BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN016I02

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                308   1e-100   Sesamum indicum [beniseed]
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                299   9e-97    Nicotiana sylvestris
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                298   2e-96    Solanum lycopersicum
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                298   2e-96    Nicotiana tomentosiformis
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           296   5e-96    Solanum tuberosum [potatoes]
emb|CDP13269.1|  unnamed protein product                                291   7e-94    Coffea canephora [robusta coffee]
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                290   2e-93    Erythranthe guttata [common monkey flower]
gb|KHN34377.1|  Putative pectate lyase 22                               287   4e-92    Glycine soja [wild soybean]
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                286   8e-92    
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                286   9e-92    
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                286   1e-91    Pyrus x bretschneideri [bai li]
ref|XP_010102919.1|  hypothetical protein L484_018936                   285   2e-91    Morus notabilis
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           285   2e-91    Cicer arietinum [garbanzo]
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     285   2e-91    Glycine max [soybeans]
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                285   3e-91    Populus euphratica
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                284   6e-91    Prunus mume [ume]
ref|XP_010100325.1|  hypothetical protein L484_027633                   284   7e-91    Morus notabilis
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                283   8e-91    
gb|KDO69410.1|  hypothetical protein CISIN_1g015569mg                   279   1e-90    Citrus sinensis [apfelsine]
gb|ABO28477.1|  pectate lyase precursor                                 280   1e-90    Glycine max [soybeans]
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     283   1e-90    Glycine max [soybeans]
gb|KJB51150.1|  hypothetical protein B456_008G203900                    278   2e-90    Gossypium raimondii
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18               282   3e-90    Fragaria vesca subsp. vesca
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   280   3e-90    Citrus sinensis [apfelsine]
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                281   5e-90    Brassica rapa
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             281   5e-90    Phaseolus vulgaris [French bean]
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                281   6e-90    Eucalyptus grandis [rose gum]
gb|KHG22755.1|  hypothetical protein F383_29653                         281   7e-90    Gossypium arboreum [tree cotton]
gb|KJB51151.1|  hypothetical protein B456_008G203900                    279   8e-90    Gossypium raimondii
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               281   8e-90    Populus euphratica
ref|XP_007037817.1|  Pectate lyase family protein isoform 3             277   9e-90    
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             281   9e-90    
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    280   2e-89    Arabis alpina [alpine rockcress]
ref|NP_564906.1|  putative pectate lyase 5                              280   3e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                   279   3e-89    Citrus sinensis [apfelsine]
ref|XP_002887143.1|  pectate lyase family protein                       280   4e-89    Arabidopsis lyrata subsp. lyrata
gb|KHG22990.1|  hypothetical protein F383_28754                         279   4e-89    Gossypium arboreum [tree cotton]
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   279   4e-89    Citrus sinensis [apfelsine]
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             279   5e-89    
gb|KJB51149.1|  hypothetical protein B456_008G203900                    279   7e-89    Gossypium raimondii
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          278   7e-89    
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               278   7e-89    Populus euphratica
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                278   7e-89    Tarenaya hassleriana [spider flower]
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               278   8e-89    Eucalyptus grandis [rose gum]
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     280   1e-88    Eucalyptus grandis [rose gum]
gb|AAM67091.1|  putative pectate lyase                                  278   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          278   1e-88    Cucumis sativus [cucumbers]
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               278   1e-88    Malus domestica [apple tree]
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                278   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               278   2e-88    Cucumis melo [Oriental melon]
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          279   2e-88    
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             278   2e-88    Phaseolus vulgaris [French bean]
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          277   3e-88    Populus trichocarpa [western balsam poplar]
emb|CDX92652.1|  BnaC07g39100D                                          277   3e-88    
gb|AEN70965.1|  pectate lyase                                           277   3e-88    Gossypium schwendimanii
gb|KJB50293.1|  hypothetical protein B456_008G162500                    277   3e-88    Gossypium raimondii
gb|KJB50292.1|  hypothetical protein B456_008G162500                    277   3e-88    Gossypium raimondii
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    277   3e-88    Theobroma cacao [chocolate]
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             277   4e-88    Capsella rubella
emb|CDY11033.1|  BnaA03g46920D                                          276   5e-88    Brassica napus [oilseed rape]
dbj|BAB59066.1|  pectate lyase                                          276   6e-88    Salix gilgiana
emb|CDY03419.1|  BnaC01g16630D                                          276   6e-88    
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          276   7e-88    Glycine max [soybeans]
gb|KJB19534.1|  hypothetical protein B456_003G108300                    272   1e-87    Gossypium raimondii
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    276   1e-87    
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               276   1e-87    Pyrus x bretschneideri [bai li]
emb|CDY56220.1|  BnaAnng14170D                                          275   2e-87    Brassica napus [oilseed rape]
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                275   2e-87    Brassica rapa
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          275   2e-87    Cicer arietinum [garbanzo]
emb|CDY01846.1|  BnaC06g28860D                                          274   4e-87    
gb|AFK44189.1|  unknown                                                 274   4e-87    Medicago truncatula
ref|XP_003608909.1|  Pectate lyase                                      274   5e-87    Medicago truncatula
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               274   5e-87    Nelumbo nucifera [Indian lotus]
gb|AAN60248.1|  unknown                                                 266   6e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               273   9e-87    Sesamum indicum [beniseed]
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         273   1e-86    Jatropha curcas
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                273   1e-86    Vitis vinifera
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               273   1e-86    Tarenaya hassleriana [spider flower]
ref|XP_007044917.1|  Pectate lyase family protein                       272   2e-86    Theobroma cacao [chocolate]
gb|ADB90477.1|  pectate lyase                                           273   2e-86    Gossypium hirsutum [American cotton]
gb|ADB90478.1|  pectate lyase                                           272   2e-86    Gossypium hirsutum [American cotton]
gb|AEN70977.1|  pectate lyase                                           272   2e-86    Gossypium hirsutum subsp. latifolium
gb|KHG19997.1|  hypothetical protein F383_02891                         272   2e-86    Gossypium arboreum [tree cotton]
gb|ADB90476.1|  pectate lyase                                           272   2e-86    Gossypium raimondii
gb|ADB90475.1|  pectate lyase                                           272   2e-86    Gossypium herbaceum [Arabian cotton]
gb|ADB90479.1|  pectate lyase                                           272   2e-86    Gossypium barbadense [Egyptian cotton]
gb|AEN70964.1|  pectate lyase                                           272   2e-86    Gossypium laxum
gb|AEN70963.1|  pectate lyase                                           272   2e-86    Gossypium thurberi
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5                272   3e-86    Fragaria vesca subsp. vesca
gb|AEN70981.1|  pectate lyase                                           272   3e-86    Gossypium davidsonii
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             272   4e-86    Prunus persica
ref|XP_010536660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    271   5e-86    Tarenaya hassleriana [spider flower]
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                271   7e-86    Vitis vinifera
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               271   7e-86    Camelina sativa [gold-of-pleasure]
gb|AEN70968.1|  pectate lyase                                           271   8e-86    Gossypium mustelinum
gb|AEN70984.1|  pectate lyase                                           271   8e-86    Gossypium gossypioides
ref|NP_001280201.1|  probable pectate lyase 18 precursor                271   8e-86    Prunus mume [ume]
ref|NP_001289258.1|  probable pectate lyase 18 precursor                271   1e-85    Pyrus x bretschneideri [bai li]
gb|AEN70985.1|  pectate lyase                                           270   1e-85    Gossypium lobatum
dbj|BAI94495.1|  pectate lyase                                          270   1e-85    Dianthus caryophyllus [carnation]
ref|NP_001280839.1|  probable pectate lyase 18 precursor                270   2e-85    Malus domestica [apple tree]
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             270   2e-85    Capsella rubella
emb|CAN76500.1|  hypothetical protein VITISV_004734                     270   2e-85    Vitis vinifera
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    270   2e-85    Arabis alpina [alpine rockcress]
ref|XP_002866540.1|  pectate lyase                                      270   3e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               269   4e-85    Brassica rapa
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                269   5e-85    Erythranthe guttata [common monkey flower]
dbj|BAB10560.1|  pectate lyase                                          268   7e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568967.1|  putative pectate lyase 22                             269   8e-85    Arabidopsis thaliana [mouse-ear cress]
gb|AAY85180.1|  pectate lyase                                           268   1e-84    Gossypium hirsutum [American cotton]
emb|CDY41506.1|  BnaA06g22590D                                          268   1e-84    Brassica napus [oilseed rape]
emb|CDY65626.1|  BnaC03g74840D                                          269   1e-84    Brassica napus [oilseed rape]
gb|ACK38190.1|  unknown                                                 265   1e-84    Medicago truncatula
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               267   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_003618787.1|  Pectate lyase                                      267   2e-84    Medicago truncatula
gb|KJB30978.1|  hypothetical protein B456_005G174600                    263   3e-84    Gossypium raimondii
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               267   3e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18               266   4e-84    Brassica rapa
gb|KJB08081.1|  hypothetical protein B456_001G062400                    266   5e-84    Gossypium raimondii
gb|AGC94753.1|  putative pectate lyase                                  266   6e-84    Euphorbia lathyris
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g             266   8e-84    Phaseolus vulgaris [French bean]
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               265   1e-83    Nicotiana tomentosiformis
gb|KJB30977.1|  hypothetical protein B456_005G174600                    263   1e-83    Gossypium raimondii
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               265   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO82122.1|  hypothetical protein CISIN_1g015702mg                   261   2e-83    Citrus sinensis [apfelsine]
ref|XP_010322529.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    264   3e-83    
gb|KHN05801.1|  Putative pectate lyase 22                               264   3e-83    Glycine soja [wild soybean]
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5                264   3e-83    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO82121.1|  hypothetical protein CISIN_1g015702mg                   261   7e-83    Citrus sinensis [apfelsine]
gb|KJB30976.1|  hypothetical protein B456_005G174600                    263   7e-83    Gossypium raimondii
gb|AAF19195.1|AF206319_1  pectate lyase 1                               262   2e-82    Musa acuminata AAA Group [Cavendish banana]
emb|CAA63496.1|  pectate lyase                                          262   2e-82    Musa acuminata AAA Group [Cavendish banana]
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         262   2e-82    Jatropha curcas
ref|XP_006347419.1|  PREDICTED: probable pectate lyase 18-like          262   2e-82    Solanum tuberosum [potatoes]
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           262   2e-82    Cicer arietinum [garbanzo]
emb|CDY28857.1|  BnaC06g26450D                                          262   3e-82    Brassica napus [oilseed rape]
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like          262   3e-82    Glycine max [soybeans]
emb|CDP15081.1|  unnamed protein product                                261   3e-82    Coffea canephora [robusta coffee]
emb|CDY48132.1|  BnaCnng15740D                                          262   3e-82    Brassica napus [oilseed rape]
dbj|BAF43572.1|  pectate lyase                                          262   3e-82    Prunus persica
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                    261   3e-82    Arabis alpina [alpine rockcress]
gb|AFD54065.1|  nodulation pectate lyase mutant                         259   5e-82    Lotus japonicus
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           261   6e-82    Citrus sinensis [apfelsine]
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   260   9e-82    Citrus sinensis [apfelsine]
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               261   1e-81    Brassica rapa
emb|CDY16732.1|  BnaA09g06500D                                          261   1e-81    Brassica napus [oilseed rape]
ref|XP_010695977.1|  PREDICTED: probable pectate lyase 18               260   1e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         260   2e-81    Jatropha curcas
emb|CDY34310.1|  BnaA01g14130D                                          259   2e-81    Brassica napus [oilseed rape]
emb|CDY24847.1|  BnaA08g14630D                                          259   2e-81    Brassica napus [oilseed rape]
