BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN016J06

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN70282.1|  hypothetical protein VITISV_023081                     344   1e-115   Vitis vinifera
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    362   5e-115   Glycine soja [wild soybean]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    362   5e-115   Glycine max [soybeans]
ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    361   2e-114   Sesamum indicum [beniseed]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    360   2e-114   Glycine max [soybeans]
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    360   3e-114   Glycine soja [wild soybean]
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             358   2e-113   Phaseolus vulgaris [French bean]
gb|KDP37890.1|  hypothetical protein JCGZ_05772                         357   3e-113   Jatropha curcas
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    357   9e-113   
ref|XP_002518223.1|  receptor protein kinase, putative                  355   2e-112   Ricinus communis
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    354   5e-112   Populus trichocarpa [western balsam poplar]
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    353   9e-112   Populus euphratica
gb|KJB37929.1|  hypothetical protein B456_006G227000                    353   1e-111   Gossypium raimondii
gb|KHG00472.1|  hypothetical protein F383_20103                         350   1e-110   Gossypium arboreum [tree cotton]
emb|CDP14623.1|  unnamed protein product                                350   3e-110   Coffea canephora [robusta coffee]
gb|AES77940.2|  tyrosine kinase family protein                          338   2e-109   Medicago truncatula
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    347   3e-109   Vitis vinifera
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    347   5e-109   Eucalyptus grandis [rose gum]
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    347   6e-109   Medicago truncatula
gb|KDO44075.1|  hypothetical protein CISIN_1g0027171mg                  343   6e-109   Citrus sinensis [apfelsine]
gb|KDO44074.1|  hypothetical protein CISIN_1g0027171mg                  343   8e-109   Citrus sinensis [apfelsine]
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    345   2e-108   Cicer arietinum [garbanzo]
ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...    343   2e-108   
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    345   2e-108   
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                343   2e-108   Erythranthe guttata [common monkey flower]
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    344   3e-108   Pyrus x bretschneideri [bai li]
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    343   8e-108   Nicotiana tomentosiformis
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             343   1e-107   Citrus clementina [clementine]
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    343   1e-107   Citrus sinensis [apfelsine]
ref|XP_003621722.1|  Receptor-like kinase                               338   2e-107   
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    342   2e-107   Solanum tuberosum [potatoes]
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    342   2e-107   Solanum lycopersicum
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    341   4e-107   Nicotiana sylvestris
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             340   7e-107   
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    340   2e-106   Fragaria vesca subsp. vesca
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    339   2e-106   Malus domestica [apple tree]
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    339   3e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003621710.1|  Receptor-like protein kinase                       338   1e-105   
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    337   2e-105   
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    336   3e-105   Nelumbo nucifera [Indian lotus]
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    333   6e-104   Populus euphratica
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    332   1e-103   Prunus mume [ume]
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    330   7e-103   Cucumis sativus [cucumbers]
ref|XP_004156987.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    329   1e-102   
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    329   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    329   2e-102   Cucumis melo [Oriental melon]
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...    326   3e-101   Elaeis guineensis
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    320   3e-99    
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    313   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...    313   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    311   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    310   2e-95    Tarenaya hassleriana [spider flower]
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    310   3e-95    Tarenaya hassleriana [spider flower]
ref|NP_001045445.1|  Os01g0957100                                       305   6e-94    
dbj|BAB92869.1|  putative receptor-like protein kinase                  305   1e-93    Oryza sativa Japonica Group [Japonica rice]
gb|EAY77289.1|  hypothetical protein OsI_05265                          305   2e-93    Oryza sativa Indica Group [Indian rice]
emb|CDX85183.1|  BnaC07g24940D                                          303   2e-93    
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    302   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    302   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    302   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    300   1e-91    Brassica rapa
emb|CDY20032.1|  BnaA09g02190D                                          299   2e-91    Brassica napus [oilseed rape]
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    299   2e-91    Arabis alpina [alpine rockcress]
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    299   4e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    298   8e-91    Brassica rapa
gb|EPS70115.1|  hypothetical protein M569_04636                         297   1e-90    Genlisea aurea
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             297   1e-90    Capsella rubella
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             295   6e-90    
emb|CDY00141.1|  BnaC09g01600D                                          294   2e-89    
ref|XP_006646695.1|  PREDICTED: probably inactive leucine-rich re...    291   1e-88    Oryza brachyantha
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             290   5e-88    Eutrema salsugineum [saltwater cress]
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...    282   7e-85    Setaria italica
dbj|BAF79960.1|  receptor-like kinase                                   263   4e-78    Marchantia polymorpha
ref|XP_001769840.1|  predicted protein                                  261   1e-77    
ref|XP_001771841.1|  predicted protein                                  259   5e-77    
ref|NP_001136621.1|  uncharacterized protein LOC100216746               247   3e-76    
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350          257   5e-76    
ref|XP_006840189.1|  hypothetical protein AMTR_s00089p00108500          256   1e-75    
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...    248   1e-72    Zea mays [maize]
ref|XP_006842493.1|  hypothetical protein AMTR_s00077p00091370          247   2e-72    Amborella trichopoda
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...    247   2e-72    Brachypodium distachyon [annual false brome]
gb|ACN33819.1|  unknown                                                 247   2e-72    Zea mays [maize]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...    246   6e-72    
dbj|BAJ85468.1|  predicted protein                                      245   9e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              242   7e-71    Selaginella moellendorffii
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    242   1e-70    Glycine max [soybeans]
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    242   1e-70    Glycine max [soybeans]
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              241   1e-70    
gb|KJB67929.1|  hypothetical protein B456_010G218400                    241   2e-70    Gossypium raimondii
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    241   3e-70    Eucalyptus grandis [rose gum]
gb|KHG03607.1|  hypothetical protein F383_26757                         241   4e-70    Gossypium arboreum [tree cotton]
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    240   6e-70    Cicer arietinum [garbanzo]
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    239   2e-69    
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    238   2e-69    Vitis vinifera
ref|XP_002520879.1|  ATP binding protein, putative                      238   2e-69    Ricinus communis
gb|KJB73018.1|  hypothetical protein B456_011G209800                    238   2e-69    Gossypium raimondii
ref|XP_004173628.1|  PREDICTED: probably inactive leucine-rich re...    236   2e-69    
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    238   2e-69    Sesamum indicum [beniseed]
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    238   3e-69    Populus euphratica
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    238   3e-69    
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             238   4e-69    Phaseolus vulgaris [French bean]
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    238   4e-69    Sesamum indicum [beniseed]
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    237   5e-69    Sesamum indicum [beniseed]
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    237   5e-69    Nicotiana tomentosiformis
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    236   6e-69    Nicotiana sylvestris
gb|KHG09451.1|  hypothetical protein F383_09289                         237   6e-69    Gossypium arboreum [tree cotton]
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    237   6e-69    Fragaria vesca subsp. vesca
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    237   7e-69    Nelumbo nucifera [Indian lotus]
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    236   8e-69    Cucumis sativus [cucumbers]
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    236   9e-69    Solanum tuberosum [potatoes]
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    236   9e-69    Prunus mume [ume]
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    236   1e-68    Nicotiana sylvestris
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    236   1e-68    Pyrus x bretschneideri [bai li]
gb|KDP21644.1|  hypothetical protein JCGZ_03315                         236   1e-68    Jatropha curcas
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    236   1e-68    Solanum lycopersicum
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    236   1e-68    Pyrus x bretschneideri [bai li]
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             236   1e-68    
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        236   2e-68    Medicago truncatula
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    236   2e-68    Pyrus x bretschneideri [bai li]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    235   2e-68    
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    235   3e-68    
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    234   4e-68    Solanum lycopersicum
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    234   4e-68    Populus euphratica
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    234   4e-68    Populus trichocarpa [western balsam poplar]
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    234   4e-68    Populus euphratica
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    234   5e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             234   8e-68    
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    234   8e-68    Citrus sinensis [apfelsine]
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    233   9e-68    Cucumis melo [Oriental melon]
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    233   1e-67    Solanum tuberosum [potatoes]
gb|KDP21865.1|  hypothetical protein JCGZ_00652                         229   1e-67    Jatropha curcas
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    233   1e-67    Cucumis melo [Oriental melon]
ref|XP_004173348.1|  PREDICTED: probably inactive leucine-rich re...    233   1e-67    
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    233   1e-67    Cucumis sativus [cucumbers]
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    233   1e-67    Morus notabilis
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    233   2e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    233   2e-67    Pyrus x bretschneideri [bai li]
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             232   3e-67    Prunus persica
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    232   5e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    231   5e-67    Nelumbo nucifera [Indian lotus]
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    231   7e-67    Vitis vinifera
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    231   9e-67    Morus notabilis
gb|EEE55595.1|  hypothetical protein OsJ_03900                          227   1e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    230   1e-66    Prunus mume [ume]
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    230   2e-66    Tarenaya hassleriana [spider flower]
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             230   2e-66    
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    230   2e-66    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    230   2e-66    Citrus sinensis [apfelsine]
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    230   2e-66    Nicotiana tomentosiformis
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   229   2e-66    Citrus sinensis [apfelsine]
ref|XP_009416322.1|  PREDICTED: probably inactive leucine-rich re...    229   3e-66    
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    229   3e-66    Ricinus communis
ref|XP_008359946.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    232   3e-66    
gb|EAY76307.1|  hypothetical protein OsI_04242                          229   4e-66    Oryza sativa Indica Group [Indian rice]
ref|NP_001044651.1|  Os01g0821900                                       227   6e-66    
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189             228   1e-65    
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    228   1e-65    
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                228   1e-65    Erythranthe guttata [common monkey flower]
ref|NP_001142419.1|  uncharacterized protein LOC100274594               221   1e-65    
dbj|BAB85306.1|  putative receptor-like protein kinase                  227   1e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    227   2e-65    Fragaria vesca subsp. vesca
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    227   2e-65    Nicotiana sylvestris
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    227   2e-65    Populus euphratica
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             227   2e-65    Populus trichocarpa [western balsam poplar]
gb|KHN40633.1|  Probably inactive leucine-rich repeat receptor-li...    223   3e-65    Glycine soja [wild soybean]
ref|XP_006644919.1|  PREDICTED: probably inactive leucine-rich re...    226   3e-65    Oryza brachyantha
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             226   6e-65    Arabidopsis lyrata subsp. lyrata
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             225   7e-65    
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    225   7e-65    Eucalyptus grandis [rose gum]
ref|XP_010938277.1|  PREDICTED: probably inactive leucine-rich re...    223   9e-65    
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    225   9e-65    Solanum lycopersicum
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240          225   1e-64    Sorghum bicolor [broomcorn]
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    225   1e-64    Brassica rapa
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                225   1e-64    Erythranthe guttata [common monkey flower]
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    225   1e-64    Setaria italica
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...    224   2e-64    Oryza brachyantha
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...    224   2e-64    Setaria italica
emb|CAN76686.1|  hypothetical protein VITISV_005469                     208   2e-64    Vitis vinifera
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             224   2e-64    
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       224   2e-64    Arabidopsis thaliana [mouse-ear cress]
gb|AAL49790.1|  unknown protein                                         224   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             224   2e-64    Capsella rubella
emb|CDX72142.1|  BnaC08g27320D                                          224   2e-64    
emb|CDY27220.1|  BnaA09g35820D                                          224   3e-64    Brassica napus [oilseed rape]
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    223   4e-64    Solanum tuberosum [potatoes]
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    223   4e-64    
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          223   4e-64    Sorghum bicolor [broomcorn]
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    223   5e-64    Camelina sativa [gold-of-pleasure]
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    223   6e-64    Populus euphratica
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    223   6e-64    Populus euphratica
gb|EPS70735.1|  hypothetical protein M569_04020                         223   6e-64    Genlisea aurea
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    223   8e-64    Cicer arietinum [garbanzo]
dbj|BAK06250.1|  predicted protein                                      222   9e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC75203.1|  hypothetical protein OsI_11455                          222   1e-63    Oryza sativa Indica Group [Indian rice]
ref|NP_001050035.1|  Os03g0335500                                       222   1e-63    
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          222   1e-63    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...    222   1e-63    
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             222   2e-63    Eutrema salsugineum [saltwater cress]
gb|AES79844.2|  LRR receptor-like kinase family protein                 221   2e-63    Medicago truncatula
ref|XP_003623626.1|  Receptor-like protein kinase                       221   3e-63    
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       221   3e-63    Arabis alpina [alpine rockcress]
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    223   3e-63    
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    221   3e-63    
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    221   3e-63    Glycine max [soybeans]
ref|XP_007134722.1|  hypothetical protein PHAVU_010G070400g             219   4e-63    Phaseolus vulgaris [French bean]
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    221   4e-63    Arabis alpina [alpine rockcress]
ref|NP_001159235.1|  uncharacterized protein LOC100304322               209   4e-63    
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    220   4e-63    
gb|EMT15869.1|  Putative LRR receptor-like serine/threonine-prote...    220   5e-63    
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             220   5e-63    
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    220   5e-63    Cucumis sativus [cucumbers]
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    220   5e-63    Cucumis melo [Oriental melon]
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...    220   7e-63    
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...    220   7e-63    
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    219   8e-63    
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...    219   9e-63    
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             219   1e-62    Capsella rubella
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             219   1e-62    Phaseolus vulgaris [French bean]
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             219   1e-62    Phaseolus vulgaris [French bean]
ref|XP_002509644.1|  leucine-rich repeat transmembrane protein ki...    218   2e-62    Ricinus communis
gb|KHM99411.1|  Probably inactive leucine-rich repeat receptor-li...    218   2e-62    Glycine soja [wild soybean]
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    219   2e-62    Glycine soja [wild soybean]
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             219   2e-62    Eutrema salsugineum [saltwater cress]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    219   2e-62    Glycine max [soybeans]
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    218   3e-62    
emb|CDY04822.1|  BnaAnng00040D                                          218   3e-62    
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...    218   4e-62    Brassica rapa
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    218   4e-62    Glycine max [soybeans]
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             217   6e-62    Arabidopsis thaliana [mouse-ear cress]
gb|AAF88073.1|AC025417_1  T12C24.1                                      203   9e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    217   9e-62    Brachypodium distachyon [annual false brome]
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    217   1e-61    Phoenix dactylifera
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    217   1e-61    Elaeis guineensis
gb|KJB25688.1|  hypothetical protein B456_004G204100                    216   1e-61    Gossypium raimondii
gb|KHF98277.1|  hypothetical protein F383_15451                         216   1e-61    Gossypium arboreum [tree cotton]
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    216   2e-61    Elaeis guineensis
ref|XP_006440456.1|  hypothetical protein CICLE_v10018802mg             215   3e-61    Citrus clementina [clementine]
gb|KDO63698.1|  hypothetical protein CISIN_1g002759mg                   215   3e-61    Citrus sinensis [apfelsine]
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    215   3e-61    
ref|XP_006477322.1|  PREDICTED: probable LRR receptor-like serine...    215   3e-61    Citrus sinensis [apfelsine]
gb|KJB71525.1|  hypothetical protein B456_011G127000                    215   4e-61    Gossypium raimondii
emb|CBI25352.3|  unnamed protein product                                214   5e-61    Vitis vinifera
ref|XP_008448931.1|  PREDICTED: probable LRR receptor-like serine...    214   5e-61    Cucumis melo [Oriental melon]
ref|XP_007040033.1|  Leucine-rich repeat protein kinase family pr...    211   9e-61    
ref|XP_006655414.1|  PREDICTED: probably inactive leucine-rich re...    213   1e-60    Oryza brachyantha
ref|XP_004147984.1|  PREDICTED: probable LRR receptor-like serine...    213   1e-60    Cucumis sativus [cucumbers]
ref|XP_004170853.1|  PREDICTED: probable LRR receptor-like serine...    213   1e-60    
ref|XP_010108089.1|  putative LRR receptor-like serine/threonine-...    213   2e-60    Morus notabilis
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    212   3e-60    
ref|XP_004298715.1|  PREDICTED: probable LRR receptor-like serine...    212   3e-60    Fragaria vesca subsp. vesca
ref|XP_007040030.1|  Leucine-rich repeat protein kinase family pr...    211   5e-60    
ref|XP_007040031.1|  Leucine-rich repeat protein kinase family pr...    211   5e-60    
emb|CBI23559.3|  unnamed protein product                                206   5e-60    Vitis vinifera
ref|XP_010546137.1|  PREDICTED: probable LRR receptor-like serine...    211   7e-60    
gb|ACO55044.1|  receptor-like kinase                                    196   7e-60    Triticum aestivum [Canadian hard winter wheat]
gb|KHG18414.1|  hypothetical protein F383_21876                         211   9e-60    Gossypium arboreum [tree cotton]
ref|XP_003605286.1|  Receptor-like protein kinase                       209   2e-59    Medicago truncatula
emb|CAE54285.1|  receptor-like kinase with LRR repeats                  195   2e-59    Triticum aestivum [Canadian hard winter wheat]
gb|KDP25570.1|  hypothetical protein JCGZ_20726                         209   3e-59    Jatropha curcas
ref|XP_002303543.1|  leucine-rich repeat transmembrane protein ki...    209   3e-59    
gb|KJB51988.1|  hypothetical protein B456_008G241300                    209   3e-59    Gossypium raimondii
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    209   4e-59    
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    209   5e-59    Brachypodium distachyon [annual false brome]
ref|XP_002991210.1|  hypothetical protein SELMODRAFT_236225             208   7e-59    
ref|XP_011015430.1|  PREDICTED: probable LRR receptor-like serine...    208   8e-59    Populus euphratica
ref|XP_011033860.1|  PREDICTED: probable LRR receptor-like serine...    208   9e-59    Populus euphratica
ref|XP_009373339.1|  PREDICTED: probable LRR receptor-like serine...    208   1e-58    Pyrus x bretschneideri [bai li]
ref|XP_002991272.1|  hypothetical protein SELMODRAFT_236241             207   1e-58    
ref|XP_002299581.2|  leucine-rich repeat transmembrane protein ki...    208   1e-58    
emb|CDP09856.1|  unnamed protein product                                207   1e-58    Coffea canephora [robusta coffee]
ref|XP_008373864.1|  PREDICTED: probable LRR receptor-like serine...    207   1e-58    
ref|XP_010276110.1|  PREDICTED: probable LRR receptor-like serine...    207   2e-58    Nelumbo nucifera [Indian lotus]
ref|XP_008238681.1|  PREDICTED: probable LRR receptor-like serine...    206   3e-58    Prunus mume [ume]
ref|XP_007210377.1|  hypothetical protein PRUPE_ppa001194mg             206   3e-58    Prunus persica
ref|XP_009400469.1|  PREDICTED: probable LRR receptor-like serine...    206   3e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008361939.1|  PREDICTED: probable LRR receptor-like serine...    206   5e-58    
ref|XP_011029116.1|  PREDICTED: probable LRR receptor-like serine...    206   6e-58    Populus euphratica
ref|XP_002275029.3|  PREDICTED: probable LRR receptor-like serine...    206   6e-58    Vitis vinifera
ref|XP_010933925.1|  PREDICTED: probable LRR receptor-like serine...    206   6e-58    Elaeis guineensis
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    206   7e-58    
dbj|BAH20406.1|  AT1G12460                                              202   2e-57    
ref|XP_008803301.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-57    
ref|NP_001048834.1|  Os03g0127700                                       204   2e-57    
gb|EAY88364.1|  hypothetical protein OsI_09819                          204   2e-57    
ref|XP_011015709.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-57    
ref|XP_004245688.1|  PREDICTED: probable LRR receptor-like serine...    203   3e-57    
ref|XP_009804678.1|  PREDICTED: probable LRR receptor-like serine...    203   4e-57    
ref|XP_009626686.1|  PREDICTED: probable LRR receptor-like serine...    203   4e-57    
ref|XP_006651000.1|  PREDICTED: probable LRR receptor-like serine...    202   5e-57    
ref|XP_010676626.1|  PREDICTED: probable LRR receptor-like serine...    203   6e-57    
ref|XP_010462668.1|  PREDICTED: probable LRR receptor-like serine...    203   7e-57    
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480          203   8e-57    
ref|XP_006363743.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    202   9e-57    
ref|XP_010476218.1|  PREDICTED: probable LRR receptor-like serine...    202   1e-56    
ref|XP_010919178.1|  PREDICTED: probable LRR receptor-like serine...    202   1e-56    
ref|XP_011071078.1|  PREDICTED: probable LRR receptor-like serine...    202   1e-56    
gb|AAO22764.1|  putative leucine-rich repeat transmembrane protei...    202   1e-56    
ref|NP_172708.1|  putative LRR receptor-like serine/threonine-pro...    202   1e-56    
gb|KFK43514.1|  hypothetical protein AALP_AA1G135400                    201   2e-56    
gb|AAF79640.1|AC025416_14  F5O11.21                                     201   2e-56    
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    202   3e-56    
ref|XP_003538720.1|  PREDICTED: probable LRR receptor-like serine...    201   4e-56    
ref|XP_004511633.1|  PREDICTED: probable LRR receptor-like serine...    200   5e-56    
ref|XP_006303147.1|  hypothetical protein CARUB_v10008271mg             200   6e-56    
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...    199   1e-55    
ref|XP_006391803.1|  hypothetical protein EUTSA_v10023252mg             199   1e-55    
ref|XP_009389657.1|  PREDICTED: probable LRR receptor-like serine...    199   2e-55    
ref|XP_002889936.1|  hypothetical protein ARALYDRAFT_888571             199   2e-55    
ref|XP_008780314.1|  PREDICTED: probable LRR receptor-like serine...    198   2e-55    
ref|XP_010494199.1|  PREDICTED: probable LRR receptor-like serine...    198   3e-55    
ref|XP_010053385.1|  PREDICTED: probable LRR receptor-like serine...    198   3e-55    
ref|XP_006573744.1|  PREDICTED: probable LRR receptor-like serine...    198   3e-55    
ref|XP_002887991.1|  hypothetical protein ARALYDRAFT_475059             198   4e-55    
ref|XP_003516680.1|  PREDICTED: probable LRR receptor-like serine...    197   4e-55    
gb|KHN42733.1|  Putative LRR receptor-like serine/threonine-prote...    197   4e-55    
ref|XP_007158425.1|  hypothetical protein PHAVU_002G152100g             197   7e-55    
ref|XP_003611204.1|  Protein kinase like protein                        196   1e-54    
gb|AES94162.2|  LRR receptor-like kinase family protein                 196   1e-54    
ref|XP_003562151.1|  PREDICTED: probable LRR receptor-like serine...    196   2e-54    
emb|CDP13903.1|  unnamed protein product                                196   2e-54    
gb|EMT17457.1|  Putative LRR receptor-like serine/threonine-prote...    195   2e-54    
gb|EEE64100.1|  hypothetical protein OsJ_18931                          195   3e-54    
dbj|BAE98888.1|  protein kinase like protein                            195   3e-54    
ref|NP_001055847.2|  Os05g0478300                                       195   4e-54    
ref|NP_176483.1|  putative leucine-rich repeat transmembrane prot...    195   4e-54    
ref|XP_001759642.1|  predicted protein                                  194   7e-54    
ref|XP_006300607.1|  hypothetical protein CARUB_v10019771mg             194   7e-54    
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...    194   1e-53    
gb|EYU40542.1|  hypothetical protein MIMGU_mgv1a0012872mg               183   1e-53    
dbj|BAJ89617.1|  predicted protein                                      193   1e-53    
dbj|BAK03696.1|  predicted protein                                      192   3e-53    
ref|XP_009148589.1|  PREDICTED: probable LRR receptor-like serine...    192   5e-53    
ref|XP_002468593.1|  hypothetical protein SORBIDRAFT_01g048690          189   4e-52    
ref|XP_004985881.1|  PREDICTED: probable LRR receptor-like serine...    189   6e-52    
emb|CDY30082.1|  BnaC05g09380D                                          187   1e-51    
emb|CDX98061.1|  BnaA06g08120D                                          185   1e-50    
ref|XP_008650433.1|  PREDICTED: probable LRR receptor-like serine...    184   4e-50    
ref|XP_008660543.1|  PREDICTED: probable LRR receptor-like serine...    183   1e-49    
ref|XP_001763904.1|  predicted protein                                  180   4e-49    
emb|CBI18033.3|  unnamed protein product                                180   6e-49    
ref|XP_002526416.1|  serine-threonine protein kinase, plant-type,...    164   7e-47    
ref|XP_006858029.1|  hypothetical protein AMTR_s00069p00201070          172   5e-46    
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    172   8e-46    
gb|KEH16892.1|  leucine-rich receptor-like kinase family protein        162   7e-45    
gb|EMT15187.1|  Putative LRR receptor-like serine/threonine-prote...    160   5e-44    
ref|XP_006662538.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-43    
gb|ABR68656.1|  receptor-like kinase Tg-34                              155   1e-43    
ref|XP_003634589.1|  PREDICTED: receptor-like protein kinase HAIKU2     166   2e-43    
ref|XP_002325963.1|  leucine-rich repeat transmembrane protein ki...    166   2e-43    
ref|XP_010062414.1|  PREDICTED: receptor-like protein kinase HAIKU2     166   2e-43    
gb|EAY79312.1|  hypothetical protein OsI_34439                          164   2e-43    
ref|NP_001176249.1|  Os10g0531700                                       164   2e-43    
ref|XP_001775671.1|  predicted protein                                  164   3e-43    
emb|CDY70210.1|  BnaAnng32980D                                          155   4e-43    
gb|EEE51301.1|  hypothetical protein OsJ_32252                          164   4e-43    
gb|KCW67550.1|  hypothetical protein EUGRSUZ_F013052                    158   4e-43    
ref|XP_007131311.1|  hypothetical protein PHAVU_011G003200g             165   4e-43    
ref|XP_011031514.1|  PREDICTED: receptor-like protein kinase HAIKU2     165   4e-43    
gb|KCW67582.1|  hypothetical protein EUGRSUZ_F01341                     156   9e-43    
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...    164   1e-42    
ref|XP_006366364.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-42    
gb|KDP33799.1|  hypothetical protein JCGZ_07370                         164   1e-42    
gb|KDP33797.1|  hypothetical protein JCGZ_07368                         162   1e-42    
ref|XP_003621709.1|  Probably inactive leucine-rich repeat recept...    150   2e-42    
ref|XP_008780630.1|  PREDICTED: leucine-rich repeat receptor-like...    152   3e-42    
ref|XP_006349462.1|  PREDICTED: probable LRR receptor-like serine...    157   3e-42    
ref|XP_006349463.1|  PREDICTED: probable LRR receptor-like serine...    157   3e-42    
gb|ADX68910.1|  brassinosteroid-like receptor protein                   153   4e-42    
ref|XP_010327728.1|  PREDICTED: putative serine/threonine-protein...    156   5e-42    
ref|XP_008660516.1|  PREDICTED: leucine-rich repeat receptor-like...    162   5e-42    
gb|KHN38783.1|  Putative LRR receptor-like serine/threonine-prote...    154   5e-42    
emb|CDY42780.1|  BnaC01g22860D                                          152   6e-42    
ref|XP_009803852.1|  PREDICTED: receptor-like protein kinase HSL1       160   6e-42    
gb|KCW71080.1|  hypothetical protein EUGRSUZ_F04179                     161   6e-42    
ref|XP_004249079.1|  PREDICTED: putative serine/threonine-protein...    156   6e-42    
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like             161   6e-42    
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...    161   7e-42    
ref|XP_010247922.1|  PREDICTED: receptor-like protein kinase HSL1       161   7e-42    
ref|XP_010065089.1|  PREDICTED: probable LRR receptor-like serine...    161   1e-41    
ref|XP_007037207.1|  Leucine-rich repeat protein kinase family pr...    157   1e-41    
ref|XP_009379270.1|  PREDICTED: receptor-like protein kinase HAIKU2     161   1e-41    
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-41    
emb|CDX96323.1|  BnaA07g29340D                                          151   1e-41    
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    160   1e-41    
ref|XP_001781606.1|  predicted protein                                  155   1e-41    
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg             160   2e-41    
ref|XP_008361619.1|  PREDICTED: receptor-like protein kinase HAIKU2     160   2e-41    
ref|XP_008339164.1|  PREDICTED: receptor-like protein kinase HAIKU2     160   2e-41    
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...    157   2e-41    
ref|XP_007138216.1|  hypothetical protein PHAVU_009G190400g             157   2e-41    
ref|XP_007138215.1|  hypothetical protein PHAVU_009G190400g             157   2e-41    
ref|XP_009769553.1|  PREDICTED: putative serine/threonine-protein...    154   2e-41    
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g             157   2e-41    
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g             157   3e-41    
emb|CDP06496.1|  unnamed protein product                                154   3e-41    
ref|XP_009362411.1|  PREDICTED: receptor-like protein kinase HSL1       160   3e-41    
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg             157   3e-41    
ref|XP_010112590.1|  LRR receptor-like serine/threonine-protein k...    157   3e-41    
ref|XP_010028759.1|  PREDICTED: LRR receptor-like serine/threonin...    157   3e-41    
ref|NP_001172868.1|  Os02g0232500                                       151   3e-41    
ref|XP_009612243.1|  PREDICTED: putative serine/threonine-protein...    154   4e-41    
ref|XP_006647582.1|  PREDICTED: probable LRR receptor-like serine...    153   4e-41    
gb|ACN59252.1|  leucine-rich repeat receptor-like protein kinase        157   4e-41    
ref|XP_010047253.1|  PREDICTED: LRR receptor-like serine/threonin...    159   5e-41    
emb|CAN70496.1|  hypothetical protein VITISV_042040                     158   5e-41    
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...    159   5e-41    
ref|XP_010047668.1|  PREDICTED: receptor-like protein kinase 5          159   5e-41    
ref|XP_008443549.1|  PREDICTED: cysteine-rich receptor-like prote...    157   5e-41    
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                   159   5e-41    
ref|XP_010911143.1|  PREDICTED: receptor-like protein kinase 5          149   6e-41    
ref|XP_006353616.1|  PREDICTED: receptor-like protein kinase HAIK...    159   6e-41    
ref|XP_008437655.1|  PREDICTED: LRR receptor-like serine/threonin...    156   6e-41    
emb|CBI20149.3|  unnamed protein product                                158   6e-41    
ref|XP_009772662.1|  PREDICTED: putative serine/threonine-protein...    153   7e-41    
ref|XP_004309904.1|  PREDICTED: receptor-like protein kinase HSL1       159   7e-41    
gb|AFS64762.1|  protein kinase                                          151   7e-41    
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...    156   7e-41    
ref|XP_009123510.1|  PREDICTED: LOW QUALITY PROTEIN: putative ser...    153   7e-41    
gb|KHN01094.1|  Receptor-like protein kinase HSL1                       157   7e-41    
gb|EAZ23941.1|  hypothetical protein OsJ_07669                          153   8e-41    
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    158   8e-41    
gb|KCW67604.1|  hypothetical protein EUGRSUZ_F01361                     157   9e-41    
ref|XP_010041838.1|  PREDICTED: probable LRR receptor-like serine...    156   9e-41    
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...    158   9e-41    
ref|XP_010644094.1|  PREDICTED: probable LRR receptor-like serine...    158   9e-41    
ref|XP_010095356.1|  Leucine-rich repeat receptor-like protein ki...    148   9e-41    
gb|KJB41389.1|  hypothetical protein B456_007G102400                    153   9e-41    
ref|XP_001753493.1|  predicted protein                                  151   9e-41    
ref|XP_008390667.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    155   1e-40    
ref|XP_004250411.1|  PREDICTED: receptor-like protein kinase HAIKU2     158   1e-40    
emb|CBI20145.3|  unnamed protein product                                158   1e-40    
ref|XP_004141193.1|  PREDICTED: cysteine-rich receptor-like prote...    155   1e-40    
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...    158   1e-40    
ref|XP_002283477.2|  PREDICTED: probable LRR receptor-like serine...    158   1e-40    
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...    155   1e-40    
emb|CDY68115.1|  BnaC01g42200D                                          146   1e-40    
ref|XP_010103492.1|  Receptor-like protein kinase HSL1                  158   1e-40    
gb|AAF69542.1|AC008007_17  F12M16.30                                    157   1e-40    
ref|XP_010064505.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-40    
gb|KDP31199.1|  hypothetical protein JCGZ_11575                         155   1e-40    
ref|XP_010094305.1|  putative LRR receptor-like serine/threonine-...    152   1e-40    
emb|CBI20153.3|  unnamed protein product                                157   1e-40    
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...    155   2e-40    
ref|XP_002283497.2|  PREDICTED: probable LRR receptor-like serine...    158   2e-40    
ref|XP_010644093.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-40    
gb|AEP14545.1|  clavata 1-like protein                                  157   2e-40    
ref|XP_010277468.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    155   2e-40    
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...    155   2e-40    
ref|XP_002894441.1|  hypothetical protein ARALYDRAFT_474471             157   2e-40    
gb|ACM89476.1|  leucine-rich repeat family protein / protein kina...    155   2e-40    
dbj|BAD94141.1|  leucine-rich repeat receptor-like kinase At1g09970     151   2e-40    
gb|EEC73672.1|  hypothetical protein OsI_08219                          152   2e-40    
ref|XP_010644092.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-40    
gb|KHG18268.1|  LRR receptor-like serine/threonine-protein kinase...    155   2e-40    
ref|XP_002283464.2|  PREDICTED: probable LRR receptor-like serine...    157   2e-40    
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg             155   2e-40    
gb|EEC69150.1|  hypothetical protein OsI_38089                          150   2e-40    
ref|NP_175747.2|  leucine-rich repeat transmembrane protein kinase      157   2e-40    
ref|XP_006370088.1|  hypothetical protein POPTR_0001s39420g             155   2e-40    
ref|XP_006388878.1|  hypothetical protein POPTR_0084s002301g            154   2e-40    
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...    157   3e-40    
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg             155   3e-40    
ref|XP_009628481.1|  PREDICTED: receptor-like protein kinase HAIKU2     157   3e-40    
gb|KDO56537.1|  hypothetical protein CISIN_1g007200mg                   153   3e-40    
emb|CDP14870.1|  unnamed protein product                                154   3e-40    
dbj|BAD25347.1|  receptor ser/thr protein kinase-like                   153   3e-40    
gb|KDO56536.1|  hypothetical protein CISIN_1g007200mg                   153   3e-40    
ref|XP_006432471.1|  hypothetical protein CICLE_v10001146mg             153   3e-40    
gb|AFW70898.1|  putative leucine-rich repeat receptor-like protei...    148   3e-40    
ref|XP_011087842.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    154   3e-40    
ref|NP_001046568.1|  Os02g0283800                                       154   3e-40    
ref|XP_011002772.1|  PREDICTED: probable LRR receptor-like serine...    157   4e-40    
ref|XP_008218929.1|  PREDICTED: receptor-like protein kinase HAIKU2     157   4e-40    
ref|XP_009626619.1|  PREDICTED: putative serine/threonine-protein...    151   4e-40    
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...    154   4e-40    
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...    154   4e-40    
ref|XP_006370084.1|  hypothetical protein POPTR_0001s39390g             157   4e-40    
ref|NP_001059901.1|  Os07g0541900                                       154   4e-40    
gb|KJB41391.1|  hypothetical protein B456_007G102400                    153   4e-40    
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             156   4e-40    
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             156   4e-40    
gb|EMS56999.1|  Cysteine-rich receptor-like protein kinase 10           148   4e-40    
ref|XP_003634705.1|  PREDICTED: probable LRR receptor-like serine...    156   4e-40    
ref|XP_010064515.1|  PREDICTED: probable leucine-rich repeat rece...    156   4e-40    
ref|XP_011087539.1|  PREDICTED: probable receptor-like protein ki...    153   4e-40    
ref|XP_011002771.1|  PREDICTED: probable LRR receptor-like serine...    156   4e-40    
ref|XP_010065822.1|  PREDICTED: receptor-like protein kinase HAIKU2     156   5e-40    
ref|XP_010916525.1|  PREDICTED: probable LRR receptor-like serine...    156   5e-40    
ref|XP_006439659.1|  hypothetical protein CICLE_v10019379mg             154   5e-40    
ref|XP_010916533.1|  PREDICTED: probable LRR receptor-like serine...    156   5e-40    
ref|XP_006370083.1|  hypothetical protein POPTR_0001s393801g            154   5e-40    
gb|KCW71078.1|  hypothetical protein EUGRSUZ_F04177                     155   5e-40    
ref|XP_010553669.1|  PREDICTED: receptor-like protein kinase HAIKU2     156   5e-40    
ref|XP_001761477.1|  predicted protein                                  149   5e-40    
ref|NP_001047537.1|  Os02g0639100                                       152   5e-40    
ref|XP_006476661.1|  PREDICTED: LRR receptor-like serine/threonin...    154   5e-40    
gb|KHG14766.1|  LRR receptor-like serine/threonine-protein kinase...    154   5e-40    
ref|XP_009780300.1|  PREDICTED: receptor-like protein kinase HAIKU2     156   5e-40    
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g             156   5e-40    
gb|KCW63493.1|  hypothetical protein EUGRSUZ_G01123                     156   6e-40    



