHLVLCLRGGAK  102

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHKHK VKLAVLQFYKVD+  KVQRLRK+C NA+CGAGTFMANHF+R
Sbjct  103  KRKKKTYTKPKKIKHKHKTVKLAVLQFYKVDDFDKVQRLRKKCLNAKCGAGTFMANHFNR  162

Query  362  HYCGKCGLTYVYQKGG  409
            HYCGKCGLTYVYQK G
Sbjct  163  HYCGKCGLTYVYQKAG  178



>gb|EGN96831.1| hypothetical protein SERLA73DRAFT_185014 [Serpula lacrymans var. 
lacrymans S7.3]
Length=159

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHNDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>gb|KIO10764.1| hypothetical protein M404DRAFT_20998 [Pisolithus tinctorius Marx 
270]
Length=159

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_011482499.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryzias latipes]
 ref|XP_011482500.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryzias latipes]
Length=156

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCTLTYCFNKPED  155



>gb|ACH71005.1| ribosomal protein S27-3 [Salmo salar]
 gb|ACI66719.1| Ubiquitin [Salmo salar]
 gb|ACN09871.1| Ubiquitin [Salmo salar]
 gb|ACN12218.1| Ubiquitin [Salmo salar]
 gb|ADD37999.1| Ubiquitin [Lepeophtheirus salmonis]
 gb|ADM16009.1| Ubiquitin [Salmo salar]
 emb|CDQ70304.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score =   198 bits (503),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPAEECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_005575916.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Macaca 
fascicularis]
Length=187

 Score =   199 bits (506),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  51   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  110

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  111  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  170

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  171  YCGKCCLTYCFNKPED  186



>ref|XP_008065389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tarsius syrichta]
Length=156

 Score =   198 bits (503),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQK  403
            YCGKC LTY + K
Sbjct  140  YCGKCCLTYCFNK  152



>ref|XP_007343921.1| ubiquitin-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD47990.1| ubiquitin-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=159

 Score =   198 bits (503),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY+ PKKIKHK KKVK+A+L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYSTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPSAECGAGVFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYQFQPG  153



>ref|XP_002733357.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Saccoglossus 
kowalevskii]
Length=157

 Score =   198 bits (503),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKKT+T PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECPN +CGAG FMA+HFDR 
Sbjct  80   RKKKTFTTPKKTKHKKKKVKLAVLKYYKVDENGKITRLRRECPNEDCGAGVFMASHFDRQ  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTYV+ K  D
Sbjct  140  YCGKCCLTYVFNKPED  155



>ref|XP_008923123.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Manacus vitellinus]
Length=188

 Score =   199 bits (506),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  52   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  111

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  112  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  171

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  172  YCGKCCLTYCFNKPED  187



>ref|XP_010573169.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Haliaeetus leucocephalus]
Length=156

 Score =   198 bits (503),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_010003219.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chaetura pelagica]
Length=240

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  104  SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  163

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  164  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  223

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  224  YCGKCCLTYCFNKPED  239



>ref|XP_010704696.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Meleagris gallopavo]
Length=212

 Score =   200 bits (508),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  76   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  135

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  136  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  195

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  196  YCGKCCLTYCFNKPED  211



>gb|KIM34102.1| hypothetical protein M408DRAFT_19058 [Serendipita vermifera MAFF 
305830]
Length=163

 Score =   198 bits (503),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  23   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  82

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKK+KHK KKVK+A+L++YKVD  GK++RLRKECPNAECGAG FMA H DR
Sbjct  83   KRKKKTYNTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRKECPNAECGAGVFMAFHHDR  142

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +  G
Sbjct  143  QYCGKCGLTYQFAPG  157



>ref|XP_009549036.1| hypothetical protein HETIRDRAFT_441019 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW78722.1| hypothetical protein HETIRDRAFT_441019 [Heterobasidion irregulare 
TC 32-1]
Length=159

 Score =   198 bits (503),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+A+L++YKV+  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMAILKYYKVESDGKIKRLRRECPSAECGAGVFMAFHHDR  138

Query  362  HYCGKCGLTYVYQKGG  409
             YCGKCGLTY +Q G 
Sbjct  139  QYCGKCGLTYTFQPGA  154



>ref|XP_009317915.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pygoscelis adeliae]
Length=142

 Score =   197 bits (501),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  6    SDTIENVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  65

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  66   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  125

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  126  YCGKCCLTYCFNKPED  141