gb|AFD54064.1|  nodulation pectate lyase mutant                         259   2e-81    Lotus japonicus
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             261   2e-81    
gb|KEH35002.1|  pectate lyase family protein                            256   2e-81    Medicago truncatula
gb|AEX93472.1|  nodulation pectate lyase                                259   2e-81    Lotus japonicus
ref|XP_002515037.1|  Pectate lyase precursor, putative                  259   2e-81    Ricinus communis
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    261   3e-81    
ref|XP_009138507.1|  PREDICTED: probable pectate lyase 18               259   4e-81    Brassica rapa
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18               259   4e-81    Brassica rapa
ref|XP_002311747.2|  pectate lyase 5 precursor family protein           258   5e-81    Populus trichocarpa [western balsam poplar]
emb|CBI17713.3|  unnamed protein product                                257   6e-81    Vitis vinifera
ref|XP_006591479.1|  PREDICTED: probable pectate lyase 5-like           258   6e-81    Glycine max [soybeans]
gb|KJB15669.1|  hypothetical protein B456_002G189900                    258   7e-81    Gossypium raimondii
emb|CDY08948.1|  BnaC08g11780D                                          258   9e-81    Brassica napus [oilseed rape]
ref|XP_003551943.1|  PREDICTED: probable pectate lyase 5-like           256   6e-80    Glycine max [soybeans]
ref|XP_002300069.1|  pectate lyase family protein                       255   7e-80    Populus trichocarpa [western balsam poplar]
ref|XP_010511733.1|  PREDICTED: probable pectate lyase 5                255   8e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010415362.1|  PREDICTED: probable pectate lyase 5                255   9e-80    Camelina sativa [gold-of-pleasure]
gb|EEE60442.1|  hypothetical protein OsJ_13660                          256   9e-80    Oryza sativa Japonica Group [Japonica rice]
gb|AAG28907.1|AC008113_23  F12A21.12                                    254   1e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     255   1e-79    
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               255   1e-79    Sesamum indicum [beniseed]
emb|CAE02420.2|  OSJNBa0095E20.8                                        257   1e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003638513.1|  Pectate lyase                                      255   1e-79    
gb|EEC76710.1|  hypothetical protein OsI_14719                          256   2e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     256   2e-79    Brachypodium distachyon [annual false brome]
ref|XP_010470701.1|  PREDICTED: probable pectate lyase 5                254   2e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010433725.1|  PREDICTED: probable pectate lyase 18               254   2e-79    Camelina sativa [gold-of-pleasure]
ref|NP_001268051.1|  pectate lyase precursor                            254   2e-79    Vitis vinifera
ref|NP_001052103.1|  Os04g0137100                                       256   2e-79    
ref|XP_002526952.1|  Pectate lyase precursor, putative                  254   3e-79    
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             254   3e-79    Capsella rubella
ref|XP_002518146.1|  Pectate lyase precursor, putative                  253   3e-79    
ref|XP_010448519.1|  PREDICTED: probable pectate lyase 18               254   3e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                253   5e-79    Elaeis guineensis
dbj|BAK06362.1|  predicted protein                                      255   5e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003601871.1|  Pectate lyase                                      253   6e-79    Medicago truncatula
gb|KJB37784.1|  hypothetical protein B456_006G219800                    250   8e-79    Gossypium raimondii
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                      253   1e-78    Populus euphratica
emb|CAA22985.1|  putative pectate lyase                                 252   1e-78    Arabidopsis thaliana [mouse-ear cress]
gb|AAK25850.1|AF360140_1  putative pectate lyase                        252   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867644.1|  pectate lyase family protein                       252   1e-78    
ref|NP_567707.1|  putative pectate lyase 18                             252   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502358.1|  PREDICTED: probable pectate lyase 5-like           252   2e-78    Cicer arietinum [garbanzo]
ref|XP_009631254.1|  PREDICTED: probable pectate lyase 18               252   2e-78    Nicotiana tomentosiformis
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    252   3e-78    Setaria italica
gb|KJB37785.1|  hypothetical protein B456_006G219800                    250   4e-78    Gossypium raimondii
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          252   6e-78    Cucumis sativus [cucumbers]
ref|XP_002314576.1|  pectate lyase 5 precursor family protein           250   7e-78    Populus trichocarpa [western balsam poplar]
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                251   9e-78    Cucumis melo [Oriental melon]
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    252   9e-78    Setaria italica
gb|AAM65103.1|  putative pectate lyase                                  250   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          249   1e-77    
ref|XP_009788173.1|  PREDICTED: probable pectate lyase 18               249   2e-77    Nicotiana sylvestris
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     250   2e-77    Elaeis guineensis
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    252   2e-77    
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     250   2e-77    Phoenix dactylifera
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                251   2e-77    Erythranthe guttata [common monkey flower]
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     251   2e-77    Elaeis guineensis
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     250   3e-77    Phoenix dactylifera
gb|KJB37786.1|  hypothetical protein B456_006G219800                    250   3e-77    Gossypium raimondii
ref|XP_011042354.1|  PREDICTED: probable pectate lyase 5                248   4e-77    Populus euphratica
gb|EPS68938.1|  hypothetical protein M569_05827                         248   4e-77    Genlisea aurea
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                249   5e-77    Sesamum indicum [beniseed]
ref|XP_008789532.1|  PREDICTED: probable pectate lyase 8                246   5e-77    
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                248   6e-77    Erythranthe guttata [common monkey flower]
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                249   6e-77    Erythranthe guttata [common monkey flower]
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    246   6e-77    Camelina sativa [gold-of-pleasure]
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                249   7e-77    Erythranthe guttata [common monkey flower]
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               249   7e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    249   7e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    249   8e-77    Camelina sativa [gold-of-pleasure]
ref|XP_008796023.1|  PREDICTED: probable pectate lyase 5                248   9e-77    Phoenix dactylifera
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         249   9e-77    Jatropha curcas
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          249   1e-76    Amborella trichopoda
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      247   1e-76    Sesamum indicum [beniseed]
ref|NP_001147553.1|  pectate lyase 8                                    249   1e-76    
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          248   2e-76    
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              249   2e-76    
ref|XP_003524720.1|  PREDICTED: pectate lyase-like                      247   2e-76    Glycine max [soybeans]
dbj|BAF43573.1|  pectate lyase                                          247   2e-76    Prunus persica
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             248   2e-76    Prunus persica
emb|CDY32557.1|  BnaC02g17500D                                          246   2e-76    Brassica napus [oilseed rape]
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           249   2e-76    
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               246   2e-76    
emb|CDY12666.1|  BnaA02g13340D                                          246   2e-76    Brassica napus [oilseed rape]
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5                246   2e-76    Brassica rapa
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18               246   2e-76    Nicotiana sylvestris
ref|XP_007163701.1|  hypothetical protein PHAVU_001G256900g             247   3e-76    Phaseolus vulgaris [French bean]
gb|KHG06252.1|  hypothetical protein F383_10745                         246   4e-76    Gossypium arboreum [tree cotton]
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                247   4e-76    Elaeis guineensis
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                247   4e-76    Nicotiana tomentosiformis
gb|KJB33886.1|  hypothetical protein B456_006G036300                    246   4e-76    Gossypium raimondii
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     246   5e-76    Elaeis guineensis
ref|XP_006351443.1|  PREDICTED: probable pectate lyase 18-like          245   5e-76    Solanum tuberosum [potatoes]
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    247   5e-76    Camelina sativa [gold-of-pleasure]
emb|CDY18738.1|  BnaC08g08780D                                          247   6e-76    Brassica napus [oilseed rape]
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    247   6e-76    Camelina sativa [gold-of-pleasure]
gb|AAM12784.1|  putative pectate-lyase                                  243   7e-76    Capsicum annuum
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          247   7e-76    Solanum tuberosum [potatoes]
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     246   7e-76    Elaeis guineensis
emb|CDY03964.1|  BnaC02g36790D                                          245   7e-76    
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             246   7e-76    Phaseolus vulgaris [French bean]
gb|KHG30349.1|  hypothetical protein F383_15991                         248   8e-76    Gossypium arboreum [tree cotton]
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                246   8e-76    Prunus mume [ume]
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                246   9e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007215475.1|  hypothetical protein PRUPE_ppa006569mg             245   1e-75    Prunus persica
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                246   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              246   1e-75    
emb|CDP03845.1|  unnamed protein product                                246   1e-75    Coffea canephora [robusta coffee]
ref|XP_002304700.1|  pectate lyase family protein                       246   1e-75    Populus trichocarpa [western balsam poplar]
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     246   1e-75    Eucalyptus grandis [rose gum]
ref|XP_010106682.1|  hypothetical protein L484_004616                   244   2e-75    Morus notabilis
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                245   2e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001141589.1|  uncharacterized protein LOC100273705               246   2e-75    Zea mays [maize]
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     245   2e-75    Eucalyptus grandis [rose gum]
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           245   2e-75    Glycine max [soybeans]
gb|EPS63108.1|  hypothetical protein M569_11679                         243   2e-75    Genlisea aurea
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                245   2e-75    Solanum lycopersicum
emb|CDO99404.1|  unnamed protein product                                245   2e-75    Coffea canephora [robusta coffee]
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                245   2e-75    Pyrus x bretschneideri [bai li]
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     245   3e-75    Phoenix dactylifera
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     245   3e-75    Phoenix dactylifera
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                245   3e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                245   3e-75    Nicotiana sylvestris
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                245   3e-75    Populus euphratica
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                244   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008230481.1|  PREDICTED: pectate lyase-like                      243   4e-75    Prunus mume [ume]
ref|XP_002870357.1|  pectate lyase family protein                       245   4e-75    
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                244   5e-75    Populus euphratica
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                244   6e-75    
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               244   6e-75    
gb|EPS69872.1|  hypothetical protein M569_04891                         243   7e-75    
emb|CDY01151.1|  BnaA04g06680D                                          244   8e-75    
gb|ACB12931.1|  pectate lyase 1-27                                      244   9e-75    
gb|KJB72155.1|  hypothetical protein B456_011G161900                    243   9e-75    
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 8                244   9e-75    
ref|XP_002297822.1|  pectate lyase family protein                       243   1e-74    
ref|XP_009340844.1|  PREDICTED: pectate lyase-like                      242   1e-74    
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                243   1e-74    
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like           242   1e-74    
emb|CBI33346.3|  unnamed protein product                                243   1e-74    
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                243   2e-74    
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                243   2e-74    
gb|AFZ78654.1|  pectate lyase                                           243   2e-74    
emb|CDY53564.1|  BnaC04g55760D                                          243   2e-74    
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     242   2e-74    
ref|XP_008367255.1|  PREDICTED: probable pectate lyase 1                241   2e-74    
ref|XP_006604001.1|  PREDICTED: pectate lyase-like                      241   3e-74    
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                242   3e-74    
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               242   3e-74    
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     242   3e-74    
gb|ABR18471.1|  unknown                                                 243   3e-74    
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             243   3e-74    
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                241   3e-74    
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                243   4e-74    
emb|CAN75298.1|  hypothetical protein VITISV_008675                     242   4e-74    
ref|NP_567409.1|  probable pectate lyase 15                             243   4e-74    
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          241   4e-74    
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                242   4e-74    
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                242   5e-74    
ref|NP_001190720.1|  probable pectate lyase 15                          241   5e-74    