>emb|CAN70282.1| hypothetical protein VITISV_023081 [Vitis vinifera]
Length=323

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             TPPL+W  RF+IILGTAKGLAHLHHS +PPIIHYN+KPSNILLDEN NP ISD+GLARL
Sbjct  129  TTPPLSWPNRFRIILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDENCNPMISDYGLARL  188

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLD+HV+S+RFQ+A+GYVAPELACQSLRVNEKCD+YGFG++ILEIVTGRRPVEYGEDN
Sbjct  189  LTKLDKHVISSRFQSALGYVAPELACQSLRVNEKCDIYGFGVMILEIVTGRRPVEYGEDN  248

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
            V+ILNDHVRVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRP+MAEVVQI
Sbjct  249  VVILNDHVRVLLEQGNVLECVDPSMXEYPEEEVLPVLKLALVCTSQIPSSRPTMAEVVQI  308

Query  543  LQVIKTPVPNRMEPY  587
            LQVIKTP+P RME +
Sbjct  309  LQVIKTPIPQRMEAF  323



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   362 bits (930),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA+RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  813   SSPPLSWAIRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARL  872

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDN
Sbjct  873   LTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDN  932

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             VLILNDHVRVLLEQGNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQI
Sbjct  933   VLILNDHVRVLLEQGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQI  992

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  993   LQVIKTPVPQRMEVF  1007



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   362 bits (930),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA+RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  813   SSPPLSWAIRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARL  872

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDN
Sbjct  873   LTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDN  932

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             VLILNDHVRVLLEQGNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQI
Sbjct  933   VLILNDHVRVLLEQGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQI  992

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  993   LQVIKTPVPQRMEVF  1007



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   361 bits (926),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = +3

Query  12    PLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK  191
             PLTWA RFKI++GTAKGLAHLHHSC+PPIIHYNIKPSNILLDENLNPKISDFGLARL+ K
Sbjct  818   PLTWANRFKIVMGTAKGLAHLHHSCRPPIIHYNIKPSNILLDENLNPKISDFGLARLLTK  877

Query  192   LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
             LD+HV+SNRFQ+A GYVAPELACQSLRVNEKCDVYGFG+LILE+V+GRRPVEYGEDNV+I
Sbjct  878   LDKHVVSNRFQSAPGYVAPELACQSLRVNEKCDVYGFGVLILELVSGRRPVEYGEDNVVI  937

Query  372   LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             L+DHVRVLLEQGNVL+CVD  MG YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV
Sbjct  938   LSDHVRVLLEQGNVLDCVDLSMGKYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  997

Query  552   IKTPVPNRMEPY  587
             IKTPVPNRME +
Sbjct  998   IKTPVPNRMEAF  1009



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA+RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  813   SSPPLSWAIRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARL  872

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDN
Sbjct  873   LTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDN  932

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             VLILNDHVRVLLE GNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQI
Sbjct  933   VLILNDHVRVLLEHGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQI  992

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  993   LQVIKTPVPQRMEVF  1007



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   360 bits (925),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA+RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  813   SSPPLSWAIRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARL  872

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDN
Sbjct  873   LTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDN  932

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             VLILNDHVRVLLE GNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQI
Sbjct  933   VLILNDHVRVLLEHGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQI  992

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  993   LQVIKTPVPQRMEVF  1007



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   358 bits (919),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+W +RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  824   SSPPLSWPIRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENCNPKISDFGLARL  883

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDN
Sbjct  884   LTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDN  943

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             VLILNDHVRVLLEQGNVLECVD  M  YP++EVLPVLKLA+VCTSQIPSSRP+M+EVVQI
Sbjct  944   VLILNDHVRVLLEQGNVLECVDHSMIEYPEDEVLPVLKLAMVCTSQIPSSRPTMSEVVQI  1003

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  1004  LQVIKTPVPQRMEVF  1018



>gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ATPPL+WA RFKI+LGTAKGLA+LHHS +PPIIHYNIKPSNILLD+N NPKISDFGLARL
Sbjct  807   ATPPLSWANRFKIVLGTAKGLAYLHHSFRPPIIHYNIKPSNILLDDNCNPKISDFGLARL  866

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRP+EYGEDN
Sbjct  867   LTKLDKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGIMILEVVTGRRPIEYGEDN  926

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+ILNDHVRVLLEQGN L+CVD  MG YP++EVLPVLKLALVCTSQIPSSRPSMAEVVQI
Sbjct  927   VVILNDHVRVLLEQGNSLDCVDPNMGDYPEDEVLPVLKLALVCTSQIPSSRPSMAEVVQI  986

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  987   LQVIKTPVPQRMEMF  1001



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   357 bits (915),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+W+ RFKIILGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  817   SAPPLSWSNRFKIILGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENSNPKISDFGLARL  876

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KL+RHV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDN
Sbjct  877   LMKLERHVISNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDN  936

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL+DHVRVLLEQGNVLECVD  MG YP++EVLPVLKLALVCTSQIPSSRPSMAEVVQI
Sbjct  937   VVILSDHVRVLLEQGNVLECVDVSMGDYPEDEVLPVLKLALVCTSQIPSSRPSMAEVVQI  996

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  997   LQVIKTPVPQRMEIF  1011



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+WA RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGL+RL
Sbjct  813   STPPLSWANRFKIVLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENNNPKISDFGLSRL  872

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HV++NRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRP+EYGEDN
Sbjct  873   LTKLDKHVINNRFQSALGYVAPELACQSLRVNEKCDVYGFGILILELVTGRRPIEYGEDN  932

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+ILNDHVRVLLEQGN L+CVD  MG YP++EVLPVLKLALVCTSQIPSSRPSM EVVQI
Sbjct  933   VVILNDHVRVLLEQGNALDCVDPSMGDYPEDEVLPVLKLALVCTSQIPSSRPSMGEVVQI  992

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  993   LQVIKTPVPQRMEIF  1007



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   354 bits (909),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+WA R KI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  812   STPPLSWANRLKIVLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNPKISDFGLARL  871

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMS+RFQ+A+GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRRPVEYGEDN
Sbjct  872   LTKLDRHVMSSRFQSALGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRPVEYGEDN  931

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+I NDHVRVLLEQGN L+CVD  MG YP++EV+PVLKLALVCTSQIPSSRPSMAEVVQI
Sbjct  932   VVIQNDHVRVLLEQGNALDCVDPSMGDYPEDEVMPVLKLALVCTSQIPSSRPSMAEVVQI  991

Query  543   LQVIKTPVPNRMEPY  587
             LQVI+TPVP RME +
Sbjct  992   LQVIRTPVPQRMEIF  1006



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   353 bits (907),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+WA R KI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  812   STPPLSWANRLKIVLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNPKISDFGLARL  871

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMS+RFQ+A+GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRRPVEYGEDN
Sbjct  872   LTKLDRHVMSSRFQSALGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRPVEYGEDN  931

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+I NDHVRVLLEQGN L+CVD  MG YP++EV+PVLKLALVCTSQIPSSRPSMAEVVQI
Sbjct  932   VVIQNDHVRVLLEQGNALDCVDPSMGDYPEDEVMPVLKLALVCTSQIPSSRPSMAEVVQI  991

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTP P RME +
Sbjct  992   LQVIKTPAPQRMEIF  1006



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   353 bits (905),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
              PPL+W+ RFKIILGTAKGLAHLHHS +PP+IHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  794  TAPPLSWSNRFKIILGTAKGLAHLHHSFRPPVIHYNIKPSNILLDENYNPKISDFGLARL  853

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KL++HV+SNRFQ+A+GYVAPELACQ+LRVNEKCDV+GFGMLILE+VTGRRPVEYGEDN
Sbjct  854  LTKLEKHVISNRFQSALGYVAPELACQNLRVNEKCDVFGFGMLILELVTGRRPVEYGEDN  913

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
            V+IL+DHVRV +EQGNVL+CVD GMG YP++EV PVLKLALVCTSQIPSSRPSMAEVVQI
Sbjct  914  VVILSDHVRVSVEQGNVLDCVDLGMGDYPEDEVFPVLKLALVCTSQIPSSRPSMAEVVQI  973

Query  543  LQVIKTPVPNRMEP  584
            LQVIKTPVP RMEP
Sbjct  974  LQVIKTPVPQRMEP  987



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            + PPL+W+ RFKIILGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  795  SAPPLSWSNRFKIILGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNPKISDFGLARL  854

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KL+ HV+SNRFQ+A+GYVAPELACQ+LRVNEKCDV+GFGMLILE+VTGRRPVEYGEDN
Sbjct  855  LTKLENHVISNRFQSALGYVAPELACQNLRVNEKCDVFGFGMLILELVTGRRPVEYGEDN  914

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
            V+IL+DHVRV +EQGNVL+CVD  MG YP++EV PVLKLALVCTSQIPSSRPSMAEVVQI
Sbjct  915  VVILSDHVRVSVEQGNVLDCVDLSMGDYPEDEVFPVLKLALVCTSQIPSSRPSMAEVVQI  974

Query  543  LQVIKTPVPNRMEP  584
            LQVIKTPVP RMEP
Sbjct  975  LQVIKTPVPQRMEP  988



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  PLTWA RFKI+LGTAKGLAHLHHS +PPIIHYN+KPSNILLDE++NPKISDFGLARL
Sbjct  826   SAAPLTWATRFKIVLGTAKGLAHLHHSIRPPIIHYNVKPSNILLDEHMNPKISDFGLARL  885

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HV+S+RFQ+A+GYVAPELACQSLRVNEKCDV+GFG+LILEIVTGRRPVEYGEDN
Sbjct  886   LTKLDKHVISSRFQSALGYVAPELACQSLRVNEKCDVFGFGVLILEIVTGRRPVEYGEDN  945

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL+DHVRVLLEQGN L+CVD  MG YP++EV PVLKLALVCTSQIPSSRPSMAEVVQI
Sbjct  946   VMILSDHVRVLLEQGNALDCVDPSMGNYPEDEVSPVLKLALVCTSQIPSSRPSMAEVVQI  1005

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTP+P RME Y
Sbjct  1006  LQVIKTPLPQRMEAY  1020



>gb|AES77940.2| tyrosine kinase family protein [Medicago truncatula]
Length=641

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            ++PPL+W  RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  446  SSPPLSWPNRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLARL  505

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLD+HVMSNRFQ+A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG+RPVEYGEDN
Sbjct  506  LTKLDKHVMSNRFQSALGYVAPELACQILRVNEKCDVYGFGVMILEIVTGKRPVEYGEDN  565

Query  363  VLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            VLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQ
Sbjct  566  VLILNDHVRVLLEHGNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQ  625

Query  540  ILQVIKTPVPNRMEPY  587
            ILQVIKT VP RME +
Sbjct  626  ILQVIKTSVPQRMEVF  641


 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            ++PPL+W  RFKI+LGTAKGLAHLHHS +PPIIH NIKPSNILLDEN N KISDFGLARL
Sbjct  115  SSPPLSWPNRFKILLGTAKGLAHLHHSFRPPIIHCNIKPSNILLDENFNAKISDFGLARL  174

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRV  275
            ++KLD+HVMSNRFQ+A+GYVAPELACQSLR+
Sbjct  175  LSKLDKHVMSNRFQSALGYVAPELACQSLRM  205



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   347 bits (890),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
              TPPL+W  RF+IILGTAKGLAHLHHS +PPIIHYN+KPSNILLDEN NP ISD+GLARL
Sbjct  818   TTPPLSWPNRFRIILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDENCNPMISDYGLARL  877

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HV+S+RFQ+A+GYVAPELACQSLRVNEKCD+YGFG++ILEIVTGRRPVEYGEDN
Sbjct  878   LTKLDKHVISSRFQSALGYVAPELACQSLRVNEKCDIYGFGVMILEIVTGRRPVEYGEDN  937

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+ILNDHVRVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRP+MAEVVQI
Sbjct  938   VVILNDHVRVLLEQGNVLECVDPSMNEYPEEEVLPVLKLALVCTSQIPSSRPTMAEVVQI  997

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTP+P RME +
Sbjct  998   LQVIKTPIPQRMEAF  1012



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   347 bits (889),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++ PL+WA RFKI LG  KGLAHLHH   PPIIHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  818   SSSPLSWATRFKIALGVGKGLAHLHHDFHPPIIHYNIKPSNILLDENDNPKISDFGLARL  877

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLDRHVMSNRFQ+A GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDN
Sbjct  878   LTKLDRHVMSNRFQSAPGYVAPELACQSLRVNEKCDVYGFGILILELVTGRRPVEYGEDN  937

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL+DHVRVLLEQGN L+CVD  +  YP++EVLPVLKLALVCTSQ+PSSRPSMAEVVQI
Sbjct  938   VVILSDHVRVLLEQGNALDCVDPSITEYPEDEVLPVLKLALVCTSQVPSSRPSMAEVVQI  997

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP+RMEPY
Sbjct  998   LQVIKTPVPHRMEPY  1012



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   347 bits (889),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+W  RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  821   SSPPLSWPNRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLARL  880

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILEIVTGRRPVEYGEDN
Sbjct  881   LTKLDKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILEIVTGRRPVEYGEDN  940

Query  363   VLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
             VLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQ
Sbjct  941   VLILNDHVRVLLEHGNALECVDPSLMNEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQ  1000

Query  540   ILQVIKTPVPNRMEPY  587
             ILQVIKTPVP RME +
Sbjct  1001  ILQVIKTPVPQRMEVF  1016



>gb|KDO44075.1| hypothetical protein CISIN_1g0027171mg [Citrus sinensis]
Length=843

 Score =   343 bits (879),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            +TPPL+W  RFK+ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL
Sbjct  649  STPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARL  708

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDN
Sbjct  709  LTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDN  768

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
            V+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQI
Sbjct  769  VVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQI  828