>ref|XP_007304445.1| ubiquitin/40s ribosomal protein S27a fusion [Stereum hirsutum 
FP-91666 SS1]
 gb|EIM86820.1| ubiquitin/40s ribosomal protein S27a fusion [Stereum hirsutum 
FP-91666 SS1]
Length=159

 Score =   198 bits (503),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+A+L++YKV+  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMAILKYYKVESDGKIKRLRRECPSAECGAGVFMAFHHDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_010595590.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Loxodonta africana]
Length=149

 Score =   197 bits (501),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  13   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  72

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  73   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  132

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  133  YCGKCCLTYCFNKPED  148



>ref|XP_009926111.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Haliaeetus 
albicilla]
 gb|KFP09598.1| Ubiquitin-40S ribosomal protein S27a, partial [Egretta garzetta]
Length=140

 Score =   197 bits (501),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  4    SDTIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  63

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  64   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  123

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  124  YCGKCCLTYCFNKPED  139



>ref|XP_007865027.1| ubiquitin-domain-containing protein [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ56264.1| ubiquitin-domain-containing protein [Gloeophyllum trabeum ATCC 
11539]
Length=159

 Score =   197 bits (502),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK++RLR+ECP AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPAAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>emb|CCO31835.1| Ubiquitin-40S ribosomal protein S27a AltName: Full=Ubiquitin 
carboxyl extension protein 80 [Rhizoctonia solani AG-1 IB]
 emb|CEL63024.1| Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A 
PE=2 SV=3 [Rhizoctonia solani AG-1 IB]
Length=159

 Score =   197 bits (502),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+A+L++YKVD  GK++RLR+ECPN+ECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMAILKYYKVDSDGKIKRLRRECPNSECGAGIFMAFHSDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +  G
Sbjct  139  QYCGKCGLTYTFAPG  153



>gb|ACO51599.1| Ubiquitin [Rana catesbeiana]
Length=156

 Score =   197 bits (502),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKPYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>gb|AGO97083.1| ubiquitin, partial [Cymbidium faberi]
Length=140

 Score =   197 bits (500),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKKIKHK KKVKLAVLQFYKVD+SGK+ RLRKECPNAECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKMARLRKECPNAECGAGTFMANHFDR  138

Query  362  HY  367
            HY
Sbjct  139  HY  140



>gb|KDQ26602.1| hypothetical protein PLEOSDRAFT_1113129 [Pleurotus ostreatus 
PC15]
Length=159

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHNDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_003758323.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sarcophilus 
harrisii]
Length=228

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  92   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  151

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  152  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  211

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  212  YCGKCCLTYCFNKPED  227



>gb|KIP07142.1| hypothetical protein PHLGIDRAFT_106094 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=159

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK Y+ PKKIKHK K VK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKQYSTPKKIKHKRKPVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYQFQPG  153



>gb|KFP93009.1| Ubiquitin-40S ribosomal protein S27a, partial [Haliaeetus albicilla]
Length=141

 Score =   197 bits (500),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  5    SDTIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  64

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  65   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  124

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  125  YCGKCCLTYCFNKPED  140



>gb|KIY63590.1| ubiquitin-domain-containing protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=159

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_004396839.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Odobenus 
rosmarus divergens]
Length=156

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRG AKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGDAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>gb|AAM27203.1|AF502248_1 40s ribosomal protein S27a [Epinephelus coioides]
Length=156

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>gb|KDQ61543.1| hypothetical protein JAAARDRAFT_30995 [Jaapia argillacea MUCL 
33604]
Length=159