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                241   6e-74    
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                241   6e-74    
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                241   6e-74    
ref|XP_002521130.1|  Pectate lyase precursor, putative                  241   7e-74    
gb|AAF19196.1|AF206320_1  pectate lyase 2                               241   7e-74    
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     241   7e-74    
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                240   1e-73    
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              239   1e-73    
gb|KJB11588.1|  hypothetical protein B456_001G267300                    239   2e-73    
gb|AAK66161.1|  pectate lyase                                           238   2e-73    
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                239   2e-73    
emb|CAC80136.1|  pectate lyase II enzyme                                240   2e-73    
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     241   2e-73    
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          240   2e-73    
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          240   2e-73    
gb|EMT28700.1|  hypothetical protein F775_17439                         238   2e-73    
gb|KJB61086.1|  hypothetical protein B456_009G339700                    241   3e-73    
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5                239   3e-73    
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     239   3e-73    
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                239   4e-73    
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     238   5e-73    
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      237   8e-73    
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               238   8e-73    
emb|CDY01119.1|  BnaA04g07000D                                          238   1e-72    
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                238   1e-72    
gb|KDO55843.1|  hypothetical protein CISIN_1g010437mg                   236   1e-72    
gb|KEH41255.1|  pectate lyase family protein                            238   1e-72    
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               238   1e-72    
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     238   1e-72    
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               238   2e-72    
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             238   2e-72    
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   238   2e-72    
gb|KHN07962.1|  Putative pectate lyase 22                               237   2e-72    
ref|XP_004304685.1|  PREDICTED: pectate lyase-like                      236   2e-72    
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     237   2e-72    
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           237   3e-72    
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                   236   3e-72    
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           237   3e-72    
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  235   3e-72    
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg             236   4e-72    
ref|NP_189110.1|  probable pectate lyase 10                             236   5e-72    
dbj|BAB01216.1|  pectate lyase                                          236   6e-72    
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             237   1e-71    
gb|AAL06861.1|  At1g04680/T1G11_6                                       233   1e-71    
ref|XP_010111662.1|  hypothetical protein L484_017690                   234   1e-71    
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         235   1e-71    
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                234   2e-71    
gb|ABR17909.1|  unknown                                                 234   2e-71    
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                234   2e-71    
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             236   2e-71    
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     232   3e-71    
emb|CDP16631.1|  unnamed protein product                                233   4e-71    
ref|NP_563715.1|  putative pectate lyase 1                              234   4e-71    
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    232   4e-71    
emb|CDX86615.1|  BnaC08g00880D                                          233   5e-71    
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    233   5e-71    
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                233   5e-71    
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             233   5e-71    
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     234   5e-71    
emb|CDX89799.1|  BnaA10g02830D                                          233   6e-71    
ref|XP_003552152.2|  PREDICTED: probable pectate lyase 20-like          234   7e-71    
gb|ADP09680.1|  pectate lyase                                           233   7e-71    
ref|XP_002884619.1|  pectate lyase family protein                       233   8e-71    
gb|AAK66160.1|  pectate lyase B                                         232   8e-71    
gb|AAZ31564.1|  pectate lyase isoform 2                                 232   8e-71    
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    232   9e-71    
ref|XP_011009338.1|  PREDICTED: probable pectate lyase 8                233   9e-71    
gb|AAZ31566.1|  pectate lyase isoform 4                                 232   9e-71    
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                233   9e-71    
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           233   1e-70    
ref|XP_007140561.1|  hypothetical protein PHAVU_008G123000g             233   1e-70    
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              233   1e-70    
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             238   1e-70    
emb|CDY61137.1|  BnaC05g48970D                                          232   1e-70    
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               231   1e-70    
ref|XP_003530885.1|  PREDICTED: probable pectate lyase 20-like          233   1e-70    
ref|XP_008382653.1|  PREDICTED: probable pectate lyase 10               231   2e-70    
ref|NP_187357.1|  putative pectate lyase 8                              231   2e-70    
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                232   2e-70    
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    232   2e-70    
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             231   2e-70    
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                232   2e-70    
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 20               232   3e-70    
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11               231   3e-70    
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                231   3e-70    
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                231   3e-70    
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                231   3e-70    
gb|AAZ31563.1|  pectate lyase isoform 1                                 230   4e-70    
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                232   4e-70    
gb|ABR26682.1|  pectate lyase                                           231   4e-70    
emb|CDY05305.1|  BnaC05g44980D                                          230   5e-70    
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                230   7e-70    
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               230   1e-69    
ref|XP_002892236.1|  pectate lyase family protein                       230   1e-69    
emb|CDY19932.1|  BnaA09g03190D                                          229   1e-69    
ref|XP_002321242.2|  pectate lyase family protein                       228   1e-69    
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          229   1e-69    
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          229   1e-69    
gb|EPS58564.1|  hypothetical protein M569_16249                         227   1e-69    
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                230   2e-69    
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                230   2e-69    
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    228   2e-69    
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          229   2e-69    
gb|EPS60822.1|  hypothetical protein M569_13978                         228   2e-69    
ref|XP_009118623.1|  PREDICTED: probable pectate lyase 1 isoform X2     229   2e-69    
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               229   2e-69    
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                229   2e-69    
ref|XP_009118622.1|  PREDICTED: probable pectate lyase 1 isoform X1     229   2e-69    
emb|CDY56668.1|  BnaCnng30870D                                          229   2e-69    
ref|XP_004515610.1|  PREDICTED: probable pectate lyase 8-like           229   3e-69    
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                229   3e-69    
gb|AAX88800.1|  ripening-related pectate lyase                          229   3e-69    
gb|AAM61584.1|  putative pectate lyase                                  228   3e-69    
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                229   3e-69    
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                228   4e-69    
ref|XP_004502359.1|  PREDICTED: probable pectate lyase 22-like          228   4e-69    
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                228   5e-69    
gb|AAB71208.1|  pectate lyase                                           228   5e-69    
gb|ABR17766.1|  unknown                                                 228   5e-69    
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                228   5e-69    
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             228   6e-69    
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                228   6e-69    
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                228   7e-69    
ref|XP_002885608.1|  pectate lyase family protein                       228   9e-69    
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             226   1e-68    
gb|ABR17791.1|  unknown                                                 227   1e-68    
emb|CDX83690.1|  BnaC07g24300D                                          227   1e-68    
ref|XP_007163700.1|  hypothetical protein PHAVU_001G256800g             226   1e-68    
emb|CDY24654.1|  BnaA05g30530D                                          226   2e-68    
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9                228   2e-68    
ref|NP_189065.2|  putative pectate lyase 9                              227   2e-68    
emb|CDX88845.1|  BnaA03g08040D                                          232   6e-68    
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                226   7e-68    
emb|CAN78491.1|  hypothetical protein VITISV_004934                     225   8e-68    
ref|XP_004247105.1|  PREDICTED: probable pectate lyase 8                225   1e-67    
ref|XP_002875382.1|  predicted protein                                  224   1e-67    
ref|XP_006350301.1|  PREDICTED: probable pectate lyase 20-like          224   1e-67    
sp|O24554.1|PLY_ZINVI  RecName: Full=Pectate lyase; AltName: Full...    223   2e-67    
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      224   2e-67    
ref|NP_189376.1|  putative pectate lyase 11                             224   2e-67    
ref|XP_003622996.1|  Pectate lyase 1-27                                 224   2e-67    
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11               223   3e-67    
gb|KCW65477.1|  hypothetical protein EUGRSUZ_G02887                     221   3e-67    
gb|AFK32131.1|  pectate lyase                                           221   4e-67    
ref|XP_009761365.1|  PREDICTED: probable pectate lyase 13 isoform X1    225   4e-67    
gb|EPS59070.1|  pectate lyase                                           218   4e-67    
ref|XP_010067356.1|  PREDICTED: probable pectate lyase 12               221   6e-67    
ref|XP_010109687.1|  hypothetical protein L484_015172                   223   6e-67    
ref|XP_001785953.1|  predicted protein                                  221   8e-67    
ref|XP_006830637.1|  hypothetical protein AMTR_s00120p00111300          225   1e-66    
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1    221   1e-66    
ref|XP_010067211.1|  PREDICTED: probable pectate lyase 13 isoform X2    222   1e-66    
ref|XP_004306262.1|  PREDICTED: probable pectate lyase 12               223   1e-66    
ref|XP_009761366.1|  PREDICTED: probable pectate lyase 13 isoform X2    223   3e-66    
ref|XP_009151964.1|  PREDICTED: putative pectate lyase 11 isoform X1    220   3e-66    
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg             221   4e-66    
ref|XP_010502717.1|  PREDICTED: putative pectate lyase 11               220   6e-66    
ref|XP_006361698.1|  PREDICTED: probable pectate lyase 13-like is...    222   6e-66    
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                    220   6e-66    
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          219   7e-66    
ref|XP_008456538.1|  PREDICTED: probable pectate lyase 12               222   7e-66    
ref|XP_010067210.1|  PREDICTED: probable pectate lyase 5 isoform X1     221   7e-66    
emb|CDY34149.1|  BnaA02g28910D                                          218   1e-65    
ref|XP_009614672.1|  PREDICTED: probable pectate lyase 13 isoform X1    221   1e-65    
gb|ABR18032.1|  unknown                                                 213   2e-65    
gb|ABK25017.1|  unknown                                                 219   2e-65    
ref|XP_004173339.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    218   2e-65    
ref|XP_002862216.1|  hypothetical protein ARALYDRAFT_359757             212   2e-65    
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg             218   2e-65    
ref|XP_011084268.1|  PREDICTED: probable pectate lyase 18               220   2e-65    
ref|XP_002519460.1|  Pectate lyase precursor, putative                  220   2e-65    
gb|AES72123.2|  pectate lyase family protein                            218   3e-65    
ref|XP_009129418.1|  PREDICTED: putative pectate lyase 11               218   3e-65    
ref|XP_004250039.1|  PREDICTED: probable pectate lyase 13 isoform X1    220   3e-65    
ref|XP_007201984.1|  hypothetical protein PRUPE_ppa004881mg             219   5e-65    
ref|XP_004150371.1|  PREDICTED: probable pectate lyase 12-like          219   6e-65    
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11               217   7e-65    
emb|CDY00156.1|  BnaC09g01450D                                          217   7e-65    
ref|XP_008241385.1|  PREDICTED: probable pectate lyase 12               219   7e-65    
emb|CDY20049.1|  BnaA09g02020D                                          217   7e-65    
ref|XP_009614673.1|  PREDICTED: probable pectate lyase 13 isoform X2    219   8e-65    
ref|XP_010435302.1|  PREDICTED: putative pectate lyase 14 isoform X2    217   9e-65    
ref|XP_010435301.1|  PREDICTED: putative pectate lyase 14 isoform X1    217   1e-64    
ref|XP_010450305.1|  PREDICTED: putative pectate lyase 14               217   1e-64    
ref|XP_004142504.1|  PREDICTED: probable pectate lyase 13-like          216   2e-64    
gb|KEH42160.1|  pectate lyase-like protein                              218   2e-64    
dbj|BAB10313.1|  pectate lyase                                          215   2e-64    
ref|XP_010037136.1|  PREDICTED: probable pectate lyase 12 isoform X2    217   2e-64    
ref|XP_009151965.1|  PREDICTED: putative pectate lyase 11 isoform X2    216   2e-64    