Query  543  LQVIKTPVPNRMEPY  587
            LQVIKTP+P RME +
Sbjct  829  LQVIKTPLPQRMEVF  843



>gb|KDO44074.1| hypothetical protein CISIN_1g0027171mg, partial [Citrus sinensis]
Length=866

 Score =   343 bits (879),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            +TPPL+W  RFK+ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL
Sbjct  672  STPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARL  731

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDN
Sbjct  732  LTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDN  791

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
            V+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQI
Sbjct  792  VVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQI  851

Query  543  LQVIKTPVPNRMEPY  587
            LQVIKTP+P RME +
Sbjct  852  LQVIKTPLPQRMEVF  866



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+W +RFKI+LGTAKGLAHLHHS +P IIHYNIKPSNILLDEN NPK+SDFGLARL
Sbjct  816   SNPPLSWPIRFKILLGTAKGLAHLHHSFRPSIIHYNIKPSNILLDENFNPKLSDFGLARL  875

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + K+++HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDN
Sbjct  876   LTKVEKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDN  935

Query  363   VLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
             VLILNDHVRVLLE GNVL+CVD   M  YP++EVLPVLKLA+VCTSQIPSSRPSMAEVVQ
Sbjct  936   VLILNDHVRVLLEHGNVLDCVDPNLMNEYPEDEVLPVLKLAMVCTSQIPSSRPSMAEVVQ  995

Query  540   ILQVIKTPVPNRMEPY  587
             ILQVIKTPVP RME Y
Sbjct  996   ILQVIKTPVPQRMEVY  1011



>ref|XP_009589224.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Nicotiana tomentosiformis]
Length=938

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  30   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  209
            RFKI+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDENLNPKISDFGLARLV KLD+H++
Sbjct  753  RFKIVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENLNPKISDFGLARLVTKLDKHMI  812

Query  210  SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  389
            SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP+EY EDNVLILNDHVR
Sbjct  813  SNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPIEYCEDNVLILNDHVR  872

Query  390  VLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  569
            VLLEQGNVLECVD  +  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP
Sbjct  873  VLLEQGNVLECVDPTLDTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  932

Query  570  NRMEPY  587
             RME Y
Sbjct  933  QRMEAY  938



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   345 bits (885),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++ PL+W  RFKI+LGTAKGLAHLHHS +PPI+HYN+KPSNILLDEN NP+ISDFGL+RL
Sbjct  829   SSQPLSWPQRFKILLGTAKGLAHLHHSIRPPIVHYNLKPSNILLDENFNPRISDFGLSRL  888

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HV+SNRFQ+A+GYVAPE+ACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDN
Sbjct  889   LTKLDKHVISNRFQSALGYVAPEMACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDN  948

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL+DH RVLLE+GNVLECVDQ +G YP++EVLPVLKLALVCTSQ+PSSRPSMAEVVQI
Sbjct  949   VVILSDHARVLLEEGNVLECVDQSIGDYPEDEVLPVLKLALVCTSQVPSSRPSMAEVVQI  1008

Query  543   LQVIKTPVPNRMEPY  587
             L VIKTPVP R+E +
Sbjct  1009  LHVIKTPVPQRLEVF  1023



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            ++ PLTW  RFKI+LGTAKGL+HLHHS +PPI+HYN+KPSNILLDENLNPKISDFGLAR+
Sbjct  766  SSMPLTWPDRFKIVLGTAKGLSHLHHSFRPPIVHYNVKPSNILLDENLNPKISDFGLARI  825

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLD+HVMS+RFQ+A GYVAPELACQSLRVNEKCDVYGFG+L+LE+VTGRRPVEYGEDN
Sbjct  826  LTKLDKHVMSSRFQSAPGYVAPELACQSLRVNEKCDVYGFGVLVLELVTGRRPVEYGEDN  885

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
            V+IL+DHVRV+LE+GNVL+CVD  MG YP+EEVLPV+KLALVCTSQIPSSRPSMAEVVQI
Sbjct  886  VVILSDHVRVMLERGNVLDCVDLEMGEYPEEEVLPVVKLALVCTSQIPSSRPSMAEVVQI  945

Query  543  LQVIKTPVPNRM  578
            L+VIKTP+PNRM
Sbjct  946  LEVIKTPLPNRM  957



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDE  N KISDF LARL
Sbjct  815   SSPPLSWANRFKILLGTAKGLAHLHHSYRPPIIHYNIKPSNILLDETYNAKISDFALARL  874

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + K+DRHV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILEIVTGRRPVEYGEDN
Sbjct  875   LTKIDRHVVSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILEIVTGRRPVEYGEDN  934

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+ILNDHVRVLLEQGN L C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI
Sbjct  935   VVILNDHVRVLLEQGNALGCIDVSMGDYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQI  994

Query  543   LQVIKTPVPNRMEPY  587
             +Q+IKTP+P  ME Y
Sbjct  995   MQIIKTPIPQTMEAY  1009



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   343 bits (881),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  30    RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  209
             RFKI+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDENLNPKISDFGLARLV KLD+H++
Sbjct  827   RFKIVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENLNPKISDFGLARLVTKLDKHMI  886

Query  210   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  389
             SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP+EY EDNVLILNDHVR
Sbjct  887   SNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPIEYCEDNVLILNDHVR  946

Query  390   VLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  569
             VLLEQGNVLECVD  +  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP
Sbjct  947   VLLEQGNVLECVDPTLDTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  1006

Query  570   NRMEPY  587
              RME Y
Sbjct  1007  QRMEAY  1012



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W  RFK+ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL
Sbjct  809   STPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARL  868

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDN
Sbjct  869   LTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDN  928

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQI
Sbjct  929   VVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQI  988

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTP+P RME +
Sbjct  989   LQVIKTPLPQRMEVF  1003



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W  RFK+ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL
Sbjct  809   STPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARL  868

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDN
Sbjct  869   LTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDN  928

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQI
Sbjct  929   VVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQI  988

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTP+P RME +
Sbjct  989   LQVIKTPLPQRMEVF  1003



>ref|XP_003621722.1| Receptor-like kinase [Medicago truncatula]
Length=804

 Score =   338 bits (867),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            ++PPL+W  RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  422  SSPPLSWPNRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLARL  481

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLD+HVMSNRFQ+A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG+RPVEYGEDN
Sbjct  482  LTKLDKHVMSNRFQSALGYVAPELACQILRVNEKCDVYGFGVMILEIVTGKRPVEYGEDN  541

Query  363  VLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            VLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQ
Sbjct  542  VLILNDHVRVLLEHGNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQ  601

Query  540  ILQVIKTPVPNRME  581
            ILQVIKT VP RME
Sbjct  602  ILQVIKTSVPQRME  615


 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            ++PPL+W  RFKI+LGTAKGLAHLHHS +PPIIH NIKPSNILLDEN N KISDFGLARL
Sbjct  115  SSPPLSWPNRFKILLGTAKGLAHLHHSFRPPIIHCNIKPSNILLDENFNAKISDFGLARL  174

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP  341
            ++KLD+HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+  LE+V    P
Sbjct  175  LSKLDKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVF-LEMVQYGNP  226



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  27    VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  206
              RF I+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDEN NP+ISDFGLARLV KLD+H+
Sbjct  825   TRFNIVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENFNPRISDFGLARLVTKLDKHM  884

Query  207   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  386
             +SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV
Sbjct  885   ISNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  944

Query  387   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  566
             RVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV
Sbjct  945   RVLLEQGNVLECVDPTMKTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  1004

Query  567   PNRMEPY  587
             P RM  Y
Sbjct  1005  PQRMSAY  1011



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  27    VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  206
              RF I+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDEN NP+ISDFGLARLV KLD+H+
Sbjct  826   TRFNIVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENFNPRISDFGLARLVTKLDKHM  885

Query  207   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  386
             +S+RFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV
Sbjct  886   ISSRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  945

Query  387   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  566
             RVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV
Sbjct  946   RVLLEQGNVLECVDPTMNTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  1005

Query  567   PNRMEPY  587
             P RME Y
Sbjct  1006  PQRMEVY  1012



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   341 bits (875),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  27    VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  206
              RFKI+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDENLNPKISDFGLARLV KLD+H+
Sbjct  826   TRFKIVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENLNPKISDFGLARLVTKLDKHM  885

Query  207   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  386
             +SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP+EY EDNVLILNDHV
Sbjct  886   ISNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPIEYCEDNVLILNDHV  945

Query  387   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  566
             RVLLEQGNVL+CVD  +  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV
Sbjct  946   RVLLEQGNVLDCVDPTLDTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  1005

Query  567   PNRMEPY  587
             P RME Y
Sbjct  1006  PQRMEAY  1012



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   340 bits (873),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            +TPPL+WA RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDF L RL
Sbjct  792  STPPLSWANRFKILLGTAKGLAHLHHSYRPPIIHYNIKPSNILLDENYNPKISDFALVRL  851

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + K+D+HV+SNRFQ A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDN
Sbjct  852  LTKIDQHVVSNRFQTALGYVAPELACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDN  911

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
            V+IL DHVRVLLEQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI
Sbjct  912  VVILTDHVRVLLEQGNVLGCIDLSMGEYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQI  971

Query  543  LQVIKTPVPNRMEPY  587
            +Q+IKTP+P+ +E +
Sbjct  972  MQIIKTPIPHTLEAF  986



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++ PL+W  RFKI+LGTAKGL+HLHHS +PPIIHYN+KPSNILLDE+LNPKISDF LARL
Sbjct  812   SSSPLSWDDRFKILLGTAKGLSHLHHSFRPPIIHYNVKPSNILLDEDLNPKISDFALARL  871

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + K+DRHV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDN
Sbjct  872   LTKIDRHVVSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDN  931

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+ILNDHV+VLLEQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI
Sbjct  932   VVILNDHVKVLLEQGNVLGCIDVSMGEYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQI  991

Query  543   LQVIKTPVPNRMEPY  587
             LQ+IKTP+P R+E +
Sbjct  992   LQIIKTPLPQRIERF  1006



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA RFKI+LGTAKGLA LHHS +PPIIHYNIKPSNILLDE+ N KISDF LARL
Sbjct  815   SSPPLSWANRFKILLGTAKGLAQLHHSYRPPIIHYNIKPSNILLDESYNAKISDFALARL  874

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + K+D+HV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILEIVTGRRPVEYGEDN
Sbjct  875   LTKIDQHVVSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILEIVTGRRPVEYGEDN  934

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+ILNDHVRVLLEQGN L C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI
Sbjct  935   VVILNDHVRVLLEQGNALGCIDVSMGYYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQI  994

Query  543   LQVIKTPVPNRMEPY  587
             +Q+IKTP+P  ME Y
Sbjct  995   MQIIKTPIPQTMEAY  1009



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   339 bits (870),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = +3

Query  12    PLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK  191
             PL+WA RF+++LGTAKGLAHLHHSC PPIIHYN+KPSNILLDEN N K++DFGLA+L+ K
Sbjct  817   PLSWATRFRVLLGTAKGLAHLHHSCTPPIIHYNLKPSNILLDENYNAKVADFGLAKLLTK  876

Query  192   LDRHVMS-NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
             +D H MS NRFQ A GY APELACQSLRVNEKCDVY FG++ LEIVTGRRP+EYGEDNVL
Sbjct  877   IDNHSMSGNRFQGAPGYAAPELACQSLRVNEKCDVYSFGVMALEIVTGRRPIEYGEDNVL  936

Query  369   ILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
             ILNDHVRVLLE+GNVLECVDQ +G YPDEEVLPVLKLALVCTSQIPSSRPSM+EVVQILQ
Sbjct  937   ILNDHVRVLLEEGNVLECVDQSIGEYPDEEVLPVLKLALVCTSQIPSSRPSMSEVVQILQ  996

Query  549   VIKTPVPNRMEPY  587
             VIKTPVP R E Y
Sbjct  997   VIKTPVPQRQEAY  1009



>ref|XP_003621710.1| Receptor-like protein kinase [Medicago truncatula]
Length=1085

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            ++PPL+W  RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL
Sbjct  703  SSPPLSWPNRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLARL  762

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLD+HVMSNRFQ+A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG+RPVEYGEDN
Sbjct  763  LTKLDKHVMSNRFQSALGYVAPELACQILRVNEKCDVYGFGVMILEIVTGKRPVEYGEDN  822

Query  363  VLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            VLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQ
Sbjct  823  VLILNDHVRVLLEHGNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQ  882

Query  540  ILQVIKTPVPNRME  581
            ILQVIKT VP RME
Sbjct  883  ILQVIKTSVPQRME  896



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + P L+WA R KI+LGTAKGLAHLHHS +PPIIH +IKPSNILLDEN NPKISDFGLAR 
Sbjct  818   SAPRLSWANRLKIVLGTAKGLAHLHHSFRPPIIHCDIKPSNILLDENFNPKISDFGLARF  877

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             +AKLDRHV+S RFQ+A+GYVAPEL+CQSLR+NEKCD+YGFG+LILE+VTGRRPVEYGEDN
Sbjct  878   LAKLDRHVISTRFQSALGYVAPELSCQSLRINEKCDIYGFGILILELVTGRRPVEYGEDN  937

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             VLIL DHVR LLEQGNV +CVD  MG YP++EVLPVLKLALVCTS IPSSRPSMAEVVQI
Sbjct  938   VLILKDHVRFLLEQGNVFDCVDPSMGDYPEDEVLPVLKLALVCTSHIPSSRPSMAEVVQI  997

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP R E +
Sbjct  998   LQVIKTPVPQRTEFF  1012



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   336 bits (862),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA RFKI LGTAKGL HLH + +PPIIHY+IKPSNILLDEN NPKISDFGLARL
Sbjct  815   SSPPLSWANRFKIALGTAKGLVHLHQNFRPPIIHYSIKPSNILLDENYNPKISDFGLARL  874

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HV+S+RFQ+A+GYVAPELACQSLR+NEKCD+YGFG++ILE+VTGR+PVEYGED+
Sbjct  875   LTKLDKHVISSRFQSALGYVAPELACQSLRINEKCDIYGFGVMILELVTGRKPVEYGEDD  934

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL+DHVRV+LEQG VL CVD  MG YP+EEVLPVLKL LVCTSQIPSSRPSMAEVVQI
Sbjct  935   VVILSDHVRVMLEQGKVLSCVDPTMGEYPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQI  994

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP RME +
Sbjct  995   LQVIKTPVPQRMEAF  1009



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   333 bits (854),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +3

Query  15    LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
             L+WA R KI+LGTAKGLAHLHHS +PPIIH++IKPSNILLDEN NPKISDFGLAR  AKL
Sbjct  822   LSWANRLKIVLGTAKGLAHLHHSFRPPIIHFDIKPSNILLDENFNPKISDFGLARFFAKL  881

Query  195   DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
             DRHV+S RFQ+A+GYVAPEL CQSL +NEKCDVYGFG+LILE+VTGRRPVEYGEDNVLIL
Sbjct  882   DRHVISTRFQSALGYVAPELLCQSLIINEKCDVYGFGILILELVTGRRPVEYGEDNVLIL  941

Query  375   NDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  554
              DHVR LLEQGNV +CVD  MG YP++EVLPVLKLALVCTS IPSSRPSMAEVVQILQVI
Sbjct  942   KDHVRFLLEQGNVFDCVDPSMGDYPEDEVLPVLKLALVCTSHIPSSRPSMAEVVQILQVI  1001

Query  555   KTPVPNRMEPY  587
             KTPVP R E +
Sbjct  1002  KTPVPQRTEFF  1012



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +T PL+WA RFKI+LG AKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDF L RL
Sbjct  815   STLPLSWANRFKILLGAAKGLAHLHHSYRPPIIHYNIKPSNILLDENYNPKISDFALVRL  874

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + K D+HV+SNRFQ+A+GYVAPELAC SLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDN
Sbjct  875   LTKTDQHVVSNRFQSALGYVAPELACHSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDN  934

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL DHVRVLLEQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI
Sbjct  935   VVILTDHVRVLLEQGNVLGCIDLSMGEYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQI  994

Query  543   LQVIKTPVPNRMEPY  587
             +Q+IKTP+P+ +E +
Sbjct  995   MQIIKTPIPHTLEAF  1009



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   330 bits (846),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+W  RFKI+LGTAKGLAHLHHS +PPI+HYN+KP+NILLDEN NPKISD+GLARL
Sbjct  816   SAPPLSWDNRFKIVLGTAKGLAHLHHSFRPPIVHYNLKPTNILLDENFNPKISDYGLARL  875

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HVM+NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVTGRRPVEYGEDN
Sbjct  876   LTKLDKHVMNNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVTGRRPVEYGEDN  935

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL DHVR LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPSSRPSMAEVVQI
Sbjct  936   VVILTDHVRYLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPSSRPSMAEVVQI  995

Query  543   LQVIKTPVPNRM  578
             LQVIK P+P R+
Sbjct  996   LQVIKAPLPQRI  1007



>ref|XP_004156987.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040-like [Cucumis 
sativus]
Length=1007

 Score =   329 bits (844),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+W  RFKI+LGTAKGLAHLHHS  PPI+HYN+KP+NILLDEN NPKISD+GLARL
Sbjct  816   SAPPLSWDNRFKIVLGTAKGLAHLHHSFXPPIVHYNLKPTNILLDENFNPKISDYGLARL  875

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HVM+NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVTGRRPVEYGEDN
Sbjct  876   LTKLDKHVMNNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVTGRRPVEYGEDN  935

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL DHVR LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPSSRPSMAEVVQI
Sbjct  936   VVILTDHVRYLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPSSRPSMAEVVQI  995

Query  543   LQVIKTPVPNRM  578
             LQVIK P+P R+
Sbjct  996   LQVIKAPLPQRI  1007



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
              TPPL+W+ RF+IILGTAKGLA+LHHSC+PPI+H+N+KP+NIL DEN NPKISDFGL RL
Sbjct  817   TTPPLSWSARFRIILGTAKGLAYLHHSCRPPIVHFNLKPTNILFDENNNPKISDFGLTRL  876

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + K DR++M++RFQ A+GY+APEL CQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGED+
Sbjct  877   LTKHDRNMMNSRFQNALGYIAPELECQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDS  936

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
              +IL+DHVRVLLEQGNVLECVD  M  Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQI
Sbjct  937   FVILSDHVRVLLEQGNVLECVDPTMDEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQI  996

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPVP R+E +
Sbjct  997   LQVIKTPVPQRLETF  1011



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+W  RFKI+LGTAKGLAHLHHS +PPI+HYN+KP+NILLDEN NPKISD+GLARL
Sbjct  816   SAPPLSWDNRFKIVLGTAKGLAHLHHSFRPPIVHYNLKPTNILLDENFNPKISDYGLARL  875

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HV++NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVTGRRPVEYGEDN
Sbjct  876   LTKLDKHVVNNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVTGRRPVEYGEDN  935

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL DHVR LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPSSRPSMAEVVQI
Sbjct  936   VVILTDHVRYLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPSSRPSMAEVVQI  995

Query  543   LQVIKTPVPNRMEPY  587
             LQVIK P+P R++ +
Sbjct  996   LQVIKAPLPQRIQGF  1010



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score =   326 bits (835),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+WA RF I LG AKGLA+LH S +PPIIHYNIKPSNILLDEN NPKISDFGLARL
Sbjct  816   SMPPLSWADRFNIALGAAKGLAYLHQSFRPPIIHYNIKPSNILLDENCNPKISDFGLARL  875

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+H++S+RFQ+A+GY+APELACQSLR+NEKCDVYGFG+LILE+VTGR+PVEYG+D+
Sbjct  876   LPKLDKHIISSRFQSAMGYMAPELACQSLRINEKCDVYGFGVLILELVTGRKPVEYGDDD  935

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL D VRVLLEQGNVL+C+D  MG +P+EEVLPVLKL LVCTSQIPSSRPSMAEVVQI
Sbjct  936   VVILIDQVRVLLEQGNVLDCMDSSMGEFPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQI  995

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPV  RME +
Sbjct  996   LQVIKTPVIERMEAF  1010



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+WA RF I LGTAKGLA+LH S +PPIIHYNIKPSNILLDE+ +P+ISDFGLARL
Sbjct  814   SMPPLSWADRFNIALGTAKGLAYLHQSFRPPIIHYNIKPSNILLDESCSPRISDFGLARL  873

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD H++S+RFQ+A+GY+APELACQSLR+NEKCDVYGFG+LILE+VTGR+PV+YG+D+
Sbjct  874   LPKLDNHIISSRFQSAMGYMAPELACQSLRINEKCDVYGFGVLILELVTGRKPVQYGDDD  933

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL D VRVLLEQGNVL+CVD  MG +P+EEVLPVLKL LVCTSQIPSSRPSMAEVVQI
Sbjct  934   VVILIDQVRVLLEQGNVLDCVDSRMGEFPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQI  993

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPV  RME +
Sbjct  994   LQVIKTPVIERMEAF  1008



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             A PPL+WA RFKI LGTAKG+AHLH S +PPI+HYN+KP+NILLDE   PKISDFGL RL
Sbjct  816   AIPPLSWADRFKIALGTAKGIAHLHQSFRPPIVHYNLKPTNILLDEKCEPKISDFGLVRL  875

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+H++S+RFQ+A+GY+APELACQSLRVNEKCD+YGFG+LILE+VTG++PVEYGED+
Sbjct  876   LQKLDKHMISSRFQSAMGYMAPELACQSLRVNEKCDIYGFGVLILELVTGKKPVEYGEDD  935

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL DHVR L+EQGN +ECVD  MG +P+EEVLPVLKL LVCTSQIPSSRPSMAEVVQI
Sbjct  936   VVILIDHVRALVEQGNAVECVDSSMGEFPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQI  995

Query  543   LQVIKTPV  566
             LQVIK P+
Sbjct  996   LQVIKAPL  1003



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL W  RFKI LGTAKGLAHLH S +PPIIHYN+KP+NILLDEN +PKISDFGLARL
Sbjct  833   STPPLPWRDRFKIALGTAKGLAHLHQSVRPPIIHYNLKPTNILLDENCDPKISDFGLARL  892

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+H++S+RFQ+A+GY+APELACQSLRVNEKCDVYG+G+LI E+VTG++PVEYG+D+
Sbjct  893   LQKLDKHIISSRFQSAMGYMAPELACQSLRVNEKCDVYGYGVLIAELVTGKKPVEYGDDD  952

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL DHVR LLEQG VL+CVD  MG +P+EEVLPVLKL LVCTSQIPS+RPSMAEVVQI
Sbjct  953   VVILIDHVRALLEQGRVLDCVDSSMGEFPEEEVLPVLKLGLVCTSQIPSTRPSMAEVVQI  1012

Query  543   LQVIKTPV  566
             LQVIK P+
Sbjct  1013  LQVIKAPL  1020



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+WA RF I++GTA GLAHLH S +PPIIHYN+KP+NILLDE+ NP ISDFG ARL
Sbjct  831   SMPPLSWADRFHIVIGTADGLAHLHQSFRPPIIHYNLKPTNILLDESCNPIISDFGHARL  890

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+H++S+RFQ+A+GY+APELACQSLRVNEKCDVYGFG+LILE+VTGR+PVEY +D+
Sbjct  891   LPKLDKHIISSRFQSAMGYMAPELACQSLRVNEKCDVYGFGVLILELVTGRKPVEYRDDD  950

Query  363   VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             V+IL D VR+LLEQG  LEC+D  MG YP+EEVLPVLKL LVC SQIPSSRPSMAEVVQI
Sbjct  951   VVILIDQVRLLLEQGKALECIDASMGEYPEEEVLPVLKLGLVCASQIPSSRPSMAEVVQI  1010

Query  543   LQVIKTPVPNRMEPY  587
             LQVIKTPV  RME +
Sbjct  1011  LQVIKTPVLERMEAF  1025



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 176/196 (90%), Gaps = 1/196 (1%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            ++PPL+WA RF+IILGTAKGLA+LHHS +PPI+H+N+KP+NILLD++ NPKISDFGL RL
Sbjct  798  SSPPLSWAARFRIILGTAKGLAYLHHSFRPPIVHFNLKPTNILLDKDNNPKISDFGLTRL  857

Query  183  VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
            + K DR+ M+N RFQ A+GYVAPEL C+SLRVNEKCDVYGFG+LILE+VTGRRPVEYGE 
Sbjct  858  LTKHDRNTMNNNRFQNALGYVAPELECESLRVNEKCDVYGFGVLILELVTGRRPVEYGEH  917

Query  360  NVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            + ++L+DHVRVLLEQGN LECVD  M  + ++EVLPVLKLALVCTSQ+PS+RP+MAE+VQ
Sbjct  918  SFVVLSDHVRVLLEQGNALECVDPTMDEFSEDEVLPVLKLALVCTSQVPSNRPTMAEIVQ  977

Query  540  ILQVIKTPVPNRMEPY  587
            IL VIKTPVP+R+E +
Sbjct  978  ILHVIKTPVPHRLETF  993



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 176/196 (90%), Gaps = 1/196 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             ++PPL+WA RF+IILGTAKGLA+LHHS +PPI+H+N+KP+NILLD++ NPKISDFGL RL
Sbjct  822   SSPPLSWAARFRIILGTAKGLAYLHHSFRPPIVHFNLKPTNILLDKDNNPKISDFGLTRL  881