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|NP_956796.1| ubiquitin-40S ribosomal protein S27a [Danio rerio]
 ref|NP_001187222.1| ubiquitin-40S ribosomal protein S27a [Ictalurus punctatus]
 ref|XP_003455526.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oreochromis 
niloticus]
 ref|XP_003963790.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Takifugu 
rubripes]
 ref|XP_004575832.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Maylandia 
zebra]
 ref|XP_005743613.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Pundamilia 
nyererei]
 ref|XP_005812668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Xiphophorus 
maculatus]
 ref|XP_005945885.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Haplochromis 
burtoni]
 ref|XP_006638483.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Lepisosteus 
oculatus]
 ref|XP_006806933.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Neolamprologus brichardi]
 ref|XP_006806934.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Neolamprologus brichardi]
 ref|XP_007230176.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Astyanax mexicanus]
 ref|XP_007577064.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia formosa]
 ref|XP_008286554.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Stegastes partitus]
 ref|XP_008319624.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cynoglossus 
semilaevis]
 ref|XP_008428691.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia reticulata]
 ref|XP_010748172.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Larimichthys 
crocea]
 ref|XP_010790874.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Notothenia coriiceps]
 ref|XP_010868135.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Esox lucius]
 sp|P68200.2|RS27A_ICTPU RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Ictalurus punctatus]
 gb|AAK95212.1|AF402838_1 40S ribosomal protein S27a [Ictalurus punctatus]
 gb|AAH55524.1| Zgc:66168 [Danio rerio]
 dbj|BAF45917.1| ribosomal protein S27a [Solea senegalensis]
 gb|ACA05172.1| ribosomal protein S27a [Oncorhynchus masou formosanus]
 gb|AAI64449.1| Zgc:66168 protein [Danio rerio]
 gb|ACM08345.1| Ubiquitin [Salmo salar]
 gb|ACO09845.1| Ubiquitin [Osmerus mordax]
 gb|ACQ58277.1| Ubiquitin [Anoplopoma fimbria]
 gb|ADM64585.1| ribosomal protein S27a [Hypophthalmichthys nobilis]
 emb|CDQ88274.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>gb|KIM90371.1| hypothetical protein PILCRDRAFT_812107 [Piloderma croceum F 1598]
Length=159

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPTAECGAGVFMAFHNDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>gb|KDR80707.1| hypothetical protein GALMADRAFT_241118 [Galerina marginata CBS 
339.88]
 gb|KIM44697.1| hypothetical protein M413DRAFT_442652 [Hebeloma cylindrosporum 
h7]
Length=159

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>gb|KFW64033.1| Ubiquitin-40S ribosomal protein S27a, partial [Pygoscelis adeliae]
Length=141

 Score =   197 bits (500),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  5    SDTIENVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  64

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  65   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  124

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  125  YCGKCCLTYCFNKPED  140



>gb|KIY49962.1| ubiquitin/40s ribosomal protein S27a fusion [Fistulina hepatica 
ATCC 64428]
Length=159

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKK+KHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKVKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHQDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_010376465.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Rhinopithecus 
roxellana]
Length=156

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY   K  D
Sbjct  140  YCGKCCLTYCLNKPED  155



>ref|XP_007771051.1| ubiquitin-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW79409.1| ubiquitin-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
Length=158

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_009235580.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Pongo 
abelii]
Length=210

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  74   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  133

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  134  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  193

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  194  YCGKCCLTYCFNKPED  209



>ref|XP_003032858.1| ubiquitin-40S ribosomal protein S31 fusion protein [Schizophyllum 
commune H4-8]
 gb|EFI97955.1| hypothetical protein SCHCODRAFT_67514 [Schizophyllum commune 
H4-8]
Length=159

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHQDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>sp|P59272.2|RS27A_DAUCA RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor, partial [Daucus carota]
 gb|AAC26159.1| ubiquitin-carboxyl extension [Daucus carota]
Length=143

 Score =   196 bits (499),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/125 (97%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG K
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYTKPKK KHKH+KVKLAVLQFYKVDESGKVQRLRKECPN ECGAGTFMANHFDR
Sbjct  79   KRKKKTYTKPKKTKHKHRKVKLAVLQFYKVDESGKVQRLRKECPNGECGAGTFMANHFDR  138

Query  362  HYCGK  376
            HYCGK
Sbjct  139  HYCGK  143



>gb|ABV58643.1| ubquitin, partial [Catharanthus roseus]
Length=124

 Score =   196 bits (498),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  23   VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkkty  202
            VK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTY
Sbjct  1    VKGKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTY  60

Query  203  tkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCG  382
            TKPKKIKHKHKKVKLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCG
Sbjct  61   TKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCG  120

Query  383  LTYV  394
            LTYV
Sbjct  121  LTYV  124



>gb|KII87325.1| hypothetical protein PLICRDRAFT_42950 [Plicaturopsis crispa FD-325 
SS-3]
Length=159

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KK K+A+L++YKVD  GK++RLR+ECP AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKTKMAILKYYKVDSDGKIKRLRRECPTAECGAGVFMAFHQDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYQFQPG  153



>gb|KFP78128.1| Ubiquitin-40S ribosomal protein S27a, partial [Acanthisitta chloris]
Length=140

 Score =   196 bits (499),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  4    SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  63

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRH
Sbjct  64   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMGSHFDRH  123

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  124  YCGKCCLTYCFNKPED  139



>gb|EMD39293.1| hypothetical protein CERSUDRAFT_112941 [Ceriporiopsis subvermispora 
B]
Length=159