>ref|XP_011086701.1| PREDICTED: probable pectate lyase 5 [Sesamum indicum]
Length=401

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 153/165 (93%), Gaps = 3/165 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT T SSP+PDPEL+VQEVNEKI     +RR L FLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15   APTLTLSSPFPDPELVVQEVNEKI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            RLADCAIGFGK AIGGRDGK+YVVTD+GDDAVNPKPGTLRYG IQ+EPLWIIFARDMVIK
Sbjct  72   RLADCAIGFGKHAIGGRDGKIYVVTDSGDDAVNPKPGTLRYGVIQNEPLWIIFARDMVIK  131

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LK+EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  132  LKQELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  176



>ref|XP_009804979.1| PREDICTED: probable pectate lyase 5 [Nicotiana sylvestris]
Length=402

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 151/161 (94%), Gaps = 2/161 (1%)
 Frame = +1

Query  121  TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  300
            TFS+P PDPE+IVQEVN+KI NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQ LAD
Sbjct  19   TFSTPVPDPEVIVQEVNDKIFNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQMLAD  76

Query  301  CAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            CAIGFGKQAIGGRDGK+Y+VTDT DD VNPKPGTLRYGAIQ+EPLWIIF RDMVIKLKEE
Sbjct  77   CAIGFGKQAIGGRDGKIYIVTDTSDDPVNPKPGTLRYGAIQNEPLWIIFGRDMVIKLKEE  136

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            L++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  137  LMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  177



>ref|XP_010320956.1| PREDICTED: probable pectate lyase 5 [Solanum lycopersicum]
Length=401

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P  TFSS  PDPE+IVQ+VNEKI     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16   PIFTFSSHVPDPEVIVQQVNEKI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGKQAIGG+DGK+YVVTDT DD VNPKPGTLRYGAIQDEPLWIIF+RDMVIKL
Sbjct  73   LADCAIGFGKQAIGGKDGKIYVVTDTSDDPVNPKPGTLRYGAIQDEPLWIIFSRDMVIKL  132

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  133  KEELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  176



>ref|XP_009586995.1| PREDICTED: probable pectate lyase 5 [Nicotiana tomentosiformis]
Length=404

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 2/163 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T + S   PDPE+IVQ+VN+KI NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRL
Sbjct  19   TFSTSVAVPDPEVIVQQVNDKIFNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRL  76

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  474
            ADCAIGFGKQAIGGRDGK+Y+VTDT DD VNPKPGTLRYGAIQDEPLWIIFARDMVIKLK
Sbjct  77   ADCAIGFGKQAIGGRDGKIYIVTDTSDDPVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  136

Query  475  EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            EELI+NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  137  EELILNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>ref|XP_006341783.1| PREDICTED: probable pectate lyase 5-like [Solanum tuberosum]
Length=401

 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 150/164 (91%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P  TFSS  PDPE+IVQEVNEKI     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16   PIFTFSSHVPDPEVIVQEVNEKI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGKQAIGG+DG +Y+VTDT DD VNPKPGTLRYGAIQDEPLWIIF+RDMVIKL
Sbjct  73   LADCAIGFGKQAIGGKDGNIYIVTDTSDDPVNPKPGTLRYGAIQDEPLWIIFSRDMVIKL  132

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  133  KEELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  176



>emb|CDP13269.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   291 bits (745),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 146/165 (88%), Gaps = 3/165 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            A T T SSP PDPE +VQEVNEKI     +RR L FLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  14   ASTNTLSSPVPDPESVVQEVNEKI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRQ  70

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
             LADCAIGFGK A+GGRDG++YVVTD GD  VNPKPGTLRYG IQDEPLWIIFARDMVI+
Sbjct  71   SLADCAIGFGKHAVGGRDGEIYVVTDNGDHPVNPKPGTLRYGVIQDEPLWIIFARDMVIQ  130

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGA+VHIAGGPCITIQYVTNII+HGLNIHD
Sbjct  131  LKEELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIVHGLNIHD  175



>gb|EYU30593.1| hypothetical protein MIMGU_mgv1a007569mg [Erythranthe guttata]
Length=403

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 3/163 (2%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T TFSSP P PEL+VQ+VNE+I    ++RR LGFLSC TGNPIDDCWRCDP+WE NR+RL
Sbjct  19   TPTFSSPLPHPELVVQQVNEQI---NVSRRSLGFLSCNTGNPIDDCWRCDPDWEKNRKRL  75

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  474
            ADCAIGFGK AIGGRDGK Y VTD+GDDAVNPKPGTLRYG IQ EPLWI FARDMVIKLK
Sbjct  76   ADCAIGFGKHAIGGRDGKFYTVTDSGDDAVNPKPGTLRYGVIQSEPLWITFARDMVIKLK  135

Query  475  EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +EL++NSFKTIDGRGASVHIAGGPCITIQYVTN+I+HGLNIHD
Sbjct  136  QELMLNSFKTIDGRGASVHIAGGPCITIQYVTNVIVHGLNIHD  178



>gb|KHN34377.1| Putative pectate lyase 22 [Glycine soja]
Length=406

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DPE + QE+N KI NA++ARR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  18   PTLISSSPVQDPEFVAQEINRKI-NASVARRNLGYLSCATGNPIDDCWRCDPNWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHD
Sbjct  137  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHD  181



>ref|XP_008340139.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008361827.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=401

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 143/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DPEL++QEV E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16   PTTISSSPVKDPELVMQEVQESI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWIIF RDM IKL
Sbjct  73   LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIIFQRDMTIKL  132

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
             EEL+MNSFKTIDGRG+SVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  133  NEELMMNSFKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHD  176



>ref|XP_008389758.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 144/164 (88%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DPEL++Q+V E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17   PTTISSSPVKDPELVMQQVQESI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWI+F RDM IKL
Sbjct  74   LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIVFQRDMTIKL  133

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  134  KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  177



>ref|XP_009359258.1| PREDICTED: probable pectate lyase 5 [Pyrus x bretschneideri]
Length=401

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DP+L++QEV+E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16   PTTISSSPVKDPQLVMQEVHESI---NASRRSLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWIIF RDM IKL
Sbjct  73   LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIIFQRDMTIKL  132

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL+MNSFKTIDGRG+SVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  133  KEELMMNSFKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHD  176



>ref|XP_010102919.1| hypothetical protein L484_018936 [Morus notabilis]
 gb|EXB94437.1| hypothetical protein L484_018936 [Morus notabilis]
Length=410

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP PDPE +V EV+  I NA+++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  27   SSPTPDPERVVGEVHRSI-NASVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  85

Query  307  IGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK A+GGRDGK+YVVTD+ D D VNPKPGTLRY  IQDEPLWIIFARDMVIKLKEEL
Sbjct  86   IGFGKNAVGGRDGKIYVVTDSSDNDVVNPKPGTLRYAVIQDEPLWIIFARDMVIKLKEEL  145

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHD
Sbjct  146  IMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHD  185



>ref|XP_004501839.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=407

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
             PT   SS   +P+L+VQEVN KI NA+++RRKLG+LSCG+GNPIDDCWRCD NWE NRQ
Sbjct  18   TPTLISSSSLQNPQLVVQEVNRKI-NASVSRRKLGYLSCGSGNPIDDCWRCDSNWEKNRQ  76

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVV D  D DAVNPKPGTLRY  IQ+EPLWIIFARDMVI
Sbjct  77   RLADCAIGFGKNAIGGRDGKIYVVNDDSDNDAVNPKPGTLRYAVIQNEPLWIIFARDMVI  136

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHD
Sbjct  137  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHD  182



>ref|XP_003549832.1| PREDICTED: probable pectate lyase 18 isoform 1 [Glycine max]
Length=406

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DPE + QEV+ KI NA++ARR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  18   PTLISSSPVQDPEFVAQEVHRKI-NASVARRNLGYLSCATGNPIDDCWRCDPNWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHD
Sbjct  137  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHD  181



>ref|XP_011029589.1| PREDICTED: probable pectate lyase 5 [Populus euphratica]
Length=402

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 145/166 (87%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP     SP  DPEL+V+EV+  I     +RRKLGFLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15   APNFISCSPVQDPELVVEEVHRSI---NASRRKLGFLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD G DD VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72   RLADCAIGFGKHAIGGRDGKIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  132  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  177



>ref|XP_008221954.1| PREDICTED: probable pectate lyase 5 [Prunus mume]
Length=401

 Score =   284 bits (726),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 143/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P  T SSP  DPEL++QEV + I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16   PAFTSSSPVQDPELVIQEVQKSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD GD  VNPKPGTLRYG IQD+PLWI+F  DMVIKL
Sbjct  73   LADCAIGFGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQDQPLWIVFKGDMVIKL  132

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  133  KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  176



>ref|XP_010100325.1| hypothetical protein L484_027633 [Morus notabilis]
 gb|EXB82459.1| hypothetical protein L484_027633 [Morus notabilis]
Length=406