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             + K DR+ M+N RFQ A+GYVAPEL C+SLRVNEKCDVYGFG+LILE+VTGRRPVEYGE 
Sbjct  882   LTKHDRNTMNNNRFQNALGYVAPELECESLRVNEKCDVYGFGVLILELVTGRRPVEYGEH  941

Query  360   NVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
             + ++L+DHVRVLLEQGN LECVD  M  + ++EVLPVLKLALVCTSQ+PS+RP+MAE+VQ
Sbjct  942   SFVVLSDHVRVLLEQGNALECVDPTMDEFSEDEVLPVLKLALVCTSQVPSNRPTMAEIVQ  1001

Query  540   ILQVIKTPVPNRMEPY  587
             IL VIKTPVP+R+E +
Sbjct  1002  ILHVIKTPVPHRLETF  1017



>ref|NP_001045445.1| Os01g0957100 [Oryza sativa Japonica Group]
 dbj|BAF07359.1| Os01g0957100, partial [Oryza sativa Japonica Group]
Length=923

 Score =   305 bits (781),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A PPLTWA RF+I+ GTA+GLAHLH S +PP+IHYN+KPSNILLDE  NP + DFGLARL
Sbjct  723  AFPPLTWAERFRIVAGTARGLAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVGDFGLARL  782

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRR VEYG+D+
Sbjct  783  LPKLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRAVEYGDDD  842

Query  363  VLILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEV  533
            V+IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSMAEV
Sbjct  843  VVILIDQVRVLLDHGGGSNVLECVDPSIGEFPEEEVLPVLKLGMVCTSQIPSNRPSMAEV  902

Query  534  VQILQVIKTPV  566
            VQILQVIK PV
Sbjct  903  VQILQVIKAPV  913



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             A PPLTWA RF+I+ GTA+GLAHLH S +PP+IHYN+KPSNILLDE  NP + DFGLARL
Sbjct  813   AFPPLTWAERFRIVAGTARGLAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVGDFGLARL  872

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRR VEYG+D+
Sbjct  873   LPKLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRAVEYGDDD  932

Query  363   VLILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEV  533
             V+IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSMAEV
Sbjct  933   VVILIDQVRVLLDHGGGSNVLECVDPSIGEFPEEEVLPVLKLGMVCTSQIPSNRPSMAEV  992

Query  534   VQILQVIKTPV  566
             VQILQVIK PV
Sbjct  993   VQILQVIKAPV  1003



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             A PPLTWA RF+I+ GTA+GLAHLH S +PP+IHYN+KPSNILLDE  NP + DFGLARL
Sbjct  813   AFPPLTWAERFRIVAGTARGLAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVGDFGLARL  872

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             + KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRR VEYG+D+
Sbjct  873   LPKLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRAVEYGDDD  932

Query  363   VLILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEV  533
             V+IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSMAEV
Sbjct  933   VVILIDQVRVLLDHGGGSNVLECVDPTIGEFPEEEVLPVLKLGMVCTSQIPSNRPSMAEV  992

Query  534   VQILQVIKTPV  566
             VQILQVIK PV
Sbjct  993   VQILQVIKAPV  1003



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            +TPPL W  R++IILGTAKGLA+LHH+ +P  +H+N+KP+NILLDE  NPKISDFGLARL
Sbjct  736  STPPLPWDARYRIILGTAKGLAYLHHTFRPATVHFNLKPTNILLDEKYNPKISDFGLARL  795

Query  183  VAKLDRHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
            +   D + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  796  LTTQDGNTMNTNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  855

Query  360  NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
            + +IL+DHVRVLLEQGNVLEC+D  M G Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  856  SFVILSDHVRVLLEQGNVLECIDPTMEGEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  915

Query  537  QILQVIKTPVPNRM  578
            QILQVI +PVP+RM
Sbjct  916  QILQVISSPVPHRM  929



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W VR++IILGTAKGLA+LHH+C+P  IH+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  820   STPPLSWDVRYRIILGTAKGLAYLHHTCRPATIHFNLKPTNILLDEKNNPKISDFGLSRL  879

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  880   LTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  939

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  940   SFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  999

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+R+
Sbjct  1000  QILQVINSPVPHRI  1013



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W VR++IILGTAKGLA+LHH+C+P  IH+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  820   STPPLSWDVRYRIILGTAKGLAYLHHTCRPATIHFNLKPTNILLDEKNNPKISDFGLSRL  879

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  880   LTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  939

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  940   SFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  999

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+R+
Sbjct  1000  QILQVINSPVPHRI  1013



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W VR++IILGTAKGLA+LHH+C+P  IH+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  820   STPPLSWDVRYRIILGTAKGLAYLHHTCRPATIHFNLKPTNILLDEKNNPKISDFGLSRL  879

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  880   LTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  939

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  940   SFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  999

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+R+
Sbjct  1000  QILQVINSPVPHRI  1013



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 170/193 (88%), Gaps = 1/193 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W  R++IILGTAKGLA+LHH+C+P  IH+N+KPSNILLDE  NPKISDFGL+RL
Sbjct  818   STPPLSWDARYRIILGTAKGLAYLHHTCRPTTIHFNLKPSNILLDEKYNPKISDFGLSRL  877

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             V +    + +NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED 
Sbjct  878   VTQDGNTMNNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDI  937

Query  363   VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
              +IL+DHVR++LEQGNVLEC+D  M   Y ++EVLPV+KLALVCTSQIPS+RP+MAE+VQ
Sbjct  938   FVILSDHVRIMLEQGNVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIPSNRPTMAEIVQ  997

Query  540   ILQVIKTPVPNRM  578
             ILQVI +PVP+RM
Sbjct  998   ILQVITSPVPHRM  1010



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  6     TPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLV  185
             TPPL+W  R++IILGTAKGLA+LHH+C+P  IH+N+KPSNILLDE  NPKISDFGL+RLV
Sbjct  819   TPPLSWDARYRIILGTAKGLAYLHHTCRPTTIHFNLKPSNILLDEKYNPKISDFGLSRLV  878

Query  186   AKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNV  365
              +    + +NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED  
Sbjct  879   TQDGNTMNNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDIF  938

Query  366   LILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQI  542
             +IL+DHVR++LEQGNVLEC+D  M   Y ++EVLPV+KLALVCTSQIPS+RP+MAE+VQI
Sbjct  939   VILSDHVRIMLEQGNVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIPSNRPTMAEIVQI  998

Query  543   LQVIKTPVPNRM  578
             LQVI +PVP+RM
Sbjct  999   LQVITSPVPHRM  1010



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   299 bits (766),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 140/194 (72%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TP L+W  R++IILGTAKGLA+LHH+ +PP +H+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  821   STPALSWDARYRIILGTAKGLAYLHHTFRPPTVHFNLKPTNILLDEKYNPKISDFGLSRL  880

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  881   LTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  940

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  941   SFVILSDHVRVMLEQGNVLECIDPVMEQEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  1000

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+RM
Sbjct  1001  QILQVINSPVPHRM  1014



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W VR+KIILGTAKGLA+LHH+ +P  IH+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  819   STPPLSWDVRYKIILGTAKGLAYLHHTFRPTTIHFNLKPTNILLDEKNNPKISDFGLSRL  878

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  879   LTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  938

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  939   SFVILSDHVRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  998

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+R+
Sbjct  999   QILQVINSPVPHRI  1012



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   298 bits (762),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 170/194 (88%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL W  R++IILGTAKGLA+LHH+ +P  +H+N+KP+NILLDE  NPKISDFGLARL
Sbjct  814   STPPLPWDARYRIILGTAKGLAYLHHTFRPATVHFNLKPTNILLDEKYNPKISDFGLARL  873

Query  183   VAKLDRHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  874   LTTQDGNTMNTNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  933

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  934   SFVILSDHVRVLLEQGNVLECIDPTMEEEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  993

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+R+
Sbjct  994   QILQVISSPVPHRI  1007



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  R  I+ G AKG+AHLHH  QPPIIHYNIKP+NILLDE LNPKISDFGLARL+ K 
Sbjct  784  LSWQNRLNIVNGIAKGIAHLHHDFQPPIIHYNIKPTNILLDEKLNPKISDFGLARLLGKF  843

Query  195  DRHVM--SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
            D  ++  SNR QA  GY APEL C+SLRVNEKCDVYGFG+LILE+VTG++PVE+GE NV+
Sbjct  844  DSKLLDRSNRSQAESGYAAPELTCRSLRVNEKCDVYGFGVLILELVTGKKPVEHGEGNVV  903

Query  369  ILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            IL+D VR LLEQGN+  CVD+ MG YP+EEVLPV+KLALVCTSQIPSSRPSMAEVVQILQ
Sbjct  904  ILSDRVRELLEQGNISRCVDKRMGPYPEEEVLPVIKLALVCTSQIPSSRPSMAEVVQILQ  963

Query  549  VIKTPVPNRMEPY  587
            VIK P+PNRM  +
Sbjct  964  VIKAPLPNRMTAF  976



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W VR++IILGTAKGLA+LHH+ +P  +H+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  820   STPPLSWDVRYRIILGTAKGLAYLHHTFRPATVHFNLKPTNILLDEKNNPKISDFGLSRL  879

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  880   LTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  939

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  940   SFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  999

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+R+
Sbjct  1000  QILQVINSPVPHRI  1013



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   295 bits (756),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W VR++IILGTAKGLA+LHH+ +P  IH+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  817   STPPLSWDVRYRIILGTAKGLAYLHHTFRPATIHFNLKPTNILLDEKNNPKISDFGLSRL  876

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  877   LTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGED  936

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  937   SFVILSDHVRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  996

Query  537   QILQVIKTPVPNRM  578
             QILQVI +PVP+++
Sbjct  997   QILQVINSPVPHQI  1010



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 169/193 (88%), Gaps = 2/193 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             + PPL+W  R++IILGTAKGLA+LHH+C+P  IH+N+KPSNILLDE  N KISDFGL+ L
Sbjct  818   SAPPLSWDARYRIILGTAKGLAYLHHTCRPTTIHFNLKPSNILLDEKYNRKISDFGLSCL  877

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             V + D + M+NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+
Sbjct  878   VTQ-DGNTMNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDS  936

Query  363   VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
              +IL+DHVRV+LEQG VLEC+D  M   Y ++EVLPV+KLALVCTSQIPS+RP+MAE+VQ
Sbjct  937   FVILSDHVRVMLEQGTVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIPSNRPTMAEIVQ  996

Query  540   ILQVIKTPVPNRM  578
             ILQVI +PVP+RM
Sbjct  997   ILQVITSPVPHRM  1009



>ref|XP_006646695.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=975

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 167/202 (83%), Gaps = 7/202 (3%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A PPLTW  RF+++ G A+ LAHLH S +PP+IHYN+KPSNILLDE  NP ++DFGLARL
Sbjct  773  ALPPLTWPERFRVVAGVARALAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVADFGLARL  832

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLD+H++S+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+L+LE+VTGRR VEY +D+
Sbjct  833  LPKLDKHMISSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLVLELVTGRRAVEYSDDD  892

Query  363  VLILNDHVRVLLEQG--NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
            V+IL D VRVLL+ G  NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSM EVV
Sbjct  893  VVILIDQVRVLLDHGGNNVLECVDPALGEFPEEEVLPVLKLGMVCTSQIPSNRPSMVEVV  952

Query  537  QILQVIKTPV-----PNRMEPY  587
            QILQVIK PV       RME +
Sbjct  953  QILQVIKAPVAASPSATRMEAF  974



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   290 bits (743),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +TPPL+W  R++IILG AKGL +LHH+ +P  +H+N+KP+NILLDE  NPKISDFGL+RL
Sbjct  821   STPPLSWDARYRIILGLAKGLEYLHHTLRPTTVHFNLKPTNILLDEKYNPKISDFGLSRL  880

Query  183   VAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  359
             +   D + M+N RFQ A+GYVAPEL CQ+LR NEKCDVYGFG+LILE+VTGRRPVEYGED
Sbjct  881   LTTQDGNTMNNNRFQNALGYVAPELECQNLRANEKCDVYGFGVLILELVTGRRPVEYGED  940

Query  360   NVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  536
             + +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V
Sbjct  941   SFVILSDHVRVLLEQGNVLECIDPVMEEEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIV  1000

Query  537   QILQVIKTPVPNRM  578
             +ILQ+I +PVP+RM
Sbjct  1001  KILQIINSPVPHRM  1014



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 157/192 (82%), Gaps = 4/192 (2%)
 Frame = +3

Query  9     PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  188
             PP+TW  RF+++ GTA+GLAHLH + +PP+IHY++KPSNI LDE  NP + DFGLARL  
Sbjct  836   PPMTWEERFRVVSGTARGLAHLHQAFRPPLIHYDVKPSNIFLDERCNPAVGDFGLARL--  893

Query  189   KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
              L R     R+    GYVAPELACQSLRVNEKCD+YG G++ILE+VTGRR VEYG+D+V+
Sbjct  894   -LPRPEQQRRYALGSGYVAPELACQSLRVNEKCDIYGLGVVILEVVTGRRAVEYGDDDVV  952

Query  369   ILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQIL  545
             +L D VRVLLE GN LECVD GMGG +P+EEVLPVLKL +VCTSQIPS+RPSMAEVVQIL
Sbjct  953   VLQDQVRVLLEHGNALECVDPGMGGAFPEEEVLPVLKLGMVCTSQIPSNRPSMAEVVQIL  1012

Query  546   QVIKTPVPNRME  581
             QVIK PV  RME
Sbjct  1013  QVIKAPVGGRME  1024



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +3

Query  9    PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  188
            PPL+W +RF+I LGTA GLAHLHH C P +IHY++K SN+LLD+    +ISD+ LA+L+ 
Sbjct  789  PPLSWRLRFRIALGTALGLAHLHHGCVPSLIHYDVKSSNVLLDDEYEARISDYSLAKLLP  848

Query  189  KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
            KLD +VMS++ Q+A+GY+APE ACQSL++ EKCDVYGFG+L+LE+VTGRRPVEY ED+V+
Sbjct  849  KLDTYVMSSKMQSALGYMAPEFACQSLKITEKCDVYGFGVLLLELVTGRRPVEYMEDDVV  908

Query  369  ILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            IL D VR LL++G  L CVD  +  +P++EVLP++KL L+CTSQ+PS+RPSMAEVVQIL+
Sbjct  909  ILCDFVRALLDEGRALSCVDSKLLSFPEDEVLPIIKLGLICTSQVPSNRPSMAEVVQILE  968

Query  549  VIKTPVPNR  575
            +I+  V +R
Sbjct  969  LIRPLVESR  977



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  9    PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  188
            PPL W  RFKI LGTA GL HLHH C P +IHYN+K +NILL  N   +ISD+GLA+L+ 
Sbjct  757  PPLRWEDRFKIALGTALGLGHLHHGCHPQVIHYNLKSTNILLSHNNVVRISDYGLAKLLP  816

Query  189  KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
             LD +VMS++FQ+A+GY+APE AC SLR+ EKCDVYGFG+L+LE+VTGRRPVEY ED+V+
Sbjct  817  ALDSYVMSSKFQSALGYMAPEFACPSLRITEKCDVYGFGVLLLELVTGRRPVEYMEDDVV  876

Query  369  ILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            IL DHVR LLE+G  L CVD  M  YP++EVLPV+KL L+CTS +PS+RPSM EVVQIL+
Sbjct  877  ILCDHVRALLEEGRPLSCVDSHMNSYPEDEVLPVIKLGLICTSHVPSNRPSMEEVVQILE  936

Query  549  VIK  557
            +I+
Sbjct  937  LIR  939



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   259 bits (663),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  9    PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  188
            PPL W  RFKI LGTA GL HLHH CQP +IHY++K +NILL  N    ISD+GLARL+ 
Sbjct  772  PPLQWDDRFKIALGTALGLGHLHHGCQPQVIHYDLKSTNILLSHNNEAHISDYGLARLLP  831

Query  189  KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
             LDR+++ ++FQ+A+GY+APE +C SLR+ EKCDVYGFG+L+LE+VTGRRPVEY ED+V+
Sbjct  832  TLDRYILGSKFQSALGYMAPEFSCPSLRITEKCDVYGFGVLLLELVTGRRPVEYMEDDVV  891

Query  369  ILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            IL DHVR LLE G  L CVD  M  YP++EVLPV+KLAL+CTS +PS+RP+M EVVQIL+
Sbjct  892  ILCDHVRALLEGGRPLTCVDSTMLPYPEDEVLPVIKLALICTSHVPSNRPAMEEVVQILE  951

Query  549  VIKTPVP  569
            +I+ P+P
Sbjct  952  LIR-PIP  957



>ref|NP_001136621.1| uncharacterized protein LOC100216746 [Zea mays]
 gb|ACF82284.1| unknown [Zea mays]
Length=437

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 8/196 (4%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-DENLNPKISDFGLARLVA-  188
            +TW  RF+++ GTA+ LAHLHH+ +PP++HYN+KPSNI L D   NP + +FGLARL+A 
Sbjct  240  MTWEERFRVLSGTARALAHLHHAFRPPLVHYNVKPSNIFLADAECNPAVGEFGLARLLAD  299

Query  189  ---KLDRHVMSNRFQ-AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGE  356
               +    +   RFQ    GYVAPELACQSLRVNEKCD+YG G+LILE+VTGRR VEYG+
Sbjct  300  GGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGLGVLILELVTGRRAVEYGD  359

Query  357  DNVLILNDHVRVLLEQGNVLECVDQGMGGY-PDEEVLPVLKLALVCTSQIPSSRPSMAEV  533
            D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL +VCTSQIPS+RPSMAEV
Sbjct  360  DDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKLGMVCTSQIPSNRPSMAEV  419

Query  534  VQILQVIKTPVPNRME  581
            VQILQVIK PV  RME
Sbjct  420  VQILQVIKAPV-GRME  434



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score =   257 bits (657),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 156/198 (79%), Gaps = 12/198 (6%)
 Frame = +3

Query  9     PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNI-LLDENLNPKISDFGLARLV  185
             PP+TW  RF+++ GTA+ LAHLH + +PP++HYN+KPSNI LLD   NP + DFGLARL+
Sbjct  849   PPMTWEERFRVVSGTARALAHLHQAFRPPLVHYNVKPSNIFLLDAECNPAVGDFGLARLL  908

Query  186   AKLDRHVMSN--RFQAAIG-----YVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPV  344
                 +       RF AA G     YVAPELACQSLRVNEKCD+YG G+LILE+VTGRR V
Sbjct  909   PVPGKLADGGCGRFHAAGGGGGMGYVAPELACQSLRVNEKCDIYGLGVLILELVTGRRAV  968

Query  345   EYGEDNVLILNDHVRVLLEQGNVLECVDQGM---GGY-PDEEVLPVLKLALVCTSQIPSS  512
             EYG+D+V++L D VRVLLE GN LECVD GM   GG+ P+EEVLPVLKLA+VCTSQIPS+
Sbjct  969   EYGDDDVVVLMDQVRVLLEHGNALECVDPGMGMGGGHVPEEEVLPVLKLAMVCTSQIPSN  1028

Query  513   RPSMAEVVQILQVIKTPV  566
             RPSMAEVVQILQVIK PV
Sbjct  1029  RPSMAEVVQILQVIKAPV  1046



>ref|XP_006840189.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 154/194 (79%), Gaps = 4/194 (2%)
 Frame = +3

Query  6    TPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLV  185
            +P L+WA+RFKI LG AK LAHLHH+C+P I+HY +KPSN+LLD N  PK+SD+GL RL 
Sbjct  786  SPSLSWAIRFKIALGVAKSLAHLHHACRPTIVHYGLKPSNVLLDANCIPKLSDYGLVRLF  845

Query  186  AKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNV  365
            + L +  +S     + GY+APEL C SL VNEKCDVY FG+L+LEIV+GRR VEY ED++
Sbjct  846  SSLGKRGLS----MSPGYMAPELTCGSLCVNEKCDVYSFGVLLLEIVSGRRAVEYREDDM  901

Query  366  LILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQIL  545
            ++L + VR ++E+G  LECVD  M  Y +EEV+P+L+L LVCTSQ+PSSRPSMAEVVQIL
Sbjct  902  VMLCEDVRSMVERGRGLECVDMKMEEYAEEEVVPLLRLGLVCTSQVPSSRPSMAEVVQIL  961

Query  546  QVIKTPVPNRMEPY  587
            QVIKTPVP RME +
Sbjct  962  QVIKTPVPERMEVF  975



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 152/197 (77%), Gaps = 12/197 (6%)
 Frame = +3

Query  12    PLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-DENLNPKISDFGLARLV-  185
             P+TW  RF+++ GTA+ LAHLH + +P ++HYN+KPSNILL D   NP + DFGLARL+ 
Sbjct  847   PMTWEERFRVVSGTARALAHLHQAFRPALVHYNVKPSNILLADAECNPAVGDFGLARLLH  906

Query  186   -AKLDRHVM--SNRFQ----AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPV  344
              +   R V    +RF+      +GYVAPELACQSLR N+KCDVYG G+LILE+VTGRR V
Sbjct  907   GSGSGRQVAMAGSRFRQGGGGGMGYVAPELACQSLRANDKCDVYGVGVLILELVTGRRAV  966

Query  345   EYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGY---PDEEVLPVLKLALVCTSQIPSSR  515
             EYG+D+V++L D VR LLE GN LECVD GMGG    P+EEV+PVLKL +VC SQIPS+R
Sbjct  967   EYGDDDVVVLTDQVRALLEHGNALECVDPGMGGRGHVPEEEVVPVLKLGMVCASQIPSNR  1026

Query  516   PSMAEVVQILQVIKTPV  566
             PSMAEVVQILQVIK PV
Sbjct  1027  PSMAEVVQILQVIKAPV  1043



>ref|XP_006842493.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF++ILG A+GLA LH SC+P ++HYN+K SN+L+DEN   K+ DFGLARL+  L
Sbjct  791  LTWLERFRVILGVARGLAFLHESCRPAVVHYNVKSSNVLIDENGEAKVGDFGLARLLPML  850

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC S RV+EKCDVYGFG+L LEI+TGRRPVEY ED+V+IL
Sbjct  851  DRYVLSSKIQSALGYMAPEFACGSARVSEKCDVYGFGVLTLEIITGRRPVEYTEDDVVIL  910

Query  375  NDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            +D VR  LE G V  CVD  MG  +P+E ++P++KLAL+C SQ+PS+RP+M EVV IL+V
Sbjct  911  SDSVRGALEGGRVGSCVDPRMGPAWPEEVLVPLVKLALICASQVPSNRPAMGEVVHILEV  970

Query  552  IKTP  563
            I +P
Sbjct  971  IGSP  974



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score =   247 bits (631),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 123/198 (62%), Positives = 151/198 (76%), Gaps = 10/198 (5%)
 Frame = +3

Query  12    PLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK  191
             P+TW  RF++I GTA GLAHLHHS +PP+IHYN+KPSNILLD   NP ISDFGLARL  +
Sbjct  860   PMTWEERFRVISGTASGLAHLHHSFRPPLIHYNVKPSNILLDSRCNPLISDFGLARLQPE  919

Query  192   LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
                   + +   A+GY APE+AC SLRVNEKCDVYGFG+++LE VTGRR VEYG+D+V +
Sbjct  920   TSP---NEKRGGAMGYAAPEVACGSLRVNEKCDVYGFGVVVLETVTGRRAVEYGDDDVAV  976

Query  372   LNDHVRVLLEQ-----GNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEV  533
             L D VR  LE      G VL+ VD  MGG +P+EE +PVLKL +VCTSQ+PS+RPSMAEV
Sbjct  977   LVDQVRSALETTTTRGGGVLDWVDPAMGGEFPEEEAVPVLKLGIVCTSQVPSNRPSMAEV  1036

Query  534   VQILQVIKTPVPNRMEPY  587
             VQ+L VI+ P+P  MEP+
Sbjct  1037  VQVLHVIRAPLPG-MEPF  1053



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 8/196 (4%)
 Frame = +3

Query  15    LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-DENLNPKISDFGLARLVA-  188
             +TW  RF+++ GTA+ LAHLHH+ +PP++HYN+KPSNI L D   NP + +FGLARL+A 
Sbjct  846   MTWEERFRVLSGTARALAHLHHAFRPPLVHYNVKPSNIFLADAECNPAVGEFGLARLLAD  905

Query  189   ---KLDRHVMSNRFQ-AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGE  356
                +    +   RFQ    GYVAPELACQSLRVNEKCD+YG G+LILE+VTGRR VEYG+
Sbjct  906   GGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGLGVLILELVTGRRAVEYGD  965

Query  357   DNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEV  533
             D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL +VCTSQIPS+RPSMAEV
Sbjct  966   DDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKLGMVCTSQIPSNRPSMAEV  1025

Query  534   VQILQVIKTPVPNRME  581
             VQILQVIK PV  RME
Sbjct  1026  VQILQVIKAPV-GRME  1040



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 8/196 (4%)
 Frame = +3

Query  15    LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-DENLNPKISDFGLARLVA-  188
             +TW  RF+++ GTA+ LAHLHH+ +PP++HYN+KPSNI L D   NP + +FGLARL+A 
Sbjct  953   MTWEERFRVLSGTARALAHLHHAFRPPLVHYNVKPSNIFLADAECNPAVGEFGLARLLAD  1012

Query  189   ---KLDRHVMSNRFQ-AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGE  356
                +    +   RFQ    GYVAPELACQSLRVNEKCD+YG G+LILE+VTGRR VEYG+
Sbjct  1013  GGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGLGVLILELVTGRRAVEYGD  1072