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+A+L++YKV+  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMAILKYYKVESDGKIKRLRRECPSAECGAGIFMAFHEDR  138

Query  362  HYCGKCGLTYVYQKGG  409
             YCGKCGLTY +Q G 
Sbjct  139  QYCGKCGLTYTFQPGA  154



>gb|KIM66010.1| hypothetical protein SCLCIDRAFT_1211653 [Scleroderma citrinum 
Foug A]
Length=159

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKK+KHK KKVK+++L++YKVD  GK++RLR+ECP AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKVKHKRKKVKMSILKYYKVDSDGKIKRLRRECPTAECGAGIFMAFHQDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_009070695.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a, partial [Acanthisitta chloris]
Length=153

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  17   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  76

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRH
Sbjct  77   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMGSHFDRH  136

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  137  YCGKCCLTYCFNKPED  152



>ref|XP_003504023.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cricetulus griseus]
Length=156

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC L Y +Q   D
Sbjct  140  YCGKCCLPYCFQNPED  155



>ref|XP_001104764.1| PREDICTED: hypothetical protein LOC709143 [Macaca mulatta]
 ref|XP_005561572.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Macaca fascicularis]
Length=156

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SD I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDMIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_006738708.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X3 [Leptonychotes weddellii]
Length=156

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+H DRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHLDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_006083528.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis lucifugus]
Length=237

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  101  SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  160

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  161  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  220

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  221  YCGKCCLTYCFNKPED  236



>ref|XP_009639081.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Egretta garzetta]
Length=182

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  46   SDTIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  105

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  106  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRH  165

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  166  YCGKCCLTYCFNKPED  181



>ref|NP_077239.1| ubiquitin-40S ribosomal protein S27a precursor [Mus musculus]
 ref|NP_112375.1| ubiquitin-40S ribosomal protein S27a [Rattus norvegicus]
 ref|NP_001029037.1| ubiquitin-40S ribosomal protein S27a precursor [Mus musculus]
 ref|XP_003751469.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Rattus 
norvegicus]
 ref|XP_006221941.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Rattus 
norvegicus]
 ref|XP_011236476.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a-like isoform X1 [Mus musculus]
 sp|P62983.2|RS27A_MOUSE RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Mus musculus]
 sp|P62982.2|RS27A_RAT RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Rattus norvegicus]
 emb|CAA57432.1| fusion protein: ubiquitin (bases 43_513); ribosomal protein S27a 
(bases 217_532) [Rattus norvegicus]
 gb|AAH02108.1| Ribosomal protein S27A [Mus musculus]
 dbj|BAB31357.1| unnamed protein product [Mus musculus]
 gb|AAH58139.1| Ribosomal protein S27a [Rattus norvegicus]
 gb|AAH81446.1| Ribosomal protein S27A [Mus musculus]
 gb|AAH96392.1| Ribosomal protein S27A [Mus musculus]
 gb|EDL23801.1| mCG13441 [Mus musculus]
 gb|EDL26463.1| mCG15222 [Mus musculus]
 gb|EDL98032.1| rCG23287, isoform CRA_a [Rattus norvegicus]
 gb|EDL98033.1| rCG23287, isoform CRA_a [Rattus norvegicus]
Length=156

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_003125184.2| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sus scrofa]
Length=204

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  68   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  127

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  128  RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  187

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  188  YCGKCCLTYCFNKPED  203



>ref|XP_004643097.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
Length=156

 Score =   196 bits (499),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RL +ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLHRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>gb|KIK50599.1| hypothetical protein GYMLUDRAFT_51110 [Gymnopus luxurians FD-317 
M1]
Length=159

 Score =   196 bits (499),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKK+KHK KKVK+A+L++YKVD  GK++RLR+ECP AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKVKHKRKKVKMAILKYYKVDSDGKIKRLRRECPTAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +  G
Sbjct  139  QYCGKCGLTYTFTPG  153



>ref|XP_006888789.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=156

 Score =   196 bits (498),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HF RH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFHRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>gb|AAA74960.1| ribosomal protein-linked ubiquitin [Oryza sativa]
Length=155

 Score =   196 bits (498),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            S  TIDNVKAKIQDKEGIPPDQQR IFAGKQLEDGRTLADYNIQKESTLH VLRLRGGAK
Sbjct  19   SRHTIDNVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLADYNIQKESTLHHVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFD  358
            KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVD+ +GKV RLRKECPN +CGAGTFMANHFD
Sbjct  79   KRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNHDCGAGTFMANHFD  138