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            A T   SSP PD EL+VQEV + I N +I RR LG+LSCGTGNPIDDCWRCD NWE NRQ
Sbjct  18   ASTLISSSPVPDSELVVQEVQKSI-NESINRRNLGYLSCGTGNPIDDCWRCDANWEKNRQ  76

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            RLA CAIGFGK A+GGRDGK+YVVTD GD  VNPKPGTLRYG IQ+EPLWIIF RDMVIK
Sbjct  77   RLAGCAIGFGKNAVGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEEL++NSFKTIDGRGASVHIAGGPCITIQYVTN+IIHGLNIHD
Sbjct  137  LKEELMVNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGLNIHD  181



>ref|XP_008350945.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008350949.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   283 bits (725),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 143/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP   PEL++Q+V E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17   PTTISSSPVKXPELVMQQVQESI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWI+F RDM IKL
Sbjct  74   LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIVFQRDMTIKL  133

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  134  KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  177



>gb|KDO69410.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=285

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 145/166 (87%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
             P    +S  PDPEL+V EV++ I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  17   TPALILASAVPDPELVVHEVHKSI-NAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQ  73

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I
Sbjct  74   RLADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTI  133

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  134  RLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>gb|ABO28477.1| pectate lyase precursor [Glycine max]
Length=312

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DPE + QEV+ KI NA++ARR LG+LSC TGNPIDDCWRCDPN E NRQR
Sbjct  18   PTLISSSPVQDPEFVAQEVHRKI-NASVARRNLGYLSCATGNPIDDCWRCDPNCEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHD
Sbjct  137  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHD  181



>ref|NP_001242543.1| uncharacterized protein LOC100779940 precursor [Glycine max]
 gb|ACU21247.1| unknown [Glycine max]
Length=406

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPE + QEVN KI NA++ARR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  18   PALISSSPVQDPEFVAQEVNRKI-NASVARRNLGYLSCATGNPIDDCWRCDPNWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEE IMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHD
Sbjct  137  LKEERIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHD  181



>gb|KJB51150.1| hypothetical protein B456_008G203900 [Gossypium raimondii]
Length=285

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SSP  DPEL+V++V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18   PSPISSSPVQDPELVVEDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAIGGRDGKIYVVTDSSDNDAVNPKPGTLRHAVIQDEPLWIIFARDMTIR  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>ref|XP_004299169.1| PREDICTED: probable pectate lyase 18 [Fragaria vesca subsp. vesca]
Length=412

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  DPEL+VQ+V   I NA+  RRKLG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  28   SSPVQDPELVVQQVQRSIYNASTTRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  87

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  IQDEPLWIIF RDM IKLKEEL
Sbjct  88   IGFGKNAIGGRDGRIYVVTDSGDDDPVTPKPGTLRHAVIQDEPLWIIFERDMSIKLKEEL  147

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKT+DGRGASVHI+GGPCIT+QYVTNIIIHGLNIHD
Sbjct  148  IMNSFKTLDGRGASVHISGGPCITVQYVTNIIIHGLNIHD  187



>gb|KDO69409.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=337

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
             P    +S  PDPEL+V EV++ I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  17   TPALILASAVPDPELVVHEVHKSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQ  73

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I
Sbjct  74   RLADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTI  133

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  134  RLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>ref|XP_009105097.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
 emb|CDY56520.1| BnaA07g38610D [Brassica napus]
Length=407

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 146/166 (88%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT T S+   DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  20   APTFTASNHVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  76

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDG++YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  77   RLADCAIGFGKHAIGGRDGRIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVI  136

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLKEEL+MNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHD
Sbjct  137  KLKEELMMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHD  182



>ref|XP_007155507.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
 gb|ESW27501.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
Length=406

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  +P+L+ QEVN KI NA++ARR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  23   SSPVQNPQLVAQEVNRKI-NASVARRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  81

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGG++GK+YVVTD+ DD AV PKPGTLRY  IQ+EPLWIIFARDMVIKLKEEL
Sbjct  82   IGFGKNAIGGKNGKIYVVTDSSDDDAVTPKPGTLRYAVIQEEPLWIIFARDMVIKLKEEL  141

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHD
Sbjct  142  IMNSFKTIDGRGASVHIANGPCITIQYVTNVIIHGINIHD  181



>ref|XP_010023435.1| PREDICTED: probable pectate lyase 5 [Eucalyptus grandis]
 gb|KCW59688.1| hypothetical protein EUGRSUZ_H02448 [Eucalyptus grandis]
Length=406

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 147/164 (90%), Gaps = 5/164 (3%)
 Frame = +1

Query  121  TFSSPYP--DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
             F+SP P  DPEL+VQEVNE I NA+  RR LGFLSCGTGNPIDDCWRCDPNWE NRQRL
Sbjct  20   AFASPSPVQDPELVVQEVNESIFNAS--RRNLGFLSCGTGNPIDDCWRCDPNWEKNRQRL  77

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADCAIGFGK AIGGRDGK+YVVTD GDD  VNPK GTLR+  IQ+EPLWI+FARDMVI+L
Sbjct  78   ADCAIGFGKHAIGGRDGKIYVVTDPGDDNPVNPKLGTLRHAVIQNEPLWIVFARDMVIRL  137

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHD
Sbjct  138  KEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHD  181



>gb|KHG22755.1| hypothetical protein F383_29653 [Gossypium arboreum]
Length=408

 Score =   281 bits (719),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT  FSSP   PE IVQ+VNE I N TIARR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  18   APTSIFSSPLQHPEHIVQQVNESIMNGTIARRNLGFLSCGTGNPIDDCWRCDPQWEKNRQ  77

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGG+ GK+YVVTD  D D +NPKPGTLR+ AIQ +PLWI+FA DMVI
Sbjct  78   RLADCAIGFGKHAIGGKHGKIYVVTDPSDRDPINPKPGTLRHAAIQVQPLWIVFAHDMVI  137

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLK+EL+MNSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHD
Sbjct  138  KLKQELLMNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGISIHD  183



>gb|KJB51151.1| hypothetical protein B456_008G203900 [Gossypium raimondii]
Length=335

 Score =   279 bits (713),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SSP  DPEL+V++V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18   PSPISSSPVQDPELVVEDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAIGGRDGKIYVVTDSSDNDAVNPKPGTLRHAVIQDEPLWIIFARDMTIR  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>ref|XP_011005597.1| PREDICTED: probable pectate lyase 18 [Populus euphratica]
Length=403

 Score =   281 bits (719),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPEL+VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17   PALISSSPVQDPELVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  74   LADCAIGFGKNAIGGRDGKIYVVTDSGNDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQ  133

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHD
Sbjct  134  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHD  178



>ref|XP_007037817.1| Pectate lyase family protein isoform 3 [Theobroma cacao]
 gb|EOY22318.1| Pectate lyase family protein isoform 3 [Theobroma cacao]
Length=285

 Score =   277 bits (708),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DPE ++Q+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  18   PTLISSSPVQDPEAVMQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAVGGRDGKIYVVTDSGNDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQ  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHD  179



>ref|XP_007222794.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
 gb|EMJ23993.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
Length=401

 Score =   281 bits (718),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPEL++QEV + I     +RR LG+LSCGTGNP+DDCWRCDPNWE NRQR
Sbjct  16   PAFISSSPVQDPELVIQEVQKSI---NASRRNLGYLSCGTGNPMDDCWRCDPNWEKNRQR  72

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD GD  VNPKPGTLRYG IQD+PLWI+F  DMVIKL
Sbjct  73   LADCAIGFGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQDQPLWIVFKGDMVIKL  132

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  133  KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  176



>gb|KFK41187.1| hypothetical protein AALP_AA2G097000 [Arabis alpina]
Length=406

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 144/166 (87%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP  T S+P  DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  19   APAFTASTPVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  76   RLADCAIGFGKHAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLKEELIMNSFKTIDGRG SVHIAGG CIT+QYVTNIIIHG++IHD
Sbjct  136  KLKEELIMNSFKTIDGRGTSVHIAGGACITVQYVTNIIIHGISIHD  181



>ref|NP_564906.1| putative pectate lyase 5 [Arabidopsis thaliana]
 sp|Q9FXD8.2|PLY5_ARATH RecName: Full=Probable pectate lyase 5; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL58893.1|AF462797_1 At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AAM26656.1| At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AEE34690.1| putative pectate lyase 5 [Arabidopsis thaliana]
Length=408

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   S+P  +PEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22   PTFIASTPVSEPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79   LADCAIGFGKHAIGGRDGKIYVVTDSSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHD
Sbjct  139  LKEELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHD  183



>gb|KDO69408.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=402

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    +S  PDPEL+V EV++ I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18   PALILASAVPDPELVVHEVHKSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>ref|XP_002887143.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63402.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   S+P  DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRC+P WE NRQ+
Sbjct  22   PTFIASTPVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCNPKWEKNRQQ  78

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79   LADCAIGFGKHAIGGRDGKIYVVTDSSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGG CITIQYVTNIIIHGLNIHD
Sbjct  139  LKEELIMNSFKTIDGRGASVHIAGGACITIQYVTNIIIHGLNIHD  183



>gb|KHG22990.1| hypothetical protein F383_28754 [Gossypium arboreum]
Length=404

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SSP  DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18   PSPISSSPVQDPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAIGGRDGKIYVVTDSSDNDAVNPKPGTLRHAVIQDEPLWIIFARDMTIR  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  135  LKEELLMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>gb|KDO69407.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=404

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    +S  PDPEL+V EV++ I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18   PALILASAVPDPELVVHEVHKSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>ref|XP_006439991.1| hypothetical protein CICLE_v10020423mg [Citrus clementina]
 gb|ESR53231.1| hypothetical protein CICLE_v10020423mg [Citrus clementina]
Length=404

 Score =   279 bits (714),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    +S  PDPEL+V EV++ I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18   PALILASAVPDPELVVHEVHKSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>gb|KJB51149.1| hypothetical protein B456_008G203900 [Gossypium raimondii]
Length=404

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SSP  DPEL+V++V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18   PSPISSSPVQDPELVVEDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAIGGRDGKIYVVTDSSDNDAVNPKPGTLRHAVIQDEPLWIIFARDMTIR  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  179



>ref|XP_002322215.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
 gb|EEF06342.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
Length=403

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPEL+VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17   PALISSSPVQDPELVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+G DD VNP+PGTLR+  IQ+EPLWIIFARDM I+
Sbjct  74   LADCAIGFGKNAIGGRDGKIYVVTDSGNDDPVNPRPGTLRHAVIQEEPLWIIFARDMTIQ  133

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHD
Sbjct  134  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHD  178



>ref|XP_011040439.1| PREDICTED: probable pectate lyase 18 [Populus euphratica]
Length=403