Query  357   DNVLILNDHVRVLLEQGNVLECVDQGMGGY-PDEEVLPVLKLALVCTSQIPSSRPSMAEV  533
             D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL +VCTSQIPS+RPSMAEV
Sbjct  1073  DDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKLGMVCTSQIPSNRPSMAEV  1132

Query  534   VQILQVIKTPVPNRME  581
             VQILQVIK PV  RME
Sbjct  1133  VQILQVIKAPV-GRME  1147



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 153/209 (73%), Gaps = 22/209 (11%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             A PPLTWA RF+++ GTA+GLA+LH S +PP+IHYN+KPSNILLD   NP I+DFGLARL
Sbjct  834   AFPPLTWAERFRVVAGTARGLAYLHQSFRPPVIHYNLKPSNILLDSRCNPLIADFGLARL  893

Query  183   VAKLDR-----------HVMSNRF--QAAIGYVAPELACQSLRVNEKCDVYGFGMLILEI  323
             + K  +            + S RF   AA+GY APELAC SLRVNEKCDVYGFG+L+LE+
Sbjct  894   LRKPKQQQQQPEGNGVGAMGSCRFMQSAAMGYAAPELACSSLRVNEKCDVYGFGVLVLEL  953

Query  324   VTGRRPVEYGEDNVLILNDHVRVLLEQGNVL--------ECVDQGM-GGYPDEEVLPVLK  476
             VTGRR VEYGED+V +L D VRV LEQG             VD  + G +P+EE LPVLK
Sbjct  954   VTGRRAVEYGEDDVAVLTDQVRVALEQGAGGDDDDAAAERVVDPALRGEFPEEEALPVLK  1013

Query  477   LALVCTSQIPSSRPSMAEVVQILQVIKTP  563
             L +VCTSQIPS+RPSMAEVVQILQVI+ P
Sbjct  1014  LGVVCTSQIPSNRPSMAEVVQILQVIRAP  1042



>ref|XP_002972654.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
 gb|EFJ25875.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
Length=927

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  9    PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  188
            PPL+W+ RFKI  GTA GL+HLHHSCQP +IHY++K +NILL  +  P ISD+GLA L+ 
Sbjct  728  PPLSWSERFKIAQGTAMGLSHLHHSCQPQVIHYDLKSNNILLGVDNRPLISDYGLANLLP  787

Query  189  KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
             LDR+ +S++FQ A+GY+APE A QS +V EKCDVYGFG+++LE+VTGRRPVEY E++V+
Sbjct  788  VLDRYAISSKFQGALGYMAPEFASQSSKVTEKCDVYGFGIILLELVTGRRPVEYMEEDVV  847

Query  369  ILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            IL D+VR LL +G  + CV+  +   P++EVLPV+KL L+C+S +PS+RPSMAEVVQIL+
Sbjct  848  ILCDYVRALLNEGRGMSCVEPSLEASPEDEVLPVIKLGLICSSPLPSNRPSMAEVVQILE  907

Query  549  VIKTPVP  569
            +++ P+P
Sbjct  908  LVR-PLP  913



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LAHLHHS    IIHYNIK +N+LLD    PK+ DFGLARL+  L
Sbjct  790  LSWNERFNVILGTAKALAHLHHS---NIIHYNIKSTNVLLDSYGEPKVGDFGLARLLPML  846

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  847  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  906

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  907  CDMVRGALEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  966

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  967  IRCPSEGQEE  976



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LAHLHHS    IIHYNIK +N+LLD    PK+ DFGLARL+  L
Sbjct  783  LSWNERFNVILGTAKALAHLHHS---NIIHYNIKSTNVLLDSYGEPKVGDFGLARLLPML  839

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  840  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  899

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  900  CDMVRGALEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  959

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  960  IRCPSEGQEE  969



>ref|XP_002988156.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
 gb|EFJ10948.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
Length=864

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  9    PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  188
            PPL+W+ RFKI  GTA GL+HLHHSCQP +IHY++K +NILL  +  P ISD+GLA L+ 
Sbjct  682  PPLSWSERFKIAQGTAMGLSHLHHSCQPQVIHYDLKSNNILLGVDNRPLISDYGLANLLP  741

Query  189  KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
             LDR+ +S++FQ A+GY+APE A QS +V EKCDVYGFG+++LE+VTGRRPVEY E++V+
Sbjct  742  VLDRYAISSKFQGALGYMAPEFASQSSKVTEKCDVYGFGIILLELVTGRRPVEYMEEDVV  801

Query  369  ILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            IL D+VR LL +G  + CV+  +   P++EVLPV+KL L+C+S +PS+RPSMAEVVQIL+
Sbjct  802  ILCDYVRALLNEGRGMSCVEPSLEACPEDEVLPVIKLGLICSSPLPSNRPSMAEVVQILE  861

Query  549  VIK  557
            +++
Sbjct  862  LVR  864



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF+IILGTAKGLAHLH S    IIHYNIK SNIL+D +  PK++DFGLARL+  L
Sbjct  796  LSWHDRFRIILGTAKGLAHLHES---NIIHYNIKSSNILIDGSGEPKVADFGLARLLPML  852

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L++E+VTG+RPVEY ED+V+IL
Sbjct  853  DRYILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVMEVVTGKRPVEYMEDDVVIL  912

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP M+EVV IL++
Sbjct  913  CDMVRGALEEGRVEECVDERLQGKFPVEEAIPVMKLGLICTSQVPSNRPDMSEVVNILEL  972

Query  552  IKTP  563
            I+ P
Sbjct  973  IRCP  976



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTA+GLAHLH   Q  IIHYNIK SNIL++ +  PK++DFGLARL+  L
Sbjct  784  LSWNERFNIILGTARGLAHLH---QMNIIHYNIKSSNILIESSGEPKVADFGLARLLPML  840

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEIVTG+RPVEY ED+V++L
Sbjct  841  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLALEIVTGKRPVEYMEDDVVVL  900

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  901  CDMVRGALEEGRVEECIDGRLQGNFPSEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  960

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  961  IRCPSEGQDE  970



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF+IILGTAKGLAHLH S    IIHYNIK SN+L+D +  PK++DFGLARL+  L
Sbjct  800  LSWHDRFRIILGTAKGLAHLHESG---IIHYNIKSSNVLIDGSGEPKVADFGLARLLPML  856

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L++E+VTG+RPVEY ED+V++L
Sbjct  857  DRYILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVMEVVTGKRPVEYMEDDVVVL  916

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP M+EVV IL++
Sbjct  917  CDMVRGALEEGRVEECVDERLQGKFPVEEAIPVMKLGLICTSQVPSNRPDMSEVVNILEL  976

Query  552  IKTP  563
            I+ P
Sbjct  977  IRCP  980



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LAHLHHS    IIHYNIK +N+L+D    PK+ DFGLARL+  L
Sbjct  781  LSWNERFNVILGTAKALAHLHHS---NIIHYNIKSTNVLIDSYGEPKVGDFGLARLLPML  837

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  838  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  897

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V EC+D+ + G +P EEV+PV+KL LVCTSQ+PS+RP M EVV IL++
Sbjct  898  CDMVRGALDEGRVEECIDERLQGKFPVEEVIPVIKLGLVCTSQVPSNRPDMGEVVTILEL  957

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  958  IRCPSEGQEE  967



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ DFGLARL+  L
Sbjct  794  LSWNDRFSIILGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKVGDFGLARLLPML  850

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++L
Sbjct  851  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEVVTGKRPVEYMEDDVVVL  910

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  911  CDMVRGALEEGRVDECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  970

Query  552  IKTP  563
            I+ P
Sbjct  971  IRCP  974



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
             TW  RF IILGTAK LAHLH   Q  IIHYN+K SN+L+D +  PK++DFGLARL+  L
Sbjct  781  FTWNERFNIILGTAKSLAHLH---QMSIIHYNLKSSNVLIDPSGEPKVADFGLARLLPML  837

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  838  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  897

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  898  CDMVRGALEEGKVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  957

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  958  IRCPSEGQEE  967



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  L
Sbjct  775  LSWNERFNIILGTAKSLAHLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPML  831

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V +L
Sbjct  832  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVAVL  891

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  + G +P +EV+PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  892  CDMVRGALEEGRVEECIDDRLQGNFPADEVVPVMKLGLICTSQVPSNRPDMGEVVNILEL  951

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  952  IRCPSEGQDE  961



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  L
Sbjct  787  LSWNDRFSIILGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKLGDYGLARLLPML  843

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++NEKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  844  DRYVLSSKIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  903

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  904  CDMVRGALEEGRVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  963

Query  552  IKTP  563
            I+ P
Sbjct  964  IRCP  967



>ref|XP_004173628.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Cucumis sativus]
Length=774

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAKGLAHLH   Q   IHYNIK SNIL+D N  PK+ D+GLARL+  L
Sbjct  586  LSWNERFDIILGTAKGLAHLH---QSNTIHYNIKSSNILIDRNGQPKVGDYGLARLLPML  642

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V +L
Sbjct  643  DRYVLSSKIQSALGYMAPEFTCRTVKITEKCDVYGFGILILEVVTGKRPVEYMEDDVAVL  702

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            +D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS +PS+RP M E+V+IL++
Sbjct  703  SDMVREAVEEGRAEECVDRNLRGSFPMEEAVPVLKLGLICTSHVPSNRPDMREMVKILEM  762

Query  552  IKTP  563
            IK P
Sbjct  763  IKCP  766



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RFKIILGTAKGLAHLH   Q  +IHYN+K +N+L+D +  PK+ DFGLARL+  L
Sbjct  791  LTWQQRFKIILGTAKGLAHLH---QLNVIHYNMKSTNVLMDFSGEPKVGDFGLARLLPAL  847

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L LE++TGRRPVEY ED+V++L
Sbjct  848  DRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLTLEVLTGRRPVEYMEDDVVVL  907

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G + EC+D+ + G YP EE +PV+KL L+C SQ+PS+RP M EV++IL++
Sbjct  908  CDMVREALDEGRIEECIDKKLEGKYPMEEAIPVVKLGLICASQVPSNRPDMEEVIRILEL  967

Query  552  IKTPVPNRME  581
            I+ P  ++ E
Sbjct  968  IQCPTESQEE  977



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+LLD +  PK+ DFGLARL+  L
Sbjct  775  LSWNERFNIILGTAKSLAHLH---QSNIIHYNIKSSNVLLDSSGEPKVGDFGLARLLPML  831

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  832  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  891

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD + MG +P +EV+PV+KL L+CT Q+PS+RP M EV+ IL +
Sbjct  892  CDMVRGALEEGRVEECVDGRLMGNFPADEVVPVMKLGLICTLQVPSNRPDMGEVINILDL  951

Query  552  IKTP  563
            I+ P
Sbjct  952  IRCP  955



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+LLD +  PK+ DFGLARL+  L
Sbjct  775  LSWNERFNIILGTAKSLAHLH---QSNIIHYNIKSSNVLLDSSGEPKVGDFGLARLLPML  831

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  832  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  891

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD + MG +P +EV+PV+KL L+CT Q+PS+RP M EV+ IL +
Sbjct  892  CDMVRGALEEGRVEECVDGRLMGNFPADEVVPVMKLGLICTLQVPSNRPDMGEVINILDL  951

Query  552  IKTP  563
            I+ P
Sbjct  952  IRCP  955



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LAHLH   Q  IIHYNIK +N+LLD     KI DFGLARL+  L
Sbjct  766  LSWNERFNVILGTAKALAHLH---QSNIIHYNIKSTNVLLDSYGEAKIGDFGLARLLPML  822

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  823  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVL  882

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  883  CDMVRGALEEGRVEECIDERLEGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  942

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  943  IRCPSEGQEE  952



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG AKGLAHLH   Q  +IHYN+K SNIL+D +  PK++D GLARL+  L
Sbjct  796  LSWNERFNIILGAAKGLAHLH---QMKVIHYNLKSSNILIDSSGEPKVADCGLARLLPML  852

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  853  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVL  912

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  913  CDMVRGSLEEGKVEECVDDRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  972

Query  552  IKTPVPNRME  581
            I+ P  ++ E
Sbjct  973  IRCPSESQDE  982



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 156/194 (80%), Gaps = 4/194 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A   L+W  RF IILG AKGLAHLH   Q  +IHYN+K SNIL+D +  PK++D+GLA+L
Sbjct  777  AESYLSWNERFNIILGAAKGLAHLH---QMNVIHYNLKSSNILIDSSGEPKVADYGLAKL  833

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+
Sbjct  834  LPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDD  893

Query  363  VLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L+D VR  +E+G V +CVD + +G +P +E +PV+KL L+CTSQ+PS+RP MAEVV 
Sbjct  894  VVVLSDMVRGAMEEGKVEDCVDARFLGKFPVDEAIPVIKLGLICTSQVPSNRPDMAEVVN  953

Query  540  ILQVIKTPVPNRME  581
            IL++I++P  ++ E
Sbjct  954  ILELIRSPSESQDE  967



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILGTAK LAHLH   Q  IIHYN+K SNIL+D +  PK++D+GLARL+  L
Sbjct  705  LTWNERFSIILGTAKSLAHLH---QMNIIHYNLKSSNILIDSSGEPKVADYGLARLLPML  761

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++L
Sbjct  762  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLILEVVTGKRPVEYMEDDVVVL  821

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D  + G +P +E +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  822  CDMVRGALEEGRIEDCIDTRLQGKFPADEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  881

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  882  IRCPSEGQDE  891



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   236 bits (603),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILGTAK LAHLH   Q  IIHYN+K SNIL+D +  PK++D+GLARL+  L
Sbjct  706  LTWNERFSIILGTAKSLAHLH---QMNIIHYNLKSSNILIDGSGEPKVADYGLARLLPML  762

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++L
Sbjct  763  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLILEVVTGKRPVEYMEDDVVVL  822

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D+ + G +P +E +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  823  CDMVRGALEEGRIEDCIDKRLQGKFPADEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  882

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  883  IRCPSEGQDE  892



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYN+K SN+L+D +  PK+ D+GLARL+  L
Sbjct  787  LSWNDRFSIILGTAKSLAHLH---QSNIIHYNLKSSNVLIDGSGEPKLGDYGLARLLPML  843

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++NEKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  844  DRYVLSSKIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  903

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  904  CDMVRGALEEGRVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  963

Query  552  IKTP  563
            I+ P
Sbjct  964  IRCP  967



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+ ++  PK+ DFGLARL+  L
Sbjct  781  LSWNDRFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLISDSGEPKVGDFGLARLLPML  837

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  838  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  897

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  898  CDMVRGALEEGRVEECIDSRLQGSFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  957

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  958  IRCPSEGQEE  967



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   237 bits (604),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTA+ LAHLH   Q  +IHYN+K SN+L+D N  PK+ DFGLARL+  L
Sbjct  782  LSWHERFNIILGTARSLAHLH---QLNVIHYNLKSSNVLIDSNGEPKVGDFGLARLLPML  838

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  839  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  898

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V +CVD  + G +P EE +PV+KL L+CTSQ+PS+RP+MAEVV IL++
Sbjct  899  CDMVRGALEEGRVEQCVDGRLSGNFPAEEAIPVMKLGLICTSQVPSNRPNMAEVVNILEL  958

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  959  IRCPSEGQEE  968



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAKGLAHLH   Q   IHYNIK SNIL+D N  PK+ D+GLARL+  L
Sbjct  737  LSWNERFDIILGTAKGLAHLH---QSNTIHYNIKSSNILIDRNGQPKVGDYGLARLLPML  793

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V +L
Sbjct  794  DRYVLSSKIQSALGYMAPEFTCRTVKITEKCDVYGFGILILEVVTGKRPVEYMEDDVAVL  853

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            +D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS +PS+RP M E+V+IL++
Sbjct  854  SDMVREAVEEGRAEECVDRNLRGSFPMEEAVPVLKLGLICTSHVPSNRPDMREMVKILEM  913

Query  552  IKTP  563
            IK P
Sbjct  914  IKCP  917



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   236 bits (603),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 154/190 (81%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAKG+A+LH   Q  IIHYN+K SNIL+D + +PK++D+GLARL+  L
Sbjct  783  LSWNERFNVILGTAKGMANLH---QMNIIHYNLKSSNILIDSSGDPKVADYGLARLLPML  839

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVTG++PVEY ED+V++L
Sbjct  840  DRYVLSSKIQSALGYMAPEFACKTVKITDKCDVYGFGVLVLEIVTGKKPVEYMEDDVIVL  899

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  900  CDMVRGALEEGKVEECVDKRLHGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEM  959

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  960  IRCPSEGQEE  969



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   236 bits (603),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  L
Sbjct  788  LSWNDRFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPML  844

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  845  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  904

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  905  CDMVRGALEEGRVEECIDGRLQGNFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  964

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  965  IRCPSEGQEE  974



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 154/192 (80%), Gaps = 4/192 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAKGLA+LH   +  IIHYN+K SNIL+D + +PK++D+GLARL+  L
Sbjct  781  LSWNERFNVILGTAKGLANLH---RMNIIHYNLKSSNILIDSSGDPKVADYGLARLLPML  837

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L
Sbjct  838  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVMVL  897

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  898  CDIVRGALEDGKVEECVDGRLHGKFPVEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEM  957

Query  552  IKTPVPNRMEPY  587
            I+ P   + EP+
Sbjct  958  IRCPSEGQDEPH  969



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  L
Sbjct  765  LSWNDRFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPML  821

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  822  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVL  881

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  882  CDMVREALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  941

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  942  IRCPSEGQEE  951



>gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+D +   K+ DFGLARL+  L
Sbjct  772  LSWNERFNIILGTAKSLAHLH---QSNIIHYNIKSSNVLIDSSGEAKVGDFGLARLLPML  828

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG+RPVEY ED+V++L
Sbjct  829  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVITGKRPVEYMEDDVVVL  888

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+ + G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  889  CDMVRGALEEGRVEECVDERLQGNFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILEL  948

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  949  IRCPSEGQEE  958



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 155/190 (82%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAKGLA+LH   Q  IIHYN+K SNIL+D + +PK++D+GLARL+  L
Sbjct  783  LSWNERFNVILGTAKGLANLH---QMNIIHYNLKSSNILIDSSGDPKVADYGLARLLPML  839

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVTG++PVEY ED+V++L
Sbjct  840  DRYVLSSKIQSALGYMAPEFACKTVKITDKCDVYGFGVLVLEIVTGKKPVEYMEDDVIVL  899

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP+MAEVV +L++
Sbjct  900  CDMVRGALEEGKVEECVDKRLHGKFPAEEAIPVMKLGLICTSQVPSNRPNMAEVVNLLEM  959

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  960  IRWPSEGQEE  969



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  L
Sbjct  765  LSWNDRFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPML  821

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  822  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVL  881

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  882  CDMVREALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILEL  941

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  942  IRCPSEGQEE  951



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  L
Sbjct  782  LSWNDRFNVILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPML  838

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  839  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  898

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  899  CDMVRGALEEGRVEECIDGRLQGNFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  958

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  959  IRCPSEGQEE  968



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK L+HLHHS    IIHYNIK +NIL+D    PK+ D+GLARL+  L
Sbjct  798  LSWNERFNVILGTAKALSHLHHS---NIIHYNIKSTNILIDSYGEPKVGDYGLARLLPML  854

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE VTG+RPVEY ED+V++L
Sbjct  855  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLETVTGKRPVEYMEDDVVVL  914

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V EC+D+ + G +P EEV+PV+KL LVCTSQ+PS+RP M EVV IL++
Sbjct  915  CDMVRGALDEGRVEECIDERLQGKFPVEEVIPVIKLGLVCTSQVPSNRPEMGEVVTILEL  974

Query  552  IKTP  563
            I+ P
Sbjct  975  IRCP  978



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAKGLAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  L
Sbjct  786  LSWNDRFNIILGTAKGLAHLH---QMNIIHYNIKSSNVLIGCSGEPKVGDFGLARLLPML  842

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  843  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  902

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL +
Sbjct  903  CDMVRGALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILDL  962

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  963  IRCPSEGQEE  972



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILG AKGLAHLH   Q  IIHYN+K +N+L+D N  PK+ DFGLARL+  L
Sbjct  777  LTWRQRFHIILGMAKGLAHLH---QMKIIHYNLKSTNVLIDSNGEPKVGDFGLARLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYLEDDVIVL  893

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+  +G +P EE +PV+KL L+C SQ+PS+RP M+EV+ IL++
Sbjct  894  CDMVRGALEEGRVEECLDKNLLGNFPAEEAIPVVKLGLICASQVPSNRPDMSEVINILEL  953

Query  552  IKTPVPNRME  581
            I+ P     E
Sbjct  954  IQCPSEGHEE  963



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAKGLAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  L
Sbjct  786  LSWNDRFNIILGTAKGLAHLH---QMNIIHYNIKSSNVLIGCSGEPKVGDFGLARLLPML  842

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  843  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  902

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +P++KL L+CTSQ+PS+RP M EVV IL++
Sbjct  903  CDMVRGALEEGRVEECVDARLQGIFPAEEAIPMMKLGLICTSQVPSNRPDMGEVVNILEL  962

Query  552  IKTP  563
            I+ P
Sbjct  963  IRCP  966



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF II+GTAK LAHLH   Q  +IHYN+K SN+L+D +  PK++D+GLARL+  L
Sbjct  706  LSWNDRFNIIIGTAKSLAHLH---QKNVIHYNLKSSNVLIDSSGEPKVADYGLARLLPML  762

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  763  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  822

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V +C+D  M G +P +EV+PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  823  CDMVRGALEEGRVEDCIDARMQGKFPADEVIPVMKLGLICTSQVPSNRPDMGEVVNILEL  882

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  883  IRYPSEGQDE  892



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   234 bits (598),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 112/190 (59%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK  NIL+D +  PK+ DFGLARL+  L
Sbjct  753  LSWNERFNIILGTAKSLAHLH---QSNIIHYNIKSRNILIDISGEPKVGDFGLARLLPML  809

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L
Sbjct  810  DRYVLSSKIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVTGKRPVEYMEDDVVVL  869

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+  V ECVD + +G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL +
Sbjct  870  CDMVRGALEESRVEECVDGRLLGHFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILDL  929

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  930  IRCPSEGQEE  939



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  +IHYNIK  NIL+D +  PK+ DFGLARL+  L
Sbjct  777  LSWNERFNIILGTAKSLAHLH---QSNVIHYNIKSRNILIDISGEPKVGDFGLARLLPML  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L
Sbjct  834  DRYVLSSKIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD + +G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL +
Sbjct  894  CDMVRGALEEGRVEECVDGRLLGNFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILDL  953

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  954  IRCPSEGQEE  963



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   234 bits (598),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 112/190 (59%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK  NIL+D +  PK+ DFGLARL+  L
Sbjct  777  LSWNERFNIILGTAKSLAHLH---QSNIIHYNIKSRNILIDISGEPKVGDFGLARLLPML  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L
Sbjct  834  DRYVLSSKIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+  V ECVD + +G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL +
Sbjct  894  CDMVRGALEESRVEECVDGRLLGHFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILDL  953

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  954  IRCPSEGQEE  963



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 151/196 (77%), Gaps = 4/196 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILG AK LAHLHH     IIHYNIK SN+LLD +   K+ D+GLA+L
Sbjct  776  ASDTLSWQERFDIILGIAKSLAHLHH---LKIIHYNIKSSNVLLDGSGEAKVGDYGLAKL  832

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG+RPVEY ED+
Sbjct  833  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTGKRPVEYMEDD  892

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV 
Sbjct  893  VVLLCDMVREALEEGRVEECMDGRLCGKFPLEETIPVIKLGLICTSQVPSNRPDMAEVVN  952

Query  540  ILQVIKTPVPNRMEPY  587
            IL++I+ P   R E +
Sbjct  953  ILELIRCPQDGRQEEF  968



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   234 bits (596),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +I GTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  L
Sbjct  809  LSWNERFNVIQGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKVGDYGLARLLPML  865

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  866  DRYVLSSKIQSALGYMAPEFACRTVKITDKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  925

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  926  CDMVRGALEEGRVEECIDEKLQGKFPSEEAIPVMKLGLICTSQVPSNRPDMEEVVNILEL  985

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  986  IRCPSEGQEE  995



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   234 bits (596),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +I GTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  L
Sbjct  787  LSWNERFNVIQGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKVGDYGLARLLPML  843

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  844  DRYVLSSKIQSALGYMAPEFACRTVKITDKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  903

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  904  CDMVRGALEEGRVEECIDEKLQGKFPSEEAIPVMKLGLICTSQVPSNRPDMEEVVNILEL  963

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  964  IRCPSEGQEE  973



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   233 bits (595),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG AKGLAHLH   Q   IHYNIK SNIL+D N  PK+ D+GLARL+  L
Sbjct  737  LSWNERFDIILGAAKGLAHLH---QSNTIHYNIKSSNILIDCNGQPKVGDYGLARLLPML  793

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V +L
Sbjct  794  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEVVTGKRPVEYMEDDVAVL  853

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            +D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS +PS+RP M E+V+IL++
Sbjct  854  SDVVREAVEEGRAEECVDRNLRGSFPIEEAVPVLKLGLICTSHVPSNRPDMREMVKILEM  913