Query  359  RHYCGKCGLTYVYQK  403
            RHYC KC LTYVY +
Sbjct  139  RHYCRKCRLTYVYNQ  153



>gb|KIK48311.1| hypothetical protein CY34DRAFT_705963 [Suillus luteus UH-Slu-Lm8-n1]
Length=159

 Score =   196 bits (498),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECPNAECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPNAECGAGVFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKGG  409
             YCGKC +TY +Q G 
Sbjct  139  QYCGKCHMTYTFQPGA  154



>gb|AAH49478.1| Zgc:66168 protein, partial [Danio rerio]
Length=172

 Score =   196 bits (499),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  36   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  95

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRH
Sbjct  96   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRH  155

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  156  YCGKCCLTYCFNKPED  171



>gb|KIK23888.1| hypothetical protein PISMIDRAFT_678904 [Pisolithus microcarpus 
441]
Length=159

 Score =   196 bits (497),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>ref|XP_002469300.1| ubiquitin/40s ribosomal protein S27a fusion [Postia placenta 
Mad-698-R]
 gb|EED85602.1| ubiquitin/40s ribosomal protein S27a fusion [Postia placenta 
Mad-698-R]
Length=159

 Score =   196 bits (497),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKV+  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVESDGKIKRLRRECPSAECGAGIFMAFHQDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYTFQPG  153



>gb|KIO29915.1| hypothetical protein M407DRAFT_242430 [Tulasnella calospora MUT 
4182]
Length=158

 Score =   196 bits (497),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTYT PK++KHK KKVK+A+L++YKV+  GK++RLR+ECPNA+CGAG FMA H DR
Sbjct  79   KRKKKTYTTPKRVKHKRKKVKMAILKYYKVESDGKIKRLRRECPNADCGAGVFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +Q G
Sbjct  139  QYCGKCGLTYKFQPG  153



>ref|XP_001831329.1| ubiquitin-40S ribosomal protein S31 fusion protein [Coprinopsis 
cinerea okayama7#130]
 gb|EAU90492.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=159

 Score =   196 bits (497),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKK Y+ PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKQYSTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +  G
Sbjct  139  QYCGKCGLTYTFTPG  153



>ref|XP_007855532.1| ubiquitin [Moniliophthora roreri MCA 2997]
 gb|ESK85162.1| ubiquitin [Moniliophthora roreri MCA 2997]
Length=159

 Score =   196 bits (497),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +  G
Sbjct  139  QYCGKCGLTYTFTPG  153



>ref|XP_004411170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Odobenus 
rosmarus divergens]
Length=156

 Score =   195 bits (496),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGI PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGISPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_004092958.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a [Nomascus leucogenys]
Length=156

 Score =   195 bits (496),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkk  184
            SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL +RLRGGAKK
Sbjct  20   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLXVRLRGGAKK  79

Query  185  rkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRH  364
            RKKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH
Sbjct  80   RKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRH  139

Query  365  YCGKCGLTYVYQKGGD  412
            YCGKC LTY + K  D
Sbjct  140  YCGKCCLTYCFNKPED  155



>ref|XP_001874554.1| ubiquitin-40S ribosomal protein S31 fusion protein [Laccaria 
bicolor S238N-H82]
 gb|EDR13995.1| predicted protein [Laccaria bicolor S238N-H82]
Length=159

 Score =   195 bits (496),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAk  181
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAK
Sbjct  19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  78

Query  182  krkkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDR  361
            KRKKKTY  PKKIKHK KKVK+++L++YKVD  GK++RLR+ECP+AECGAG FMA H DR
Sbjct  79   KRKKKTYNTPKKIKHKRKKVKMSILKYYKVDSDGKIKRLRRECPSAECGAGIFMAFHKDR  138

Query  362  HYCGKCGLTYVYQKG  406
             YCGKCGLTY +  G
Sbjct  139  QYCGKCGLTYTFTPG  153



>ref|XP_006887475.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=156

 Score =   195 bits (496),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  8    DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkr  187
            DTI+NVKAKIQDKEGIPPD+QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKR
Sbjct  21   DTIENVKAKIQDKEGIPPDKQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKR  80

Query  188  kkktytkpkkikhkhkkvkLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHY  367
            KKK+YT PKK KHK KKVKLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHY
Sbjct  81   KKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHY  140

Query  368  CGKCGLTYVYQKGGD  412
            CGKC LTY + K  D
Sbjct  141  CGKCCLTYCFNKPED  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335