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  +PEL+VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17   PALISSSPVQEPELVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVT++G DD VNPKPGTLR+  IQ+EPLWIIFARDM I+
Sbjct  74   LADCAIGFGKNAIGGRDGKIYVVTESGNDDPVNPKPGTLRHAVIQEEPLWIIFARDMTIQ  133

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  134  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  178



>ref|XP_010531484.1| PREDICTED: probable pectate lyase 5 [Tarenaya hassleriana]
Length=404

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SSP PDPEL+VQEVNEKI     +RR LG LSCG GNPIDDCWRCDP+WE NRQR
Sbjct  18   PSFVASSPVPDPELVVQEVNEKI---NASRRNLGVLSCGNGNPIDDCWRCDPHWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD T  D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  75   LADCAIGFGKHAIGGRDGKIYVVTDPTDKDPVNPKPGTLRHAVIQDEPLWIIFARDMVIK  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRG+SVHIAGG C+TIQYVTNIIIHG+N+HD
Sbjct  135  LKEELIMNSFKTIDGRGSSVHIAGGACVTIQYVTNIIIHGINVHD  179



>ref|XP_010026892.1| PREDICTED: probable pectate lyase 18 [Eucalyptus grandis]
Length=408

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP  DPE +V EV++ IANAT  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADC
Sbjct  23   FSSPVQDPEGVVHEVHQSIANATRNRRGLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADC  82

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK A+GGRDG++YVVTD+G DD VNPKPGT+R+  IQDEPLWIIF RDM I+LKEE
Sbjct  83   AIGFGKNAVGGRDGRIYVVTDSGDDDPVNPKPGTIRHAVIQDEPLWIIFQRDMSIQLKEE  142

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKT+DGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHD
Sbjct  143  LIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGLHIHD  183



>gb|KCW83228.1| hypothetical protein EUGRSUZ_B00168 [Eucalyptus grandis]
Length=484

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP  DPE +V EV++ IANAT  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADC
Sbjct  99   FSSPVQDPEGVVHEVHQSIANATRNRRGLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADC  158

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK A+GGRDG++YVVTD+G DD VNPKPGT+R+  IQDEPLWIIF RDM I+LKEE
Sbjct  159  AIGFGKNAVGGRDGRIYVVTDSGDDDPVNPKPGTIRHAVIQDEPLWIIFQRDMSIQLKEE  218

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKT+DGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHD
Sbjct  219  LIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGLHIHD  259



>gb|AAM67091.1| putative pectate lyase [Arabidopsis thaliana]
Length=406

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   S+P  +PEL+VQEVNEKI     ARR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  20   PTFIASTPVSEPELVVQEVNEKI---NAARRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG DGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKHAIGGLDGKIYVVTDSSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHD
Sbjct  137  LKEELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHD  181



>ref|XP_004152502.1| PREDICTED: probable pectate lyase 22-like [Cucumis sativus]
 gb|KGN64357.1| hypothetical protein Csa_1G049960 [Cucumis sativus]
Length=413

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 144/163 (88%), Gaps = 6/163 (4%)
 Frame = +1

Query  130  SPYP----DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLA  297
            SP P    +PEL+VQEV+  I NAT  RR LG+LSCGTGNPIDDCWRCD NWE NRQRLA
Sbjct  27   SPNPAAVSNPELVVQEVHRSIINAT-KRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLA  85

Query  298  DCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  474
            DC IGFGK AIGGRDGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+LK
Sbjct  86   DCGIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIRLK  145

Query  475  EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  146  EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  188



>ref|XP_008351757.1| PREDICTED: probable pectate lyase 18 [Malus domestica]
Length=411

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  33   DPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGKLYVVTD+GDD AVNPKPGTLR+  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKLYVVTDSGDDDAVNPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHD  186



>ref|XP_010250930.1| PREDICTED: probable pectate lyase 5 [Nelumbo nucifera]
Length=406

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 142/164 (87%), Gaps = 4/164 (2%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T   SS   DPEL+V+EV   I      RR LGFLSCGTGNPIDDCWRCDPNWE NRQRL
Sbjct  21   TLINSSAVQDPELVVKEVERSI---NTTRRNLGFLSCGTGNPIDDCWRCDPNWEKNRQRL  77

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADCAIGFGKQAIGGRDG++YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+L
Sbjct  78   ADCAIGFGKQAIGGRDGRIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIQL  137

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEEL+MNSFKTIDGRGASVHIAGGPCITIQYV NIIIHGLNIHD
Sbjct  138  KEELLMNSFKTIDGRGASVHIAGGPCITIQYVNNIIIHGLNIHD  181



>ref|XP_008439105.1| PREDICTED: probable pectate lyase 22 [Cucumis melo]
Length=411

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQEV+  I NAT  RR LG+LSCGTGNPIDDCWRCD NWE NRQRLADC IGFGK
Sbjct  33   DPELVVQEVHRSIINAT-KRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLADCGIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDAGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIRLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  186



>ref|XP_006476937.1| PREDICTED: probable pectate lyase 18-like [Citrus sinensis]
Length=449

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    +S  PDPEL+V EV++ I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  63   PALISASAVPDPELVVHEVHKSI-NAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  119

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  120  LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  179

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  180  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  224



>ref|XP_007137977.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
 gb|ESW09971.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
Length=410

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 148/167 (89%), Gaps = 4/167 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  285
            PT  FSSP  + E +VQEVN KI NA++AR  R LG+LSCG+GNPIDDCWRCDPNWE NR
Sbjct  18   PTLIFSSPLHNAEEVVQEVNRKI-NASMARHRRNLGYLSCGSGNPIDDCWRCDPNWEQNR  76

Query  286  QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  462
            QRLADCAIGFGK AIGGRDGK+YVV D GDD  VNPKPGTLR+  IQDEPLWIIFARDMV
Sbjct  77   QRLADCAIGFGKNAIGGRDGKIYVVDDAGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMV  136

Query  463  IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            I+LKEEL+MNSFKTIDGRGASVHIAGGPCIT+QYVTN+IIHG+++HD
Sbjct  137  IQLKEELLMNSFKTIDGRGASVHIAGGPCITVQYVTNVIIHGIHLHD  183



>ref|XP_002318694.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
 gb|EEE96914.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
Length=403

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPE +VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17   PALVSSSPVQDPEFVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGR+GK+YVVT++G DD VNPKPGTLR+  IQ+EPLWIIFARDM I+
Sbjct  74   LADCAIGFGKNAIGGRNGKIYVVTESGNDDPVNPKPGTLRHAVIQEEPLWIIFARDMTIQ  133

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  134  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  178



>emb|CDX92652.1| BnaC07g39100D [Brassica napus]
Length=406

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WE++RQRLADC
Sbjct  21   FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWETHRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIRLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHD
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHD  181



>gb|AEN70965.1| pectate lyase [Gossypium schwendimanii]
Length=411

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCA
Sbjct  30   SSPVQDPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCA  86

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDGK+YVVTD+GDD  +NPKPGTLR+  IQDEPLWIIFARDM I+LKEEL
Sbjct  87   IGFGKNAIGGRDGKIYVVTDSGDDDPINPKPGTLRHAVIQDEPLWIIFARDMTIQLKEEL  146

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  147  IMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|KJB50293.1| hypothetical protein B456_008G162500 [Gossypium raimondii]
Length=414

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT  FSSP   P+L+VQ+V E I N TIARR LGFLSCGTGNPIDDCWRCDP+WE NRQ
Sbjct  18   APTSIFSSPLQHPDLVVQQVIESIMNGTIARRNLGFLSCGTGNPIDDCWRCDPHWEKNRQ  77

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGG+ GK+YVVTD  D D +NPKPGTLR+ AIQ EPLW++FA DMVI
Sbjct  78   RLADCAIGFGKHAIGGKHGKIYVVTDPSDRDPINPKPGTLRHAAIQVEPLWVVFAHDMVI  137

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLK+EL++NSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHD
Sbjct  138  KLKQELLVNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGISIHD  183



>gb|KJB50292.1| hypothetical protein B456_008G162500 [Gossypium raimondii]
Length=408

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT  FSSP   P+L+VQ+V E I N TIARR LGFLSCGTGNPIDDCWRCDP+WE NRQ
Sbjct  18   APTSIFSSPLQHPDLVVQQVIESIMNGTIARRNLGFLSCGTGNPIDDCWRCDPHWEKNRQ  77

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGG+ GK+YVVTD  D D +NPKPGTLR+ AIQ EPLW++FA DMVI
Sbjct  78   RLADCAIGFGKHAIGGKHGKIYVVTDPSDRDPINPKPGTLRHAAIQVEPLWVVFAHDMVI  137

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLK+EL++NSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHD
Sbjct  138  KLKQELLVNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGISIHD  183



>ref|XP_007037815.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY22316.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=404

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SSP  DPE ++Q+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  18   PTLISSSPVQDPEAVMQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75   LADCAIGFGKNAVGGRDGKIYVVTDSGNDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQ  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHD
Sbjct  135  LKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHD  179



>ref|XP_006302330.1| hypothetical protein CARUB_v10020387mg [Capsella rubella]
 gb|EOA35228.1| hypothetical protein CARUB_v10020387mg [Capsella rubella]
Length=409

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            ++P  DP+L+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQRLADCA
Sbjct  28   TTPVSDPDLVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQRLADCA  84

Query  307  IGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLRY  IQDEPLWIIFARDMVIKLKEEL
Sbjct  85   IGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRYAVIQDEPLWIIFARDMVIKLKEEL  144

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRG +VHIAGG CIT+QYVTN+IIHG+NIHD
Sbjct  145  IMNSFKTIDGRGVNVHIAGGACITVQYVTNVIIHGINIHD  184



>emb|CDY11033.1| BnaA03g46920D [Brassica napus]
Length=406

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WES+R RLADC
Sbjct  21   FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWESHRHRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIRLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHD
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHD  181



>dbj|BAB59066.1| pectate lyase [Salix gilgiana]
Length=409

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP     SP  DPE++V+EV+  I     +RRKLGFLSCGTGNPIDDCWRCDP W  NRQ
Sbjct  22   APNFISCSPVQDPEVVVEEVHRSI---NASRRKLGFLSCGTGNPIDDCWRCDPKWGENRQ  78

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+Y VTD+GDD  VNPKPGTLRY  IQDEPLWI+FARDMVI
Sbjct  79   RLADCAIGFGKHAIGGRDGKIYAVTDSGDDDPVNPKPGTLRYAVIQDEPLWIVFARDMVI  138

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KL+EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHD
Sbjct  139  KLREELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGVNIHD  184



>emb|CDY03419.1| BnaC01g16630D [Brassica napus]
Length=406

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCD NWE NRQRLADC
Sbjct  21   FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCSTGNPIDDCWRCDSNWEKNRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  IQDEPLWIIF RDM I LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVIQDEPLWIIFQRDMTIHLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+++HD
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHLHD  181