Query  552  IKTP  563
            IK P
Sbjct  914  IKCP  917



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  +IHYN+K SN+L+D +  PK++D+GLARL+  L
Sbjct  706  LSWNERFNIILGTAKSLAHLH---QMNVIHYNLKSSNVLIDSSGEPKVADYGLARLLPML  762

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  763  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  822

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V +C+D  + G +P +EV+PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  823  CDMVRGALEEGRVEDCIDARLQGKFPADEVIPVMKLGLICTSQVPSNRPDMGEVVNILEL  882

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  883  IRCPSEGQDE  892



>gb|KDP21865.1| hypothetical protein JCGZ_00652 [Jatropha curcas]
Length=638

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             T  L+W  RF II G AKGLAHLHH     +IHYN+K +NIL+D++  PK+ DFGLARL
Sbjct  446  TTNCLSWRQRFNIIRGIAKGLAHLHHM---NVIHYNLKSTNILIDDSGEPKVGDFGLARL  502

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+
Sbjct  503  LPMLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDD  562

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G V EC+D  + G +P EE +PV+KL L+C SQ+PS+RP M EVV 
Sbjct  563  VVVLCDMVRGALEDGRVEECIDGKLRGNFPAEEAIPVIKLGLICASQVPSNRPDMEEVVN  622

Query  540  ILQVIKTPVPNRME  581
            IL++I+ P   + E
Sbjct  623  ILELIQCPAEGQEE  636



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ DFGLARL+  L
Sbjct  776  LSWNERFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIDSSGEPKVGDFGLARLLPML  832

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  833  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  892

Query  375  NDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  +   +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  893  CDMVRRELEEGQVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVPSNRPDMAEVVNILEL  952

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  953  IRCPSEGQEE  962



>ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
Length=964

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ DFGLARL+  L
Sbjct  776  LSWNERFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIDSSGEPKVGDFGLARLLPML  832

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  833  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  892

Query  375  NDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  +   +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  893  CDMVRRELEEGRVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVPSNRPDMAEVVNILEL  952

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  953  IRCPSEGQEE  962



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ DFGLARL+  L
Sbjct  776  LSWNERFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIDSSGEPKVGDFGLARLLPML  832

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  833  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  892

Query  375  NDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D  +   +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  893  CDMVRRELEEGRVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVPSNRPDMAEVVNILEL  952

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  953  IRCPSEGQEE  962



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGLARL+  L
Sbjct  769  LTWRQRFGIILGMAKGLAHLH---QMNIIHYNLKSTNVLMDGSCEPKLGDFGLARLLPML  825

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  826  DRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLLLEVVTGKRPVEYMEDDVVVL  885

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+ + G +P EE +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  886  CDMVRGALEEGRVEECVDERLQGIFPAEEAIPVIKLGLICASQVPSNRPDMTEVVNILEL  945

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  946  IQCPSEGQEE  955



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF II+G AKGL+HLH   Q  +IHYN+K SNIL+D    PK+ DFGLARL+  L
Sbjct  788  LSWNDRFNIIVGMAKGLSHLH---QLNVIHYNLKSSNILIDGLGEPKVGDFGLARLLPML  844

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTGRRPVEY ED+V++L
Sbjct  845  DRYILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGRRPVEYMEDDVVVL  904

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++
Sbjct  905  CDMVRGALEEGKVEECVDERLQGRFPAEEAIPVMKLGLICTSQVPSNRPDMREVVNILEL  964

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  965  IRCPSEGQEE  974



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILG AKGLAHLH   Q  IIHYN+K +N+L+D N  PK+ D GLARL+  L
Sbjct  777  LTWRQRFHIILGMAKGLAHLH---QMNIIHYNLKSTNVLIDNNGEPKVGDIGLARLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVIVL  893

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+  +G +P EE +PV+KL L+C SQ+PS+RP M EV+ IL++
Sbjct  894  CDMVRGALEEGRVEECLDKNLLGNFPAEEAIPVIKLGLICASQVPSNRPDMNEVINILEL  953

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  954  IQCPSEGQEE  963



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGLARL+  L
Sbjct  777  LTWRQRFNIILGMAKGLAHLH---QINIIHYNLKSTNVLIDSSGAPKVGDFGLARLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+DQ  +G +P +E +PV+KL L+C SQ+PS+RP M EV+ IL++
Sbjct  894  CDMVRGALEEGRVEECLDQKLLGNFPADEAIPVVKLGLICASQVPSNRPDMNEVINILEL  953

Query  552  IKTP  563
            I+ P
Sbjct  954  IQCP  957



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = +3

Query  12   PLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK  191
            PL+W  RF II+G AKGLAHLH   Q  IIHYN+K SNIL+D +   K+ DFGLARL+  
Sbjct  780  PLSWHQRFNIIVGVAKGLAHLH---QIDIIHYNLKSSNILIDSSDEAKVGDFGLARLLPM  836

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTGR+PVEY ED+V++
Sbjct  837  LDRYILSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVVTGRKPVEYMEDDVVV  896

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G   +C+DQ + G +  EEV+PV+KL L+C SQ+PS+RP MAEVV IL+
Sbjct  897  LAEMVRGALEEGKSEDCIDQRLHGNFIAEEVIPVIKLGLICASQVPSNRPEMAEVVNILE  956

Query  549  VIKTPVPNRME  581
            +I+ P   R E
Sbjct  957  LIQCPSEGRDE  967



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTA+ LAHLH   Q  IIHYN+K SN+L+D    PK+ DFGLARL+  L
Sbjct  782  LSWHERFNIILGTARSLAHLH---QLDIIHYNLKASNVLIDSTGEPKVGDFGLARLLPML  838

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  839  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLLLEVVTGKRPVEYMEDDVVVL  898

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V +CVD  + G +  EE +PV+KL L+CTSQ+PS+RP MAEVV IL++
Sbjct  899  CDMVRGALEEGRVEQCVDGRLSGNFLAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEL  958

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  959  IRCPSEGQEE  968



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LGTAKGLAHLH   Q  IIHYN+K +NIL+D    PK+ DF LARL+  L
Sbjct  806  LSWRERFNIVLGTAKGLAHLH---QLNIIHYNLKSTNILIDSGGEPKVGDFALARLLPML  862

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTGRRPVEY ED+V++L
Sbjct  863  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGRRPVEYMEDDVVVL  922

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  923  CDMVRGALDEGKVEECVDRRLQGEFPADEAIPVIKLGLICASQVPSNRPDMGEVVNILEL  982

Query  552  IKTP  563
            I+ P
Sbjct  983  IQCP  986



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LA+LH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  L
Sbjct  788  LSWNERFNIILGTAKSLAYLH---QHNIIHYNIKSSNVLIDSSGEPKVGDYGLARLLPML  844

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+ PVEY ED+V++L
Sbjct  845  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKMPVEYMEDDVVVL  904

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD  + G +P EE +P +KL L+CTSQ+PS+RP M EVV IL++
Sbjct  905  CDMVRGALEEGRVEECVDARLHGKFPAEEAIPAMKLGLICTSQVPSNRPDMGEVVNILEL  964

Query  552  IKTPVPNRME  581
            I+ P  ++ E
Sbjct  965  IRCPSEDQEE  974



>gb|EEE55595.1| hypothetical protein OsJ_03900 [Oryza sativa Japonica Group]
Length=660

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  L
Sbjct  471  LSWMERFDIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPML  527

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L
Sbjct  528  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVL  587

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D  + G +P EE LP++KL LVCTS++PS+RP M EVV IL++
Sbjct  588  CDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVPSNRPDMGEVVNILEL  647

Query  552  IKTP  563
            +++P
Sbjct  648  VRSP  651



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILG AKGLAHLH   +  IIHYN+K +N+L+D +  PK+ DFGLARL+  L
Sbjct  777  LTWRQRFNIILGMAKGLAHLH---KINIIHYNLKSTNVLIDSSGAPKVGDFGLARLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+DQ  +G +P +E +PV+KL L+C SQ+PS+RP M EV+ IL++
Sbjct  894  CDMVRGALEEGRVEECLDQKLLGNFPADEAIPVVKLGLICASQVPSNRPDMNEVINILEL  953

Query  552  IKTP  563
            I+ P
Sbjct  954  IQCP  957



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LA+LH   Q  +IHYNIK SN+LLD +   K+ D+GLARL+  L
Sbjct  775  LSWNDRFNIILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEAKVGDYGLARLLPML  831

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  832  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVL  891

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G   ECVD  + G +P EE +PV+KL L+CTSQ+PSSRP M EVV IL++
Sbjct  892  CDMVREALEDGRAEECVDARLQGKFPTEEAVPVIKLGLICTSQVPSSRPDMGEVVNILKM  951

Query  552  IKTP  563
            I+ P
Sbjct  952  IRCP  955



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ DFGLARL+  L
Sbjct  781  LSWRQRFNIILGMAKGLAYLHHT---NIIHYNLKSTNVLIDSSGEPKVGDFGLARLLPML  837

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  838  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  897

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  898  CDMVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILEL  957

Query  552  IKTPVPNRME  581
            I++P+  + E
Sbjct  958  IQSPLDGQEE  967



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILG A+ LAHLH   Q  IIHYN+K SN+LLD +  PK+ D GLA+L
Sbjct  775  ASNTLSWQERFDIILGIARSLAHLH---QHKIIHYNLKSSNVLLDGSGEPKVGDCGLAKL  831

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE ACQ++++ +KCDVYGFG+L+LEI+TG+RPVEY ED+
Sbjct  832  LPMLDRYVLSSKIQSALGYMAPEFACQTVKITDKCDVYGFGVLVLEIMTGKRPVEYMEDD  891

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L+D VR  L++G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV 
Sbjct  892  VVLLSDMVRETLDEGKVEECMDERLCGKFPLEETIPVMKLGLICTSQVPSNRPEMAEVVN  951

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  952  ILELIRFP  959



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ DFGLARL+  L
Sbjct  779  LSWRQRFNIILGMAKGLAYLHHT---NIIHYNLKSTNVLIDSSGEPKVGDFGLARLLPML  835

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  836  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  895

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  896  CDMVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILEL  955

Query  552  IKTPVPNRME  581
            I++P+  + E
Sbjct  956  IQSPLDGQEE  965



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 149/185 (81%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAK  191
            L+W  RF IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + N K+ DFGLARL+  
Sbjct  791  LSWQQRFNIILDTAKGLAYLH---QLSIIHYNMKSTNVLIDDASANAKVGDFGLARLLPV  847

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++
Sbjct  848  LDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILILEVVTGKRPVEYMEDDVVV  907

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L D VR  LE+G + EC+DQ + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL+
Sbjct  908  LCDMVRGALEEGRIEECIDQRLQGNFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILE  967

Query  549  VIKTP  563
            +I+ P
Sbjct  968  LIRCP  972



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ DFGLARL+  L
Sbjct  779  LSWRQRFNIILGMAKGLAYLHHT---NIIHYNLKSTNVLIDSSGEPKVGDFGLARLLPML  835

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  836  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  895

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  896  CDMVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILEL  955

Query  552  IKTPVPNRME  581
            I++P+  + E
Sbjct  956  IQSPLDGQEE  965



>ref|XP_009416322.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=870

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILG A+ LAHLH   Q  IIHYN+K SN+LLD +  PK+ D GLA+L
Sbjct  676  ASNTLSWQERFDIILGIARSLAHLH---QHKIIHYNLKSSNVLLDGSGEPKVGDCGLAKL  732

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE ACQ++++ +KCDVYGFG+L+LEI+TG+RPVEY ED+
Sbjct  733  LPMLDRYVLSSKIQSALGYMAPEFACQTVKITDKCDVYGFGVLVLEIMTGKRPVEYMEDD  792

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L+D VR  L++G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV 
Sbjct  793  VVLLSDMVRETLDEGKVEECMDERLCGKFPLEETIPVMKLGLICTSQVPSNRPEMAEVVN  852

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  853  ILELIRFP  860



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG AKGL+HLH   Q  +IHYN+K +NILLD++  PK+ DFGLARL+  L
Sbjct  780  LSWRRRFNIILGMAKGLSHLH---QMNVIHYNLKSTNILLDDSGEPKVGDFGLARLLPML  836

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  837  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVL  896

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V ECVD + +G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  897  CDMVRGALENGRVEECVDGRLLGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILEL  956

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  957  IQCPAEGQEE  966



>ref|XP_008359946.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103423634 
[Malus domestica]
Length=1756

 Score =   232 bits (592),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15    LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
             LTW  RF IILG AKGLAHLH   Q  IIHYN+K +N+L D N  PK+ D GLARL+  L
Sbjct  1568  LTWRQRFHIILGMAKGLAHLH---QMNIIHYNLKSTNVLXDNNGEPKVGDIGLARLLPTL  1624

Query  195   DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
             DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  1625  DRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYVEDDVIVL  1684

Query  375   NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             +D VR  L +G V EC+D+  +G +P EE +PV+KL L+C SQ+PS+RP M EV+ IL++
Sbjct  1685  SDMVRGALGEGRVEECLDKNLLGNFPAEEAIPVIKLGLICASQVPSNRPDMGEVINILEL  1744

Query  552   IKTPVPNRME  581
             I+ P   + E
Sbjct  1745  IQCPSEGQEE  1754



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  L
Sbjct  758  LSWMERFDIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPML  814

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L
Sbjct  815  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVL  874

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D  + G +P EE LP++KL LVCTSQ+PS+RP M EVV IL++
Sbjct  875  CDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSQVPSNRPDMGEVVNILEL  934

Query  552  IKTP  563
            +++P
Sbjct  935  VRSP  938



>ref|NP_001044651.1| Os01g0821900 [Oryza sativa Japonica Group]
 dbj|BAF06565.1| Os01g0821900, partial [Oryza sativa Japonica Group]
Length=775

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  L
Sbjct  586  LSWMERFDIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPML  642

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L
Sbjct  643  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVL  702

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D  + G +P EE LP++KL LVCTS++PS+RP M EVV IL++
Sbjct  703  CDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVPSNRPDMGEVVNILEL  762

Query  552  IKTP  563
            +++P
Sbjct  763  VRSP  766



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W +RFK+ LG A+GL +LHH C+P +IHYN K SN+LLD+  N ++SD+GLA+L+   
Sbjct  721  LPWELRFKVALGAAQGLCYLHHKCRPRVIHYNFKSSNVLLDDGFNARVSDYGLAKLLHSR  780

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR V+ N+ Q+++GY+APE  C+S +V EKCDVYGFG+++LE++TG+ PVEY E++V+IL
Sbjct  781  DRFVVMNKLQSSLGYLAPECGCESFKVTEKCDVYGFGVVLLELITGKPPVEYLENDVVIL  840

Query  375  NDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  554
             D VR L + G  L CVD  M  YP+EEV+ ++KL LVCTS +P++RPSM EVVQIL++I
Sbjct  841  CDFVRSLADDGKPLLCVDPKMVVYPEEEVMTLIKLGLVCTSPVPANRPSMTEVVQILELI  900

Query  555  KTPVPNR  575
            K    NR
Sbjct  901  KPLADNR  907



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAKGLA+LH   +  +IHYN+K +NIL+D +  PK+ DFGLARL+  L
Sbjct  777  LSWRQRFNIILGTAKGLAYLH---RMNVIHYNLKSTNILIDSSGEPKVGDFGLARLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVITGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            +D VR  LE G V EC+D  +   +P EE +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  894  SDMVRGALEDGRVEECIDGSLRSNFPAEEAIPVIKLGLICASQVPSNRPDMEEVVNILEL  953

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  954  IQCPSDGQEE  963



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RFKII+ TAKGLAHLH   +  +IHYNIK SN++++ +   K+ DFGLA+L+  L
Sbjct  758  LTWRQRFKIIVCTAKGLAHLH---RLNLIHYNIKSSNVMIEVSGEAKVGDFGLAKLLPAL  814

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE++TG+RPVEY ED+V++L
Sbjct  815  DRYILSSKVQSALGYMAPEFACQTVKITEKCDVYGFGVLILEVITGKRPVEYMEDDVVVL  874

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V EC+D+ + GGY  EE +PV+KL L+C SQ+PS+RP M EV++IL++
Sbjct  875  CDMVREALDEGRVEECIDKKLNGGYSMEEAIPVIKLGLICASQVPSNRPDMEEVIRILEL  934

Query  552  IKTPVPNRME  581
            I+ P  ++ E
Sbjct  935  IQCPSESQEE  944



>ref|NP_001142419.1| uncharacterized protein LOC100274594 [Zea mays]
 gb|ACF88448.1| unknown [Zea mays]
Length=511

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL +LH   Q  IIHYN+K SN+LLD N  PK+ D+GLA+L+  L
Sbjct  322  LSWMERFDIILGIARGLTYLH---QHGIIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPML  378

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE +TGRRPVEY ED+V++L
Sbjct  379  DRYVLSSKVQSALGYMAPEFACKTVKITEKCDVYGFGVLLLEALTGRRPVEYLEDDVVVL  438

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G   +CVD  + G +P +E LPV+KL LVCTSQ+PS+RP M EVV +L++
Sbjct  439  CDLVRGALEEGRPEDCVDPRLRGEFPMDEALPVIKLGLVCTSQVPSNRPGMGEVVSMLEL  498

Query  552  IKTP  563
            ++ P
Sbjct  499  VRNP  502



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  L
Sbjct  758  LSWMERFDIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPML  814

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L
Sbjct  815  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVL  874

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D  + G +P EE LP++KL LVCTS++PS+RP M EVV IL++
Sbjct  875  CDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVPSNRPDMGEVVNILEL  934

Query  552  IKTP  563
            +++P
Sbjct  935  VRSP  938



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG AKGLAHLH   Q  +IHYN+K +NIL+D +  PK+ D GLARL+  +
Sbjct  770  LSWRQRFNIILGMAKGLAHLH---QMNLIHYNLKSTNILIDSSGEPKVGDSGLARLLPMV  826

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V+IL
Sbjct  827  DRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVIL  886

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V EC+D+  +G YP EE +PV+KL L+C SQ+PS+RP M+EVV IL++
Sbjct  887  CDMVRGELEEGRVEECLDRKLLGNYPAEEAIPVIKLGLICASQVPSNRPDMSEVVNILEL  946

Query  552  IKTP  563
            I+ P
Sbjct  947  IQCP  950



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 148/185 (80%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAK  191
            L+W  RF IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + N K+ DFGLARL+  
Sbjct  776  LSWQQRFNIILDTAKGLAYLH---QLSIIHYNMKSTNVLIDDASANAKVGDFGLARLLPV  832

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L LE+VTG++PVEY ED+VL+
Sbjct  833  LDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILTLEVVTGKKPVEYMEDDVLV  892

Query  372  LNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L D VR  LE+G + EC+DQ + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL+
Sbjct  893  LCDMVRGALEEGRIEECIDQRLQGHFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILE  952

Query  549  VIKTP  563
            +I+ P
Sbjct  953  LIRCP  957



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GLAHLHH     I HYN+K +NIL+D++  PK+ DFGLA+L+  L
Sbjct  777  LSWRHRFNIILGMARGLAHLHHM---NITHYNLKSTNILIDDSGEPKVGDFGLAKLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V EC+D  + G +P +E +PV+KL L+C+SQ+PS+RP M EVV IL++
Sbjct  894  CDMVRGALEDGRVEECIDGRLRGNFPADEAIPVVKLGLICSSQVPSNRPDMEEVVNILEL  953

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  954  IQCPAGGQEE  963



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GLAHLHH     I HYN+K +NIL+D++  PK+ DFGLA+L+  L
Sbjct  777  LSWRHRFNIILGMARGLAHLHHM---NITHYNLKSTNILIDDSGEPKVGDFGLAKLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V EC+D  + G +P +E +PV+KL L+C+SQ+PS+RP M EVV IL++
Sbjct  894  CDMVRGALEDGRVEECIDGRLRGNFPADEAIPVVKLGLICSSQVPSNRPDMEEVVNILEL  953

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  954  IQCPAGGQEE  963



>gb|KHN40633.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=637

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
             +W  RFKIILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGL +L+  L
Sbjct  449  FSWPQRFKIILGMAKGLAHLH---QMNIIHYNLKSTNVLIDCSGEPKVGDFGLVKLLPML  505

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  506  DHCVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVL  565

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V +CVD + +G +  EE +PV+KL L+C SQ+PS+RP MAEVV IL++
Sbjct  566  CDMVRGALEEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVPSNRPEMAEVVNILEL  625

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  626  IQCPSEGQEE  635



>ref|XP_006644919.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Oryza brachyantha]
Length=858

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF II+G A+GL +LH   Q  IIHYN+K SN+LLD N  P+I D+GLA+L+  L
Sbjct  669  LSWMERFDIIIGVARGLTYLH---QRGIIHYNLKSSNVLLDSNGEPRIGDYGLAKLLPML  725

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L
Sbjct  726  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVL  785

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D  + G +P EE LP++KL LVCTSQ+PS+RP M EVV IL++
Sbjct  786  CDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSQVPSNRPDMGEVVNILEL  845

Query  552  IKTP  563
            +++P
Sbjct  846  VRSP  849



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 145/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  L+W  RF IILGTAK LA+LH   Q  IIHYNIK SN+LLD + +PK+ D+GLARL
Sbjct  770  GSSSLSWNDRFNIILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGDPKVGDYGLARL  826

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  827  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  886

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  887  VVVLCDMVREALEDGKADECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVN  946

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  947  ILRMIRCP  954



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 145/190 (76%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+ LAHLHH     I+HYN+K +NIL+D++  PK+ DFGLA+L+  L
Sbjct  777  LSWRHRFNIILGMARALAHLHHM---NIVHYNLKSTNILIDDSGEPKVGDFGLAKLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V EC+D  +GG  P +E +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  894  CDMVRGALEDGRVEECIDGKLGGKVPADEAIPVIKLGLICASQVPSNRPDMEEVVNILEL  953

Query  552  IKTPVPNRME  581
            I+ P     E
Sbjct  954  IQCPAEGHEE  963



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW  RF IILG AKGL++LH   Q  ++HYN+K +N+LLD +   K+ DFGLARL+  L
Sbjct  774  LTWRQRFNIILGMAKGLSYLH---QMGVVHYNLKSTNVLLDGSGEAKVGDFGLARLLPML  830

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+V++L
Sbjct  831  DRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEIITGRRPVEYMEDDVVVL  890

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+  V +C+D  +GG +P EE +PV+KL L+C SQ+PS+RP M+EVV IL++
Sbjct  891  CDMVRGALEENKVEKCIDGSLGGSFPPEEAIPVIKLGLICASQVPSNRPEMSEVVNILEL  950

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  951  IQCPSEGQEE  960



>ref|XP_010938277.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=737

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 145/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            AT  L+W  RF IILGTAK L HLH   +  IIHYN+K SNILLD +  PKI D+GLA+L
Sbjct  544  ATNILSWQERFDIILGTAKSLEHLH---RLDIIHYNLKSSNILLDGSGEPKIGDYGLAKL  600

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LD +V+S++ Q+A+GY+APE AC+++++ EKCDVY FGM++LEI+ G+RPVEY ED+
Sbjct  601  LPVLDHYVLSSKLQSALGYLAPEFACRTVKITEKCDVYAFGMVVLEIMAGKRPVEYLEDD  660

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV 
Sbjct  661  VVVLRDIVRGALEEGKVEECVDGRLCGKFPLEEAIPVIKLGLICTSQVPSNRPDMGEVVN  720

Query  540  ILQVIKTP  563
            +L++I+ P
Sbjct  721  MLELIRCP  728



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   225 bits (574),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 151/191 (79%), Gaps = 5/191 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAK  191
            L+W  RF IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + + KI DFGLARL+  
Sbjct  776  LSWQQRFNIILDTAKGLAYLH---QLNIIHYNMKSTNVLIDDGSTSTKIGDFGLARLLPI  832

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG++ILE+VTG+RPVEY ED+V++
Sbjct  833  LDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGIMILEVVTGKRPVEYMEDDVIV  892

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L D VR  LE+G + EC+D  + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL+
Sbjct  893  LCDMVRGALEEGRIEECIDGRLQGNFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILE  952

Query  549  VIKTPVPNRME  581
            +I+ P  ++ E
Sbjct  953  LIRCPSESQEE  963



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL +LH   Q  +IHYN+K SN+LLD N  PK+ D+GLA+L+  L
Sbjct  759  LSWMERFDIILGVARGLTYLH---QHGVIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPML  815

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L
Sbjct  816  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVL  875

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G   +C+D  + G +P +E LP++KL LVCTSQ+PS+RP M EVV IL++
Sbjct  876  CDLVRSALEEGRPEDCIDPRLCGEFPMDEALPIIKLGLVCTSQVPSNRPDMGEVVSILEL  935

Query  552  IKTP  563
            +++P
Sbjct  936  VRSP  939



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  L+W  RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL
Sbjct  765  GSSTLSWNDRFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARL  821

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  822  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  881

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G   ECVD  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  882  VVVLCDMVREALEDGRAEECVDMRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVN  941

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  942  ILRMIRCP  949



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 147/183 (80%), Gaps = 5/183 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNP-KISDFGLARLVAK  191
            L+W  R+ I+LG A+GLAHLH +    IIHYN+K SNIL+DE     K++D+GLARL+  
Sbjct  772  LSWNERYNIVLGAARGLAHLHRT---NIIHYNLKSSNILIDEGSGEIKVADYGLARLLPM  828

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG+RPVEY ED+V++
Sbjct  829  LDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVLTGKRPVEYMEDDVVV  888

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L+D VR  +E+G V ECVD  M G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL+
Sbjct  889  LSDMVRGAVEEGRVEECVDSRMLGKFPVEEAIPVMKLGLICTSQVPSNRPDMDEVVNILE  948

Query  549  VIK  557
            +I+
Sbjct  949  MIR  951



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+ LAHLH   +  IIHYN+K SNILLD +   K+ D+GLA+L+  L
Sbjct  783  LSWKERFDIILGIARSLAHLH---RHDIIHYNLKSSNILLDGSGEAKVGDYGLAKLLPML  839

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TGR PVEY ED+V++L
Sbjct  840  DRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTGRTPVEYMEDDVIVL  899

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  900  CDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  959

Query  552  IKTP  563
            I+ P
Sbjct  960  IRCP  963



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH   +  IIHYN+K SNILLD + + K+ D+GLA+L+  L
Sbjct  782  LSWKERFDIVLGIARSLAHLH---RHDIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPML  838

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGR PVEY ED+V++L
Sbjct  839  DRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTGRTPVEYMEDDVIVL  898

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  899  CDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  958

Query  552  IKTP  563
            I+ P
Sbjct  959  IRCP  962



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL +LH   Q  IIHYN+K SN+LLD N  PK+ D+GLA+L+  L
Sbjct  757  LSWMERFDIILGVARGLTYLH---QHGIIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPML  813

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+++GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L
Sbjct  814  DRYVLSSKIQSSLGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVL  873

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G   +C+D  + G +P +E LP++KL LVCTSQ+PS+RP M EVV IL++
Sbjct  874  CDLVRSTLEEGRPEDCIDPRLCGEFPMDEALPIIKLGLVCTSQVPSNRPDMGEVVSILEL  933

Query  552  IKTP  563
            +++P
Sbjct  934  VRSP  937



>emb|CAN76686.1| hypothetical protein VITISV_005469 [Vitis vinifera]
Length=167

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 133/163 (82%), Gaps = 1/163 (1%)
 Frame = +3

Query  96   IIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRV  275
            IIHYN+K SN+L+D +  PK++DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++
Sbjct  3    IIHYNLKSSNVLIDPSGEPKVADFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKI  62

Query  276  NEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPD  452
             EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P 
Sbjct  63   TEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGALEEGKVEECVDGRLQGKFPA  122

Query  453  EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRME  581
            EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   + E
Sbjct  123  EEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEE  165



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  L
Sbjct  749  LSWNDRFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPML  805

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L
Sbjct  806  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVL  865

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++
Sbjct  866  CDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRM  925

Query  552  IKTP  563
            I+ P
Sbjct  926  IRCP  929



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  L
Sbjct  774  LSWNDRFNIILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPML  830

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L
Sbjct  831  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVL  890

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++
Sbjct  891  CDMVREALEDGRADECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRM  950

Query  552  IKTP  563
            I+ P
Sbjct  951  IRCP  954



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  L
Sbjct  774  LSWNDRFNIILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPML  830

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L
Sbjct  831  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVL  890

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++
Sbjct  891  CDMVREALEDGRADECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRM  950

Query  552  IKTP  563
            I+ P
Sbjct  951  IRCP  954



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  L
Sbjct  776  LSWNDRFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPML  832

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L
Sbjct  833  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVL  892

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++
Sbjct  893  CDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRM  952

Query  552  IKTP  563
            I+ P
Sbjct  953  IRCP  956



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  L+W  RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL
Sbjct  742  GSSTLSWNDRFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARL  798

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  799  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  858

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  859  VVVLCDMVREALEDGRAEECIDLRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVN  918

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  919  ILRMIRCP  926



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 143/188 (76%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  L+W  RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD    PK+ D+GLARL
Sbjct  742  GSSTLSWNDRFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSCGEPKVGDYGLARL  798

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  799  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  858

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G   ECVD  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  859  VVVLCDMVREALEDGRAEECVDMRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVN  918

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  919  ILRMIRCP  926



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 148/185 (80%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAK  191
            L+W  RF IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + + K+ DFGLARL+  
Sbjct  793  LSWQQRFNIILDTAKGLAYLH---QLNIIHYNMKSTNVLIDDGSASTKVGDFGLARLLPV  849

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE+VTG+RP+EY ED+V++
Sbjct  850  LDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILILEVVTGKRPMEYMEDDVIV  909

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L D VR  LE+G + EC+D  + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL+
Sbjct  910  LCDMVRGALEEGRIEECIDGRLQGNFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILE  969

Query  549  VIKTP  563
            +I+ P
Sbjct  970  LIRCP  974



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  L+W  RF +ILGTAK LA+LH   Q  +IHYNIK SN+LLD +  PK+ D+GLARL
Sbjct  773  GSSSLSWNDRFNVILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEPKVGDYGLARL  829

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  830  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  889

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  890  VVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVN  949

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  950  ILRMIRCP  957



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH   +  IIHYN+K SNILLD +   K+ D+GLA+L+  L
Sbjct  783  LSWKERFDIVLGIARSLAHLH---RHDIIHYNLKSSNILLDGSGEAKVGDYGLAKLLPML  839

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TGR PVEY ED+V++L
Sbjct  840  DRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTGRTPVEYMEDDVIVL  899

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M EVV IL++
Sbjct  900  CDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMNEVVNILEL  959

Query  552  IKTP  563
            I+ P
Sbjct  960  IRCP  963



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  L+W  RF +ILGTAK LA+LH   Q  +IHYNIK SN+LLD +  PK+ D+GLARL
Sbjct  774  GSSSLSWNDRFNVILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEPKVGDYGLARL  830

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  831  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  890

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  891  VVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVN  950

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  951  ILRMIRCP  958



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 143/190 (75%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+ LAHLHH     I+HYN+K +NIL+D++  PK+ DFGLA+L+  L
Sbjct  777  LSWRHRFNIILGMARALAHLHHM---NIVHYNLKSTNILIDDSGEPKVGDFGLAKLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSRKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V EC+D  +GG  P +E +PV+KL L+C S +PS+RP M EVV IL++
Sbjct  894  CDMVRGALEDGRVEECIDGRLGGKVPADEAIPVIKLGLICASHVPSNRPDMEEVVNILEL  953

Query  552  IKTPVPNRME  581
            I+ P     E
Sbjct  954  IQCPAEGHEE  963



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 143/190 (75%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+ LAHLHH     I+HYN+K +NIL+D++  PK+ DFGLA+L+  L
Sbjct  777  LSWRHRFNIILGMARALAHLHHM---NIVHYNLKSTNILIDDSGEPKVGDFGLAKLLPTL  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  834  DRCILSRKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G V EC+D  +GG  P +E +PV+KL L+C S +PS+RP M EVV IL++
Sbjct  894  CDMVRGALEDGRVEECIDGRLGGKVPADEAIPVIKLGLICASHVPSNRPDMEEVVNILEL  953

Query  552  IKTPVPNRME  581
            I+ P     E
Sbjct  954  IQCPAEGHEE  963



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 147/186 (79%), Gaps = 5/186 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLN-PKISDFGLARLVAK  191
            L+W  RF IILG AKGLAHLH   +  IIHYN+K SNIL+D +    K++D+GLA L+  
Sbjct  772  LSWNERFNIILGAAKGLAHLH---KMNIIHYNLKSSNILIDASTGEAKVADYGLAGLLPM  828

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR+V+S++ Q+A+GY+APE A +++++ EKCDVYGFG+L+LE+V+GRRPVEY ED+V++
Sbjct  829  LDRYVLSSKIQSALGYMAPEFAVKTIKITEKCDVYGFGILVLEMVSGRRPVEYMEDDVVV  888

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L D +R ++E+G V ECVD  + G +  EEV+PV+KL L+CTSQ+PS+RP MAEVV +L+
Sbjct  889  LADMIRGVVEEGKVEECVDSRLQGKFSAEEVVPVMKLGLICTSQVPSTRPHMAEVVSMLE  948

Query  549  VIKTPV  566
            +IK P 
Sbjct  949  LIKCPA  954



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 145/190 (76%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKIILG AKGL+HLH   Q  IIHYN+K +N+L+  +  PKI DFGL +L+  L
Sbjct  769  LSWRQRFKIILGMAKGLSHLH---QMNIIHYNLKSTNVLIHSSDEPKIGDFGLVKLLPML  825

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L
Sbjct  826  DHCVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTGKRPVEYMEDDVVVL  885

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V ECVD+  +G +  EE +PV+KL L+C SQ+PS+RP M EV+ IL++
Sbjct  886  CDMVRGALEEGKVEECVDERLLGNFAAEEAIPVIKLGLICASQVPSNRPDMDEVINILEL  945

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  946  IQCPSEGQEE  955



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH      IIHYN+K SNI+LD++   K+ D+GLA+L+  L
Sbjct  784  LSWKERFDIVLGMARSLAHLHWH---DIIHYNLKSSNIMLDDSGEAKVGDYGLAKLLPML  840

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TGR PVEY ED+V++L
Sbjct  841  DRYVLSSKVQSALGYMAPEFTCRTVKITEKCDVYGFGVLVLEVMTGRTPVEYMEDDVIVL  900

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  901  CDVVRAALDEGKVEECVDEKLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  960

Query  552  IKTP  563
            I+ P
Sbjct  961  IRCP  964



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH   +  IIHYN+K SNILLD + + K+ D+GLA+L+  L
Sbjct  782  LSWKERFDIVLGIARSLAHLH---RHDIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPML  838

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGR PV+Y ED+V++L
Sbjct  839  DRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTGRTPVQYMEDDVIVL  898

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  899  CDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  958

Query  552  IKTP  563
            I+ P
Sbjct  959  IRCP  962



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH   +  IIHYN+K SNILLD + + K+ D+GLA+L+  L
Sbjct  782  LSWKERFDIVLGIARSLAHLH---RHDIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPML  838

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGR PV+Y ED+V++L
Sbjct  839  DRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTGRTPVQYMEDDVIVL  898

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  899  CDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  958

Query  552  IKTP  563
            I+ P
Sbjct  959  IRCP  962



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH   +  IIHYN+K SNILLD + + K+ D+GLA+L+  L
Sbjct  782  LSWKERFDIVLGIARSLAHLH---RHDIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPML  838

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGR PV+Y ED+V++L
Sbjct  839  DRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTGRTPVQYMEDDVIVL  898

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  899  CDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  958

Query  552  IKTP  563
            I+ P
Sbjct  959  IRCP  962



>tpg|DAA57062.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=949

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+GL +LH   Q  IIHYN+K SN+LLD N  PK+ D+GLA+L+  L
Sbjct  760  LSWMERFDIILGIARGLTYLH---QHGIIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPML  816

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE +TGRRPVEY ED+V++L
Sbjct  817  DRYVLSSKVQSALGYMAPEFACKTVKITEKCDVYGFGVLLLEALTGRRPVEYLEDDVVVL  876

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G   +CVD  + G +P +E LPV+KL LVCTSQ+PS+RP M EVV +L++
Sbjct  877  CDLVRGALEEGRPEDCVDPRLRGEFPMDEALPVIKLGLVCTSQVPSNRPGMGEVVSMLEL  936

Query  552  IKTP  563
            ++ P
Sbjct  937  VRNP  940



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 142/184 (77%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  L
Sbjct  777  LSWNDRFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPML  833

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L
Sbjct  834  DRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVL  893

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G   EC+D  + G +  EE + V+KL L+CTSQ+PSSRP M E V IL++
Sbjct  894  CDMVREALEDGRAEECIDPRLQGKFSAEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRM  953

Query  552  IKTP  563
            I+ P
Sbjct  954  IRCP  957



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFK+ILG AKGL+HLH   +  IIHYN+K +N+L+D +   KI DFGL +L+  L
Sbjct  765  LSWRQRFKVILGMAKGLSHLH---ETNIIHYNLKSTNVLIDCSGEAKIGDFGLVKLLPML  821

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L
Sbjct  822  DHCVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTGKRPVEYMEDDVVVL  881

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+GNV  CVD+  +G +  EE +PV+KL L+C SQ+PS+RP M+EV+ IL++
Sbjct  882  CDMVRGSLEEGNVEHCVDERLLGNFAAEEAIPVIKLGLICASQVPSNRPDMSEVINILEL  941

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  942  IQCPSEGQEE  951



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFK+ILG AKGL+HLH   +  IIHYN+K +N+L+D +   KI DFGL +L+  L
Sbjct  759  LSWRQRFKVILGMAKGLSHLH---ETNIIHYNLKSTNVLIDCSGEAKIGDFGLVKLLPML  815

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L
Sbjct  816  DHCVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTGKRPVEYMEDDVVVL  875

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+GNV  CVD+  +G +  EE +PV+KL L+C SQ+PS+RP M+EV+ IL++
Sbjct  876  CDMVRGSLEEGNVEHCVDERLLGNFAAEEAIPVIKLGLICASQVPSNRPDMSEVINILEL  935

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  936  IQCPSEGQEE  945



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 143/188 (76%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             +  L+W  RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +   K+ D+GLARL
Sbjct  770  GSSSLSWNDRFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEAKVGDYGLARL  826

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  827  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  886

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  887  VVVLCDMVREALEDGRAEECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVN  946

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  947  ILRMIRCP  954



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3     ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
              +  L+W  RF +ILGTAK LA+LH   Q  +IHYNIK SN+LLD +  PK+ D+GLARL
Sbjct  1037  GSSSLSWNDRFNVILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEPKVGDYGLARL  1093

Query  183   VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
             +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+
Sbjct  1094  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDD  1153

Query  363   VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
             V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V 
Sbjct  1154  VVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVN  1213

Query  540   ILQVIKTP  563
             IL++++ P
Sbjct  1214  ILRMVRCP  1221



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILGTAK LAHLH   +  IIHYN+K +NILLD +  PK  D+GLA+L
Sbjct  752  ASNALSWQERFDIILGTAKSLAHLH---RLDIIHYNLKSANILLDGSGEPKTGDYGLAKL  808

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LD +V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+L+LEI+ G+RP+EY ED+
Sbjct  809  LPMLDHYVLSSKIQSALGYMAPEFACRTVKITEKCDVYAFGVLVLEIMAGKRPLEYMEDD  868

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE+G V ECVD  + G +P EE + V+KL L+CTSQ+PS+RP M EVV 
Sbjct  869  VVVLCDMVRGALEEGKVAECVDGRLCGKFPIEEAIAVMKLGLICTSQVPSNRPDMGEVVN  928

Query  540  ILQVIKTPVPNRME  581
            IL++I+ P  ++ E
Sbjct  929  ILELIRCPQDSQEE  942



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
             +W  RFK+ILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGL +L+  L
Sbjct  779  FSWPQRFKVILGMAKGLAHLH---QMNIIHYNLKSTNVLIDCSGEPKVGDFGLVKLLPML  835

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVTG+RPVEY ED+V++L
Sbjct  836  DHCVLSSKIQSALGYMAPEFACRTVKITKKCDVYGFGILVLEIVTGKRPVEYMEDDVVVL  895

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V +CVD + +G +  EE +PV+KL L+C SQ+PS+RP MAEVV IL++
Sbjct  896  CDMVRGALEEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVPSNRPDMAEVVNILEL  955

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  956  IQCPSEGQEE  965



>ref|XP_007134722.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06716.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=783

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 143/190 (75%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKIILG A+GLAHLH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  L
Sbjct  595  LSWRKRFKIILGIARGLAHLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPML  651

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+LILE+VTG+RPVEY ED+V++L
Sbjct  652  DPCVLSSKIQSALGYMAPEFACRTVKITEKCDVYSFGILILEVVTGKRPVEYMEDDVVVL  711

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS RP MAEV+ IL++
Sbjct  712  CDKVRSALDDGKVEQCVDENLKGNFAAEEAVPVIKLGLVCASQVPSKRPDMAEVINILEL  771

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  772  IQCPSEGQEE  781



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  790  LTWRQRFSIILGIARGLAYLHSS---NITHYNLKATNVLIDATGEAKVSDFGLARLLASA  846

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  847  LDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  906

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL+
Sbjct  907  LCETVREGLEEGRVEECVDGRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPDMEEVVKILE  966

Query  549  VIKTP  563
            +I+ P
Sbjct  967  LIQCP  971



>ref|NP_001159235.1| uncharacterized protein LOC100304322 [Zea mays]
 gb|ACN25536.1| unknown [Zea mays]
Length=308

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 145/188 (77%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
             T  L W  RF I+LG A+ LAHLH   +  IIHYN+K SNILLD +   K+ D+GLA+L
Sbjct  115  TTNCLPWKERFDIVLGIARSLAHLH---RHDIIHYNLKSSNILLDGSGEAKVGDYGLAKL  171

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TGR PVEY ED+
Sbjct  172  LPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTGRTPVEYMEDD  231

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M EVV 
Sbjct  232  VVVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMGEVVN  291

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  292  ILELIRCP  299



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILGTAK LAHLH   +  IIHYN+K +NILLD +  PK  D+GLA+L
Sbjct  776  ASNALSWQERFDIILGTAKSLAHLH---RLDIIHYNLKSANILLDGSGEPKTGDYGLAKL  832

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LD +V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+L+LEI+ G+RP+EY ED+
Sbjct  833  LPMLDHYVLSSKIQSALGYMAPEFACRTVKITEKCDVYAFGVLVLEIMAGKRPLEYMEDD  892

Query  363  VLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE+G V ECVD  + G +P EE + V+KL L+CTSQ+PS+RP M EVV 
Sbjct  893  VVVLCDMVRGALEEGKVAECVDGRLCGKFPIEEAIAVMKLGLICTSQVPSNRPDMGEVVN  952

Query  540  ILQVIKTPVPNRME  581
            IL++I+ P  ++ E
Sbjct  953  ILELIRCPQDSQEE  966



>gb|EMT15869.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=866

 Score =   220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF II+G A+GL HLH   Q  ++HYN+K SN+LLD N  P++ D+GLA L+  L
Sbjct  677  LSWMERFDIIIGVARGLMHLH---QHGVVHYNLKSSNVLLDSNGEPRVGDYGLASLLPML  733

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGRRPVEY ED+V++L
Sbjct  734  DRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLALEILTGRRPVEYLEDDVVVL  793

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G + +C+D  + G +  EE +P++KL LVCTSQ+PS+RP M EV+ IL+V
Sbjct  794  CDLVRSALEEGRLEDCMDPRLCGEFAMEEAIPIIKLGLVCTSQVPSNRPDMGEVLSILEV  853

Query  552  IKTP  563
            +++P
Sbjct  854  VRSP  857



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  782  LTWRQRFSIILGIARGLAYLHSS---NITHYNLKATNVLIDATGEAKVSDFGLARLLASA  838

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  839  LDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  898

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL+
Sbjct  899  LCETVREGLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKILE  958

Query  549  VIKTP  563
            +I+ P
Sbjct  959  LIQCP  963



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 ref|XP_004160330.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKI+LG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ D+GLA L+  L
Sbjct  771  LSWRQRFKIVLGMAKGLAYLHHN---NIIHYNLKSTNVLIDSSGKPKVGDYGLAMLLPML  827

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++ + EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  828  DRCILSSKIQSALGYMAPEFACKTVTITEKCDVYGFGILVLEVVTGKRPVEYMEDDVIVL  887

Query  375  NDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VRV L++G V  CVD+ +   +  EE +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  888  CDMVRVALDEGTVERCVDERLQLNFRVEEAIPVMKLGLICASQVPSNRPDMNEVVNILEL  947

Query  552  IKTP  563
            I++P
Sbjct  948  IQSP  951



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKI+LG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ D+GLA L+  L
Sbjct  770  LSWRQRFKIVLGMAKGLAYLHHN---NIIHYNLKSTNVLIDSSGKPKVGDYGLAMLLPML  826

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR ++S++ Q+A+GY+APE AC+++ + EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  827  DRCILSSKIQSALGYMAPEFACKTVTITEKCDVYGFGILVLEVVTGKRPVEYMEDDVIVL  886

Query  375  NDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VRV L++G V  CVD+ +   +  EE +PV+KL L+C SQ+PS+RP M EVV IL++
Sbjct  887  CDMVRVALDEGTVERCVDERLQLNFRVEEAIPVMKLGLICASQVPSNRPDMNEVVNILEL  946

Query  552  IKTP  563
            I++P
Sbjct  947  IQSP  950



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 145/191 (76%), Gaps = 5/191 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  768  LTWRQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASA  824

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  825  LDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  884

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL+
Sbjct  885  LCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILE  944

Query  549  VIKTPVPNRME  581
            +I+ P  + +E
Sbjct  945  LIQCPPSHDLE  955



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 145/191 (76%), Gaps = 5/191 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  772  LTWRQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASA  828

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  829  LDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  888

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL+
Sbjct  889  LCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILE  948

Query  549  VIKTPVPNRME  581
            +I+ P  + +E
Sbjct  949  LIQCPPSHDLE  959



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 145/191 (76%), Gaps = 5/191 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  766  LTWRQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASA  822

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  823  LDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  882

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL+
Sbjct  883  LCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILE  942

Query  549  VIKTPVPNRME  581
            +I+ P  + +E
Sbjct  943  LIQCPPSHDLE  953



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 145/191 (76%), Gaps = 5/191 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  780  LTWRQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASA  836

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  837  LDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  896

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL+
Sbjct  897  LCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILE  956

Query  549  VIKTPVPNRME  581
            +I+ P  + +E
Sbjct  957  LIQCPPSHDLE  967



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            L W  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  781  LNWRQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASA  837

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  838  LDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  897

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL+
Sbjct  898  LCETVRERLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPDMEEVVKILE  957

Query  549  VIKTP  563
            +I++P
Sbjct  958  LIQSP  962



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
             +W  RFKII G AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGL +L+  L
Sbjct  780  FSWPQRFKIIYGMAKGLAHLH---QMNIIHYNLKSTNVLIDCSGEPKVGDFGLVKLLPML  836

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCD+YGFG+L+LE+VTG+RPVEY ED+V++L
Sbjct  837  DHCVLSSKIQSALGYMAPEFACRTVKITEKCDIYGFGILVLEVVTGKRPVEYMEDDVVVL  896

Query  375  NDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE+G V +CVD + +G +  EE +PV+KL L+C SQ+PS+RP MAEVV IL++
Sbjct  897  CDMVRGALEEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVPSNRPDMAEVVNILEL  956

Query  552  IKTP  563
            I+ P
Sbjct  957  IQCP  960



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 143/190 (75%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKIILG A+GLAHLH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  L
Sbjct  794  LSWRKRFKIILGIARGLAHLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPML  850

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+LILE+VTG+RPVEY ED+V++L
Sbjct  851  DPCVLSSKIQSALGYMAPEFACRTVKITEKCDVYSFGILILEVVTGKRPVEYMEDDVVVL  910

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS RP MAEV+ IL++
Sbjct  911  CDKVRSALDDGKVEQCVDENLKGNFAAEEAVPVIKLGLVCASQVPSKRPDMAEVINILEL  970

Query  552  IKTPVPNRME  581
            I+ P   + E
Sbjct  971  IQCPSEGQEE  980



>ref|XP_002509644.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
 gb|EEF51031.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
Length=884

 Score =   218 bits (556),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 103/185 (56%), Positives = 145/185 (78%), Gaps = 3/185 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W+ RF+I LGTA+ L++LHH C+PPI+H NIK +NILLDEN   K+SD+GL RL+  L
Sbjct  699  LHWSRRFQIALGTARALSYLHHDCRPPILHLNIKSTNILLDENYEAKLSDYGLGRLLPIL  758

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN-VLI  371
            D + ++ +F  A+GYVAPELA QSLR++EKCDVY FG+++LE+VTGR+PVE    N V+I
Sbjct  759  DNYGLT-KFHNAVGYVAPELA-QSLRLSEKCDVYSFGVILLELVTGRKPVESPSANEVVI  816

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE G+  +C D+ + G+ + E++ V+KL L+CTS++PS RPSMAEVVQ+L+ 
Sbjct  817  LCEYVRSLLETGSASDCFDRSLRGFSENELIQVMKLGLICTSEVPSRRPSMAEVVQVLES  876

Query  552  IKTPV  566
            I++ V
Sbjct  877  IRSGV  881



>gb|KHM99411.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=780

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKIILG AKGLA+LH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  L
Sbjct  595  LSWRQRFKIILGMAKGLAYLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPML  651

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY APE AC+++++ EKCD+Y FG+LILE+VTG+RPVEY ED+V++L
Sbjct  652  DHCVLSSKIQSALGYTAPEFACRTVKITEKCDIYSFGILILEVVTGKRPVEYTEDDVVVL  711

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L+ G V +CVD+ + G +  +E +PV+KL LVC SQ+PS+RP MAEV+ IL++
Sbjct  712  CDKVRSALDDGKVEQCVDEKLKGNFAADEAIPVIKLGLVCASQVPSNRPDMAEVINILEL  771

Query  552  IKTP  563
            I+ P
Sbjct  772  IQCP  775



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 142/184 (77%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKIILG AKGLA+LH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  L
Sbjct  784  LSWRQRFKIILGMAKGLAYLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPML  840

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCD+Y FG+LILE+VTG+RPVEY ED+V++L
Sbjct  841  DHCVLSSKIQSALGYMAPEFACRTVKITEKCDIYSFGILILEVVTGKRPVEYMEDDVVVL  900