>ref|XP_003523121.1| PREDICTED: probable pectate lyase 18-like [Glycine max]
Length=408

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 149/167 (89%), Gaps = 4/167 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  285
            PT   SSP  +P+ +VQEVN+KI N +IAR  R LG+LSCG+GNPIDDCWRCDPNWE NR
Sbjct  18   PTLISSSPVLNPQEVVQEVNKKI-NGSIARPRRNLGYLSCGSGNPIDDCWRCDPNWEQNR  76

Query  286  QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  462
            QRLADCAIGFGK AIGGRDGK+YVV D GDD AVNPKPGTLR+  IQDEPLWIIFARDMV
Sbjct  77   QRLADCAIGFGKNAIGGRDGKIYVVEDDGDDDAVNPKPGTLRHAVIQDEPLWIIFARDMV  136

Query  463  IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            I+LKEEL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHD
Sbjct  137  IQLKEELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHD  183



>gb|KJB19534.1| hypothetical protein B456_003G108300 [Gossypium raimondii]
Length=292

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>ref|XP_004157771.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 22-like 
[Cucumis sativus]
Length=413

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 143/163 (88%), Gaps = 6/163 (4%)
 Frame = +1

Query  130  SPYP----DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLA  297
            SP P    +PEL+VQEV+  I NAT  RR LG+LSCGTGNPIDDCWRCD NWE NRQRLA
Sbjct  27   SPNPAAVSNPELVVQEVHRSIINAT-KRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLA  85

Query  298  DCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  474
            DC IGFGK AIGGRDG +YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+LK
Sbjct  86   DCGIGFGKNAIGGRDGXIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIRLK  145

Query  475  EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  146  EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  188



>ref|XP_009359518.1| PREDICTED: probable pectate lyase 18 [Pyrus x bretschneideri]
Length=411

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  33   DPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDNPVNPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  186



>emb|CDY56220.1| BnaAnng14170D [Brassica napus]
Length=406

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 144/166 (87%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SS   DPEL+VQEVN+ I     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  19   APTYVASSHVSDPELVVQEVNQHI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK+AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQ+EPLWIIFARDMVI
Sbjct  76   RLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQEEPLWIIFARDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLKEELIMNSFKTIDGRGA+VHIAGG CIT+QYVTNIIIHG++IHD
Sbjct  136  KLKEELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGISIHD  181



>ref|XP_009105327.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 144/166 (87%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SS   DPEL+VQEVN+ I     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  19   APTYVASSHVSDPELVVQEVNQHI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK+AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQ+EPLWIIFARDMVI
Sbjct  76   RLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQEEPLWIIFARDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLKEELIMNSFKTIDGRGA+VHIAGG CIT+QYVTNIIIHG++IHD
Sbjct  136  KLKEELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGVSIHD  181



>ref|XP_004515847.1| PREDICTED: probable pectate lyase 22-like [Cicer arietinum]
Length=411

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP P+P L+ Q+V  KI N +IARR LG+LSCG+GNPIDDCWRCDPNWE NRQRLADCA
Sbjct  27   SSPLPNPHLVSQQVTRKI-NESIARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCA  85

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGG++GK+YVVTD+ DD  VNPKPGTLRY  IQDEPLWIIF RDMVI+LKEEL
Sbjct  86   IGFGKNAIGGKNGKIYVVTDSKDDDPVNPKPGTLRYAVIQDEPLWIIFERDMVIQLKEEL  145

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHD
Sbjct  146  IMNSFKTIDGRGASVHIANGPCITIQYVTNVIIHGINIHD  185



>emb|CDY01846.1| BnaC06g28860D [Brassica napus]
Length=406

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 145/166 (87%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SS   DPEL+VQEVN++I     +RR LG LSCGTGNPIDDCWRCDP WE+NRQ
Sbjct  19   APTYVASSHVSDPELVVQEVNQQI---NASRRNLGVLSCGTGNPIDDCWRCDPKWENNRQ  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK+AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQ+EPLWIIFARDMVI
Sbjct  76   RLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQEEPLWIIFARDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLKEELIMNSFKTIDGRGA+ HIAGG CIT+QYVTNIIIHG++IHD
Sbjct  136  KLKEELIMNSFKTIDGRGANAHIAGGACITVQYVTNIIIHGISIHD  181



>gb|AFK44189.1| unknown [Medicago truncatula]
Length=407

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 2/158 (1%)
 Frame = +1

Query  133  PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            P  DP+L+ QEVN KI N ++ARR LG+LSCG+GNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  25   PLQDPDLVTQEVNRKI-NGSLARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCAIG  83

Query  313  FGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FGK AIGG++GK+YVVTD+GDD  V PKPGTLR+  IQDEPLWIIFARDMVI+LKEELIM
Sbjct  84   FGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRFAVIQDEPLWIIFARDMVIQLKEELIM  143

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHD
Sbjct  144  NSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGIHIHD  181



>ref|XP_003608909.1| Pectate lyase [Medicago truncatula]
 gb|AES91106.1| pectate lyase family protein [Medicago truncatula]
Length=407

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 2/158 (1%)
 Frame = +1

Query  133  PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            P  DP+L+ QEVN KI N ++ARR LG+LSCG+GNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  25   PLQDPDLVTQEVNRKI-NGSLARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCAIG  83

Query  313  FGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FGK AIGG++GK+YVVTD+GDD  V PKPGTLR+  IQDEPLWIIFARDMVI+LKEELIM
Sbjct  84   FGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRFAVIQDEPLWIIFARDMVIQLKEELIM  143

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHD
Sbjct  144  NSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGIHIHD  181



>ref|XP_010248740.1| PREDICTED: probable pectate lyase 18 [Nelumbo nucifera]
Length=405

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 142/159 (89%), Gaps = 4/159 (3%)
 Frame = +1

Query  130  SPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAI  309
            S   DPEL+V++V   I     +RR LGFLSCGTGNPIDDCWRCDPNWE NRQRLADCAI
Sbjct  25   SAVQDPELVVKDVERSI---NASRRNLGFLSCGTGNPIDDCWRCDPNWEKNRQRLADCAI  81

Query  310  GFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELI  486
            GFGKQA+GGRDG++YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDMVIKLKEELI
Sbjct  82   GFGKQAVGGRDGRIYVVTDSGDDNPVNPKPGTLRFAVIQDEPLWIIFARDMVIKLKEELI  141

Query  487  MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            MNSFKTIDGRGASVHIAGGPCITIQYV+NIIIHGL+IHD
Sbjct  142  MNSFKTIDGRGASVHIAGGPCITIQYVSNIIIHGLHIHD  180



>gb|AAN60248.1| unknown [Arabidopsis thaliana]
Length=193

 Score =   266 bits (680),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S P  DPEL+V+EV+ KI N +I+RRKLGF SCG+GNPIDDCWRCD +WE NR+RLADC 
Sbjct  25   SLPVSDPELVVEEVHRKI-NESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLADCG  83

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF RDM I+LKEEL
Sbjct  84   IGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFKRDMTIQLKEEL  143

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKT+DGRGASVHI+GGPC TIQYVTNIIIHGL+IHD
Sbjct  144  IMNSFKTLDGRGASVHISGGPCXTIQYVTNIIIHGLHIHD  183



>ref|XP_011086987.1| PREDICTED: probable pectate lyase 22 [Sesamum indicum]
Length=404

 Score =   273 bits (698),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 147/166 (89%), Gaps = 5/166 (3%)
 Frame = +1

Query  112  PTCTFSSP-YPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            P+   SSP   DPEL+VQEV+ K+    ++RRKLGFLSC TGNPIDDCWRCDPNWE NRQ
Sbjct  17   PSLIASSPTLQDPELVVQEVHRKL---NVSRRKLGFLSCNTGNPIDDCWRCDPNWEENRQ  73

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            +LADCAIGFGK AIGG+DG++YVVTD+GDD  VNPKPGTLRY  IQD+PLWIIFARDMVI
Sbjct  74   KLADCAIGFGKNAIGGKDGEIYVVTDSGDDDPVNPKPGTLRYAVIQDQPLWIIFARDMVI  133

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +LKEELIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG++IHD
Sbjct  134  QLKEELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGVHIHD  179



>gb|KDP46367.1| hypothetical protein JCGZ_10207 [Jatropha curcas]
Length=403

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP   FSSP  DPEL+VQEV+  I  +   RR L +LSCGTGNPIDDCWRCDP+WE NRQ
Sbjct  16   APPFVFSSPVQDPELVVQEVHRSINES---RRSLAYLSCGTGNPIDDCWRCDPSWERNRQ  72

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGR+G++YVVTDT D DAVNPKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  73   RLADCAIGFGKNAIGGRNGRIYVVTDTSDEDAVNPKPGTLRHAVIQDEPLWIIFQRDMVI  132

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +LK+EL+MNS+KTIDGRGASVHIAGGPCITI Y TNIIIHGL+IHD
Sbjct  133  RLKQELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGLHIHD  178



>ref|XP_002285340.1| PREDICTED: probable pectate lyase 5 [Vitis vinifera]
 emb|CBI16836.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 143/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  DPEL+V+EV+++I     +RR LGFLSCGTGNPIDDCWRCDP+WE NRQ LADC+
Sbjct  22   SSPVQDPELVVEEVHKRI---NASRRNLGFLSCGTGNPIDDCWRCDPDWEKNRQGLADCS  78

Query  307  IGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFG+ AIGGRDG++YVVTD+GD D VNPKPGTLRY  IQ EPLWIIF RDMVIKLKEEL
Sbjct  79   IGFGRHAIGGRDGEIYVVTDSGDYDPVNPKPGTLRYAVIQKEPLWIIFQRDMVIKLKEEL  138

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  139  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  178



>ref|XP_010545988.1| PREDICTED: probable pectate lyase 22 [Tarenaya hassleriana]
Length=412

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = +1

Query  139  PDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFG  318
            PDPEL+VQEV+ K+ N +IARR LGF SC TGNPIDDCWRCDP WE NRQRLADCAIGFG
Sbjct  33   PDPELVVQEVHRKL-NESIARRNLGFFSCRTGNPIDDCWRCDPEWEKNRQRLADCAIGFG  91

Query  319  KQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNS  495
            K AIGGRDGKLYVVTD  D D VNPKPGTLRY  IQDEPLWIIF RDM I+LKEEL+MNS
Sbjct  92   KNAIGGRDGKLYVVTDPSDSDPVNPKPGTLRYAVIQDEPLWIIFNRDMTIQLKEELMMNS  151

Query  496  FKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            FKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHD
Sbjct  152  FKTIDGRGASVHIAGGPCITIQYVTNVIIHGVHIHD  187