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS+RP MAEV+ IL++
Sbjct  901  CDKVRSALDDGKVEQCVDEKLKGNFAAEEAIPVIKLGLVCASQVPSNRPDMAEVINILEL  960

Query  552  IKTP  563
            I+ P
Sbjct  961  IQCP  964



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLA L+A  
Sbjct  786  LTWRQRFSIILGIARGLAYLHGS---NITHYNLKSTNVLIDATGEAKVSDFGLAGLLAST  842

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  843  LDRCVLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYAEDDVVV  902

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL+
Sbjct  903  LCETVREGLEEGRVEECVDGRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKILE  962

Query  549  VIKTP  563
            +I+ P
Sbjct  963  LIQCP  967



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 142/184 (77%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKIILG AKGLA+LH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  L
Sbjct  784  LSWRQRFKIILGMAKGLAYLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPML  840

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++++ EKCD+Y FG+LILE+VTG+RPVEY ED+V++L
Sbjct  841  DHCVLSSKIQSALGYMAPEFACRTVKITEKCDIYSFGILILEVVTGKRPVEYMEDDVVVL  900

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS+RP MAEV+ IL++
Sbjct  901  CDKVRSALDDGKVEQCVDEKLKGNFAAEEAIPVIKLGLVCASQVPSNRPDMAEVINILEL  960

Query  552  IKTP  563
            I+ P
Sbjct  961  IQCP  964



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH   +  IIHYN+K SNI+LD +   K+ D+GLA+L+  L
Sbjct  784  LSWKERFDIVLGMARSLAHLH---RHDIIHYNLKSSNIMLDGSGEAKVGDYGLAKLLPML  840

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D++V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TGR PVEY ED+V++L
Sbjct  841  DQYVLSSKVQSALGYMAPEFTCRTVKITEKCDVYGFGVLVLEVMTGRAPVEYMEDDVIVL  900

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD  + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  901  CDVVRAALDEGKVEECVDGKLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  960

Query  552  IKTP  563
            I+ P
Sbjct  961  IRCP  964



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 143/186 (77%), Gaps = 6/186 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLN-PKISDFGLARLVAK  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D      K+SDFGLARL+A 
Sbjct  741  LTWRQRFSIILGIARGLAYLHGS---NITHYNLKATNVLIDAATGEAKVSDFGLARLLAS  797

Query  192  -LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
             LDR V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V+
Sbjct  798  ALDRCVLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYAEDDVM  857

Query  369  ILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQIL  545
            +L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL
Sbjct  858  VLCETVREGLEEGRVEECVDARLRGDFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKIL  917

Query  546  QVIKTP  563
            ++I+ P
Sbjct  918  ELIQCP  923



>ref|XP_009125388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=925

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 143/186 (77%), Gaps = 6/186 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLN-PKISDFGLARLVAK  191
            LTW  RF IILG A+GLA+LH S    I HYN+K +N+L+D      K+SDFGLARL+A 
Sbjct  738  LTWRQRFSIILGIARGLAYLHGS---NITHYNLKATNVLIDAATGEAKVSDFGLARLLAS  794

Query  192  -LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  368
             LDR V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V+
Sbjct  795  ALDRCVLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYAEDDVM  854

Query  369  ILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQIL  545
            +L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL
Sbjct  855  VLCETVREGLEEGRVEECVDARLRGDFPAEEAIPVVKLGLVCGSQVPSNRPEMEEVVKIL  914

Query  546  QVIKTP  563
            ++I+ P
Sbjct  915  ELIQCP  920



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RFKIILG AKGLA+LH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  L
Sbjct  785  LSWRQRFKIILGMAKGLAYLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPML  841

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY APE AC+++++ EKCD+Y FG+LILE+VTG+RPVEY ED+V++L
Sbjct  842  DHCVLSSKIQSALGYTAPEFACRTVKITEKCDIYSFGILILEVVTGKRPVEYTEDDVVVL  901

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L+ G V +CVD+ + G +  +E +PV+KL LVC SQ+PS+RP MAEV+ IL++
Sbjct  902  CDKVRSALDDGKVEQCVDEKLKGNFAADEAIPVIKLGLVCASQVPSNRPDMAEVINILEL  961

Query  552  IKTP  563
            I+ P
Sbjct  962  IQCP  965



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-  191
            LTW  RF IILG A+GLA LH S    I HYN+K +N+L+D     K+SDFGLARL+A  
Sbjct  781  LTWRQRFSIILGIARGLAFLHSS---NITHYNMKATNVLIDAAGEAKVSDFGLARLLASA  837

Query  192  LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  371
            LDR V+S + Q+A+GY APE AC+++++ ++CDVYGFG+L+LE+VTG+RPVEY ED+V++
Sbjct  838  LDRCVLSGKVQSALGYTAPEFACRTVKITDRCDVYGFGILVLEVVTGKRPVEYAEDDVVV  897

Query  372  LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  548
            L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL+
Sbjct  898  LCETVREGLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKILE  957

Query  549  VIKTP  563
            +I+ P
Sbjct  958  LIQCP  962



>gb|AAF88073.1|AC025417_1 T12C24.1 [Arabidopsis thaliana]
Length=221

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W  RF+I LGTAK L+ LH+ C+P I+H N+K +NILLDE    K+SD+GL + +  +
Sbjct  35   LNWHRRFQIALGTAKALSFLHNDCKPAILHLNVKSTNILLDERYEAKLSDYGLEKFLPVM  94

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEY-GEDNVLI  371
            D   ++ +F  A+GY+APELA QSLR +EKCDVY +G+++LE+VTGR+PVE   E+ VLI
Sbjct  95   DSFGLTKKFHNAVGYIAPELAQQSLRASEKCDVYSYGVVLLELVTGRKPVESPSENQVLI  154

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L D+VR LLE G+  +C D+ +  + + E++ V+KL L+CTS+ P  RPSMAEVVQ+L+ 
Sbjct  155  LRDYVRDLLETGSASDCFDRRLREFEENELIQVMKLGLLCTSENPLKRPSMAEVVQVLES  214

Query  552  IKT  560
            I+ 
Sbjct  215  IRN  217



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF I+LG A+ LAHLH   +  IIHYN+K SNI+L+ +   K+ D+GLA+L+  L
Sbjct  781  LSWKERFDIVLGIARSLAHLH---RHDIIHYNLKSSNIMLNGSGEAKVGDYGLAKLLPML  837

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE  C+++++ +KCDVYGFG+L+LE++TG+ PVEY ED+V++L
Sbjct  838  DRYVLSSKVQSALGYMAPEFTCRTVKITDKCDVYGFGVLVLEVMTGKTPVEYMEDDVIVL  897

Query  375  NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++
Sbjct  898  CDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILEL  957

Query  552  IKTP  563
            I+ P
Sbjct  958  IRCP  961



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   217 bits (552),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 110/188 (59%), Positives = 148/188 (79%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILG A+GLAHLH   +  IIHYN+K SNIL+D +   K+ D+GLA L
Sbjct  775  ASNSLSWQERFDIILGIARGLAHLH---RLNIIHYNLKSSNILIDGSGEAKVGDYGLANL  831

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            + KLDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+
Sbjct  832  LPKLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTGRRPVEYMEDD  891

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE+G V E VD  +GG +P EE +PVLKL L+CTSQ+PS+RP MAE V 
Sbjct  892  VVVLCDVVRGALEEGRVEESVDGRLGGKFPVEEAVPVLKLGLICTSQVPSNRPDMAEAVN  951

Query  540  ILQVIKTP  563
            IL++I+ P
Sbjct  952  ILRLIRCP  959



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILG A+ LAHLH   +  IIHYN+K SNIL+D +   K+ D+GLA+L
Sbjct  775  ASNLLSWQERFDIILGIARSLAHLH---RLNIIHYNLKSSNILIDGSGEAKVGDYGLAKL  831

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+
Sbjct  832  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIMTGRRPVEYMEDD  891

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D V+  LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS+RP MAEVV+
Sbjct  892  VVVLCDVVKGALEEGRVEECVDGKLGGKFPVEEAVPVMKLGLICTSQVPSNRPDMAEVVK  951

Query  540  ILQVIKTP  563
            ILQ+I+ P
Sbjct  952  ILQLIRCP  959



>gb|KJB25688.1| hypothetical protein B456_004G204100 [Gossypium raimondii]
Length=885

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW+ RF + LGTA+ L++LHH C+PPI H NIK SNILLDE    K+SD+GL +L+  L
Sbjct  701  LTWSRRFHVALGTARALSYLHHDCRPPIFHLNIKSSNILLDEEYKAKLSDYGLGKLLPIL  760

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN-VLI  371
            D + ++ +F  A+GYVAPELA QSLRV+EKCDVY FG+++LE+VTGR+PVE    N V+I
Sbjct  761  DNYGLT-KFHNAVGYVAPELA-QSLRVSEKCDVYSFGVILLELVTGRKPVESPTANEVVI  818

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE+G+  +C D+ + G+ D E++ V+KL L+CTS+IPS RPSM+EVVQ+L+ 
Sbjct  819  LCEYVRGLLEKGSASDCFDRRLRGFADNELIQVMKLGLICTSEIPSRRPSMSEVVQVLEF  878

Query  552  IKTPV  566
            I++ +
Sbjct  879  IRSGI  883



>gb|KHF98277.1| hypothetical protein F383_15451 [Gossypium arboreum]
Length=885

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            LTW+ RF + LGTA+ L++LHH C+PPI H NIK SNILLDE    K+SD+GL +L+  L
Sbjct  701  LTWSRRFHVALGTARALSYLHHDCRPPIFHLNIKSSNILLDEEYKAKLSDYGLGKLLPIL  760

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN-VLI  371
            D + ++ +F  A+GYVAPELA QSLRV+EKCDVY FG+++LE+VTGR+PVE    N V+I
Sbjct  761  DNYGLT-KFHNAVGYVAPELA-QSLRVSEKCDVYSFGVILLELVTGRKPVESPTANEVVI  818

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE+G+  +C D+ + G+ D E++ V+KL L+CTS+IPS RPSM+EVVQ+L+ 
Sbjct  819  LCEYVRGLLERGSASDCFDRRLRGFADNELIQVMKLGLICTSEIPSRRPSMSEVVQVLEF  878

Query  552  IKTPV  566
            I++ +
Sbjct  879  IRSGI  883



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 149/189 (79%), Gaps = 4/189 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
            A+  L+W  RF IILG A+ LAHLH   +  IIHYN+K SNIL+D +   K+ D GLA+L
Sbjct  775  ASNSLSWRERFDIILGIARSLAHLH---RLNIIHYNLKSSNILIDGSGEAKVGDAGLAKL  831

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+
Sbjct  832  LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIITGRRPVEYMEDD  891

Query  363  VLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
            V++L D VR  LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS+RP MAEVV 
Sbjct  892  VVVLCDVVRGALEEGRVEECVDGRLGGKFPVEEAVPVVKLGLICTSQVPSNRPDMAEVVN  951

Query  540  ILQVIKTPV  566
            ILQ+I+ P+
Sbjct  952  ILQLIRCPL  960



>ref|XP_006440456.1| hypothetical protein CICLE_v10018802mg [Citrus clementina]
 gb|ESR53696.1| hypothetical protein CICLE_v10018802mg [Citrus clementina]
Length=884

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
              P L W+ RF I LGTA+ L++LHH C+PPI+H N+K +NILLDEN  PK+SD+GLA+L
Sbjct  696  GNPELHWSRRFHIALGTARALSYLHHDCKPPILHLNLKSTNILLDENYEPKLSDYGLAKL  755

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LD + ++ +F  A+GYVAPELA QSLR+++KCDVY FG+++LE+VTGR+PVE    N
Sbjct  756  LPILDNYGLT-KFHNAVGYVAPELA-QSLRLSDKCDVYSFGVILLELVTGRKPVESPTTN  813

Query  363  -VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
             V++L ++VR LLE+G+   C D+ + G+ + E++ V+KL L+CTS++PS RPSMAEVVQ
Sbjct  814  EVVVLCEYVRELLERGSASACFDRSLRGFAENELIQVMKLGLICTSEVPSRRPSMAEVVQ  873

Query  540  ILQVIKT  560
            +L+ I+ 
Sbjct  874  VLESIRN  880



>gb|KDO63698.1| hypothetical protein CISIN_1g002759mg [Citrus sinensis]
Length=884

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
              P L W+ RF I LGTA+ L++LHH C+PPI+H N+K +NILLDEN  PK+SD+GLA+L
Sbjct  696  GNPELHWSRRFHIALGTARALSYLHHDCKPPILHLNLKSTNILLDENYEPKLSDYGLAKL  755

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LD + ++ +F  A+GYVAPELA QSLR+++KCDVY FG+++LE+VTGR+PVE    N
Sbjct  756  LPILDNYGLT-KFHNAVGYVAPELA-QSLRLSDKCDVYSFGVILLELVTGRKPVESPTTN  813

Query  363  -VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
             V++L ++VR LLE+G+   C D+ + G+ + E++ V+KL L+CTS++PS RPSMAEVVQ
Sbjct  814  EVVVLCEYVRELLERGSASACFDRSLRGFAENELIQVMKLGLICTSEVPSRRPSMAEVVQ  873

Query  540  ILQVIKT  560
            +L+ I+ 
Sbjct  874  VLESIRN  880



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L+W  RF IILG A+ LAHLH   +  IIHYN+K SNIL+D +   K+ D+GLA+L+  L
Sbjct  779  LSWQERFDIILGIARSLAHLH---RFNIIHYNLKSSNILIDGSGEAKVGDYGLAKLLPML  835

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            DR+V+S++ Q+A+GY+APE AC+++++NEKCDVYGFG+L+LEI+TGRRPVEY ED+V++L
Sbjct  836  DRYVLSSKIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEIMTGRRPVEYMEDDVVVL  895

Query  375  NDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D V+  LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS+RP M EVV ILQ+
Sbjct  896  CDVVKGALEEGRVEECVDGKLGGKFPVEEAVPVVKLGLICTSQVPSNRPDMVEVVNILQL  955

Query  552  IKTP  563
            I+ P
Sbjct  956  IRCP  959



>ref|XP_006477322.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460-like [Citrus sinensis]
Length=884

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    ATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARL  182
              P L W+ RF I LGTA+ L++LHH C+PPI+H N+K +NILLDEN  PK+SD+GLA+L
Sbjct  696  GNPELHWSRRFHIALGTARALSYLHHDCKPPILHLNLKSTNILLDENYEPKLSDYGLAKL  755

Query  183  VAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN  362
            +  LD + ++ +F  A+GYVAPELA QSLR+++KCDVY FG+++LE+VTGR+PVE    N
Sbjct  756  LPILDNYGLT-KFHNAVGYVAPELA-QSLRLSDKCDVYSFGVILLELVTGRKPVESPTTN  813

Query  363  -VLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  539
             V++L ++VR LLE+G+   C D+ + G+ + E++ V+KL L+CTS++PS RPSMAEVVQ
Sbjct  814  EVVVLCEYVRELLERGSASACFDRSLRGFAENELIQVMKLGLICTSEVPSRRPSMAEVVQ  873

Query  540  ILQVIKT  560
            +L+ I+ 
Sbjct  874  VLESIRN  880



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 144/189 (76%), Gaps = 4/189 (2%)
 Frame = +3

Query  18   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  197
            +W  RF IILG AKGLA+LH   +  +IHYN+K +N+L+D +  PK+ DFGLARL+  LD
Sbjct  780  SWRQRFNIILGMAKGLAYLH---RMNVIHYNLKSTNVLIDCSGEPKVGDFGLARLLPTLD  836

Query  198  RHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  377
            R V+S++ Q+A+GY+APE AC+++++ EK DVYGFG+L+LE++TG++PVEY ED+V++L 
Sbjct  837  RCVLSSKIQSALGYMAPEFACKTVKITEKSDVYGFGVLVLEVITGKKPVEYMEDDVVVLC  896

Query  378  DHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  554
            + VR  LE G V ECVD+ +   +P EE +PV+KL L+C SQ+PS+RP M EVV IL++I
Sbjct  897  EMVRGALEDGKVEECVDRRLRSNFPTEEAIPVIKLGLICASQVPSNRPDMEEVVNILELI  956

Query  555  KTPVPNRME  581
            + P   + E
Sbjct  957  QCPSEGQEE  965



>emb|CBI25352.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 137/168 (82%), Gaps = 4/168 (2%)
 Frame = +3

Query  63   LAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQAAIGYV  242
            LAHLH   Q  IIHYN+K SN+L+D +  PK++DFGLARL+  LDR+V+S++ Q+A+GY+
Sbjct  604  LAHLH---QMSIIHYNLKSSNVLIDPSGEPKVADFGLARLLPMLDRYVLSSKIQSALGYM  660

Query  243  APELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLEC  422
            APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  LE+G V EC
Sbjct  661  APEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGALEEGKVEEC  720

Query  423  VDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  563
            VD  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P
Sbjct  721  VDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCP  768



>ref|XP_008448931.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460 [Cucumis melo]
Length=882

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W+ R+KI LGTA+ LA+LHH C+PPI+H NIK +NILLDEN   K+SD+GL +L+  L
Sbjct  698  LHWSRRYKIALGTARALAYLHHDCRPPILHLNIKSTNILLDENYEAKLSDYGLGKLLPVL  757

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN-VLI  371
            D ++++ ++ +A+GYVAPELA QSLR +EKCDVY FG+++LE+VTGR+PVE    N V+I
Sbjct  758  DNYILT-KYHSAVGYVAPELA-QSLRASEKCDVYSFGVILLELVTGRKPVESPRANQVVI  815

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE G+  +C D+ + G  + E++ V+KL L+CTS+IPS RPSMAEVVQ+L+ 
Sbjct  816  LCEYVRELLESGSASDCFDRNLRGIAENELIQVMKLGLICTSEIPSKRPSMAEVVQVLES  875

Query  552  IK  557
            I+
Sbjct  876  IR  877



>ref|XP_007040033.1| Leucine-rich repeat protein kinase family protein isoform 4 [Theobroma 
cacao]
 gb|EOY24534.1| Leucine-rich repeat protein kinase family protein isoform 4 [Theobroma 
cacao]
Length=646

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 143/183 (78%), Gaps = 3/183 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W+ RF I LGTA+ L++LHH C+PPI+H NIK +NILLDE    K+SD+GL +L+  L
Sbjct  462  LNWSRRFHIALGTARALSYLHHDCRPPILHLNIKSTNILLDEKYEAKLSDYGLGKLLPIL  521

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN-VLI  371
            D + ++ +F  A+GYVAPELA QSLR++EKCDVY FG+++LE+VTGR+PVE    N V+I
Sbjct  522  DNYGLT-KFHNAVGYVAPELA-QSLRLSEKCDVYSFGVILLELVTGRKPVESPTLNEVVI  579

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE+G+  +C D+ + G+ + E++ V+KL L+CTS+IPS RPSMAEVVQ+L+ 
Sbjct  580  LCEYVRGLLERGSASDCFDRRLHGFAENELIQVMKLGLICTSEIPSRRPSMAEVVQVLES  639

Query  552  IKT  560
            I+T
Sbjct  640  IRT  642



>ref|XP_006655414.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Oryza brachyantha]
Length=788

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 140/182 (77%), Gaps = 4/182 (2%)
 Frame = +3

Query  18   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  197
            +W  RF I++G A+ LAHLH      IIHYN+K SN+LLD N  P++ D+GL +L+  LD
Sbjct  600  SWMERFGIVIGVARALAHLHRHG---IIHYNLKSSNVLLDSNGEPRVGDYGLVKLLPMLD  656

Query  198  RHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  377
            R+V+S++ Q+A+GY+APE  C+++ V EKCDVYGFG+LILEI+TGRRPVEY ED+V++L+
Sbjct  657  RYVLSSKIQSALGYMAPEFTCRTVNVTEKCDVYGFGVLILEILTGRRPVEYLEDDVIVLS  716

Query  378  DHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  554
            D VR  L++G V +C+D+ + G +  EE + ++KL LVCTSQ+PS RP M EVV +L+++
Sbjct  717  DVVRAALDEGRVEDCLDRRLSGEFSMEEAMLIIKLGLVCTSQVPSHRPDMGEVVSMLEMV  776

Query  555  KT  560
            ++
Sbjct  777  RS  778



>ref|XP_004147984.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460-like [Cucumis sativus]
 gb|KGN55933.1| hypothetical protein Csa_3G037080 [Cucumis sativus]
Length=882

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W+ R+KI +GTA+ LA+LHH C+PPI+H NIK +NILLDEN   K+SD+GL +L+  L
Sbjct  698  LHWSRRYKIAIGTARALAYLHHDCRPPILHLNIKSTNILLDENYEGKLSDYGLGKLLPVL  757

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN-VLI  371
            D ++++ ++ +A+GYVAPELA QSLR +EKCDVY FG+++LE+VTGR+PVE    N V+I
Sbjct  758  DNYILT-KYHSAVGYVAPELA-QSLRASEKCDVYSFGVILLELVTGRKPVESPRANQVVI  815

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE G+  +C D+ + G  + E++ V+KL L+CTS+IPS RPSMAEVVQ+L+ 
Sbjct  816  LCEYVRELLESGSASDCFDRNLRGIAENELIQVMKLGLICTSEIPSKRPSMAEVVQVLES  875

Query  552  IK  557
            I+
Sbjct  876  IR  877



>ref|XP_004170853.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460-like [Cucumis sativus]
Length=882

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W+ R+KI +GTA+ LA+LHH C+PPI+H NIK +NILLDEN   K+SD+GL +L+  L
Sbjct  698  LHWSRRYKIAIGTARALAYLHHDCRPPILHLNIKSTNILLDENYEGKLSDYGLGKLLPVL  757

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDN-VLI  371
            D ++++ ++ +A+GYVAPELA QSLR +EKCDVY FG+++LE+VTGR+PVE    N V+I
Sbjct  758  DNYILT-KYHSAVGYVAPELA-QSLRASEKCDVYSFGVILLELVTGRKPVESPRANQVVI  815

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE G+  +C D+ + G  + E++ V+KL L+CTS+IPS RPSMAEVVQ+L+ 
Sbjct  816  LCEYVRELLESGSASDCFDRNLRGIAENELIQVMKLGLICTSEIPSKRPSMAEVVQVLES  875

Query  552  IK  557
            I+
Sbjct  876  IR  877



>ref|XP_010108089.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC17821.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=885

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W+ RFKI LGTA+ LA+LHH C+PPI+H NIK +NILLDEN N K+SD+GL +L+  L
Sbjct  700  LDWSRRFKIALGTARALAYLHHDCRPPILHLNIKSTNILLDENYNAKLSDYGLGKLLPIL  759

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGE-DNVLI  371
            D + ++ +F  A+GYVAPELA QSLR++EKCDVY FG+++LE+VTGR+PVE      V++
Sbjct  760  DNYGLT-KFHNAVGYVAPELA-QSLRLSEKCDVYSFGVILLELVTGRKPVESPRASEVVV  817

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE G+  +C D+ + G  + E++ V+KL L+CTS++PS RPSMAEVVQ+L+ 
Sbjct  818  LCEYVRALLESGSASDCFDRSLRGIVENELIQVMKLGLICTSEVPSRRPSMAEVVQVLES  877

Query  552  IKT  560
            I+ 
Sbjct  878  IRN  880



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 138/190 (73%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
             TW  RFKII G AKGLA+LH   Q  I HYNIK +N+ +D N  PKI DFGL  L   L
Sbjct  757  FTWRQRFKIISGIAKGLAYLH---QMNITHYNIKSTNVFIDFNDEPKIGDFGLLNLFPML  813

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  374
            D  V+S++ Q+A+GY+APE AC+++ + EKCD+YGFG+L+LE+VTG++PVEY ED+V++L
Sbjct  814  DHCVLSSKVQSALGYMAPEFACRTVNITEKCDIYGFGVLVLEVVTGKKPVEYMEDDVVVL  873

Query  375  NDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
             D VR  LE G + +C+D+  +G +  EE +PV+KL LVC S++PSSRP MAEVV IL++
Sbjct  874  CDMVRSSLEDGKIEQCIDEKLLGDFSVEEAMPVIKLGLVCASKVPSSRPDMAEVVNILEL  933

Query  552  IKTPVPNRME  581
            I+     + E
Sbjct  934  IQCSSEGQQE  943



>ref|XP_004298715.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460 [Fragaria vesca subsp. vesca]
Length=885

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = +3

Query  15   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  194
            L W+ RFKI LGTAK LA+LHH C+PP++H NIK +NILLDEN   K+SD+GL +L+  L
Sbjct  700  LYWSRRFKIALGTAKALAYLHHDCRPPLLHLNIKSTNILLDENYEAKLSDYGLGKLLPLL  759

Query  195  DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEY-GEDNVLI  371
            D H ++ ++  A+GYVAPELA QSLR++EKCDVY FG+++LE+VTGR+PVE   E+ V++
Sbjct  760  DNHGLT-KYHNAVGYVAPELA-QSLRLSEKCDVYSFGVILLELVTGRKPVESPTENQVVV  817

Query  372  LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  551
            L ++VR LLE G   +C D+ + G+ + E++ V+KL L+CTS+ PS RPSMAEVVQ+L+ 
Sbjct  818  LCEYVRGLLEGGFASDCFDRSLRGFVENELIQVMKLGLICTSEHPSRRPSMAEVVQVLES  877

Query  552  IKT  560
            I+ 
Sbjct  878  IRN  880



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800