>ref|XP_007044917.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY00749.1| Pectate lyase family protein [Theobroma cacao]
Length=406

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT  FSSP  DPE +VQ+VNE + NATIARR LG+LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  16   APTFIFSSPVQDPEQVVQQVNESVRNATIARRNLGYLSCGTGNPIDDCWRCDPRWEKNRQ  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFA DMVI
Sbjct  76   RLADCAIGFGKHAIGGRDGKIYVVTDSSDRDPVNPKPGTLRHAVIQDEPLWIIFASDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KLKEEL+MNSFKTIDGRGA+VHIAGGPCITIQYVT
Sbjct  136  KLKEELLMNSFKTIDGRGANVHIAGGPCITIQYVT  170



>gb|ADB90477.1| pectate lyase [Gossypium hirsutum]
Length=411

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|ADB90478.1| pectate lyase [Gossypium hirsutum]
 gb|ADB90480.1| pectate lyase [Gossypium barbadense]
 gb|AEN70970.1| pectate lyase [Gossypium darwinii]
 gb|AEN70972.1| pectate lyase [Gossypium tomentosum]
 gb|AEN70974.1| pectate lyase [Gossypium barbadense var. brasiliense]
 gb|AEN70976.1| pectate lyase [Gossypium barbadense var. peruvianum]
 gb|AEN70978.1| pectate lyase [Gossypium hirsutum subsp. latifolium]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|AEN70977.1| pectate lyase [Gossypium hirsutum subsp. latifolium]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|KHG19997.1| hypothetical protein F383_02891 [Gossypium arboreum]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|ADB90476.1| pectate lyase [Gossypium raimondii]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|ADB90475.1| pectate lyase [Gossypium herbaceum]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|ADB90479.1| pectate lyase [Gossypium barbadense]
 gb|AEN70967.1| pectate lyase [Gossypium mustelinum]
 gb|AEN70969.1| pectate lyase [Gossypium darwinii]
 gb|AEN70971.1| pectate lyase [Gossypium tomentosum]
 gb|AEN70973.1| pectate lyase [Gossypium barbadense var. brasiliense]
 gb|AEN70975.1| pectate lyase [Gossypium barbadense var. peruvianum]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|AEN70964.1| pectate lyase [Gossypium laxum]
 gb|AEN70983.1| pectate lyase [Gossypium aridum]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|AEN70963.1| pectate lyase [Gossypium thurberi]
 gb|AEN70966.1| pectate lyase [Gossypium turneri]
 gb|AEN70979.1| pectate lyase [Gossypium armourianum]
 gb|AEN70980.1| pectate lyase [Gossypium harknessii]
 gb|AEN70986.1| pectate lyase [Gossypium trilobum]
 gb|KJB19533.1| hypothetical protein B456_003G108300 [Gossypium raimondii]
Length=411

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>ref|XP_004310004.1| PREDICTED: probable pectate lyase 5 [Fragaria vesca subsp. vesca]
Length=402

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = +1

Query  133  PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            P+P+P+ ++QEV+  I     +RR LG+LSCG+GNPIDDCWRCDP WE NRQRLADCAIG
Sbjct  24   PFPNPDSVIQEVHRSI---NASRRSLGYLSCGSGNPIDDCWRCDPKWEQNRQRLADCAIG  80

Query  313  FGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMN  492
            FGK AIGGRDGK+YVVTD GD  VNPKPGTLRYG IQDEPLWIIF  DM IKLKEEL+MN
Sbjct  81   FGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQDEPLWIIFKGDMTIKLKEELMMN  140

Query  493  SFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            SFKTIDGRGA+VHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  141  SFKTIDGRGANVHIAGGPCITIQYVTNIIIHGLNIHD  177



>gb|AEN70981.1| pectate lyase [Gossypium davidsonii]
 gb|AEN70982.1| pectate lyase [Gossypium klotzschianum]
Length=411

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V   I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVQRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>ref|XP_007209185.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
 gb|ABV32549.1| pectase lyase [Prunus persica]
 gb|EMJ10384.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
Length=413

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +1

Query  109  APTCTFSSPYP-DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  285
             PT   S P   +PEL+VQ+V   I N +++RR LG+LSCGTGNPIDDCWRCDPNWE NR
Sbjct  23   TPTLIASRPLQQNPELVVQDVQRSI-NDSVSRRNLGYLSCGTGNPIDDCWRCDPNWEQNR  81

Query  286  QRLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMV  462
            QRLADCAIGFGK AIGGRDGK+YVVTD+GD D VNPKPGTLR+  IQDEPLWIIF RDM 
Sbjct  82   QRLADCAIGFGKNAIGGRDGKIYVVTDSGDNDPVNPKPGTLRHAVIQDEPLWIIFQRDMT  141

Query  463  IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            I+LKEELIMNSFKTIDGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHD
Sbjct  142  IQLKEELIMNSFKTIDGRGASVHIAGGPCITVQFVTNIIIHGLHIHD  188



>ref|XP_010536660.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 18 [Tarenaya 
hassleriana]
Length=401

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V+EV+  I  +  ARRKLG+LSCGTGNPIDDCWRCDPNWE  RQRLADCAIGFGK
Sbjct  27   DPETVVEEVHRSINASVAARRKLGYLSCGTGNPIDDCWRCDPNWEKTRQRLADCAIGFGK  86

Query  322  QAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG++YVVTD+G DD VNPKPGTLRY  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  87   NAIGGRDGRIYVVTDSGNDDPVNPKPGTLRYAVIQDEPLWIIFQRDMTIQLKEELIMNSF  146

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHG+++HD
Sbjct  147  KTIDGRGASVHIAGGPCITVQYVTNIIIHGIHVHD  181



>ref|XP_010663062.1| PREDICTED: probable pectate lyase 5 [Vitis vinifera]
 emb|CBI14899.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 142/165 (86%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPEL++QEV+  I  +   RR LG+LSCG+GNPIDDCWRC+ NWE NRQ 
Sbjct  17   PILIASSPVQDPELVIQEVHRSINES---RRNLGYLSCGSGNPIDDCWRCNANWEKNRQS  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD+ DD  VNPKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  74   LADCAIGFGKNAIGGKNGKIYVVTDSSDDDVVNPKPGTLRYAVIQDEPLWIIFARDMVIK  133

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHD
Sbjct  134  LKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHD  178



>ref|XP_010459939.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=412

 Score =   271 bits (693),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T   SSP  DPEL+V+EV+ KI N +++RRKLGF SCGTGNPIDDCWRCD +WE NR+RL
Sbjct  23   TLASSSPVSDPELVVEEVHRKI-NESMSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRL  81

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+L
Sbjct  82   ADCGIGFGKNAIGGRDGQIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQL  141

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  142  KEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  185



>gb|AEN70968.1| pectate lyase [Gossypium mustelinum]
Length=411

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE++VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPEVVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>gb|AEN70984.1| pectate lyase [Gossypium gossypioides]
Length=411

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCW+CDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWKCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>ref|NP_001280201.1| probable pectate lyase 18 precursor [Prunus mume]
 dbj|BAE48664.1| Pectate lyase [Prunus mume]
Length=413

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = +1

Query  112  PTCTFSSPYP-DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            PT   S P   +PEL+VQ+V   I N +++RR LG+LSCGTGNPIDDCWRCDPNWE NR+
Sbjct  24   PTLIASRPLQQNPELVVQDVQRSI-NDSVSRRNLGYLSCGTGNPIDDCWRCDPNWEQNRE  82

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK A+GGRDGK+YVVTD+GD D VNPKPGTLR+  IQDEPLWIIF RDM I
Sbjct  83   RLADCAIGFGKNAVGGRDGKIYVVTDSGDSDPVNPKPGTLRHAVIQDEPLWIIFQRDMTI  142

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHD
Sbjct  143  QLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHD  188



>ref|NP_001289258.1| probable pectate lyase 18 precursor [Pyrus x bretschneideri]
 gb|AHX37592.1| pectate lyase [Pyrus x bretschneideri]
Length=414

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 145/167 (87%), Gaps = 4/167 (2%)
 Frame = +1

Query  112  PTCTFSSPY--PDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  285
            PT   S P    DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NR
Sbjct  24   PTLISSRPLHLQDPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNR  82

Query  286  QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  462
            Q LADCAIGFGK AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQ+EPLWIIF RDM 
Sbjct  83   QSLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQEEPLWIIFQRDMT  142

Query  463  IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            I+LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHD
Sbjct  143  IQLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHD  189



>gb|AEN70985.1| pectate lyase [Gossypium lobatum]
Length=411

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPEHVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  186



>dbj|BAI94495.1| pectate lyase [Dianthus caryophyllus]
Length=407

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 4/166 (2%)
 Frame = +1

Query  115  TCTFSSP--YPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            T   S+P  +PDPEL+V +V+  I N ++ARR LG+LSCGTGNPIDDCWRCDP+WESNRQ
Sbjct  18   TLVLSAPAIHPDPELVVNQVHRAI-NESVARRNLGYLSCGTGNPIDDCWRCDPDWESNRQ  76

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK A+GG++G++YVVTD+ D D V PKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  77   RLADCAIGFGKNALGGKNGRIYVVTDSSDNDPVTPKPGTLRHAVIQDEPLWIIFQRDMVI  136

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +LKEELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG+N+HD
Sbjct  137  RLKEELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGINVHD  182



>ref|NP_001280839.1| probable pectate lyase 18 precursor [Malus domestica]
 ref|XP_008346717.1| PREDICTED: probable pectate lyase 18 [Malus domestica]
 gb|AAQ84042.1| pectate lyase [Malus domestica]
Length=418

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NRQ LADCAIGFGK
Sbjct  40   DPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQSLADCAIGFGK  98

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  99   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEELIMNSF  158

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHD
Sbjct  159  KTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHD  193



>ref|XP_006280553.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
 gb|EOA13451.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
Length=412

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T   S P  DPEL+V+EV+ KI N +++RRKLGF SCGTGNPIDDCWRCD +WE NR+RL
Sbjct  23   TLASSLPVSDPELVVEEVHRKI-NESVSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRL  81

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+L
Sbjct  82   ADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQL  141

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEELIMNSFKT+DGRGASVHIAGGPCITIQYVTNIIIHGL+IHD
Sbjct  142  KEELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGLHIHD  185



>emb|CAN76500.1| hypothetical protein VITISV_004734 [Vitis vinifera]
Length=403

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 141/165 (85%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPEL+ QEV+  I  +   RR LG+LSCG+GNPIDDCWRC+ NWE NRQ 
Sbjct  17   PILIASSPVQDPELVXQEVHRSINES---RRNLGYLSCGSGNPIDDCWRCNANWEKNRQS  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD+ DD  VNPKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  74   LADCAIGFGKNAIGGKNGKIYVVTDSSDDDVVNPKPGTLRYAVIQDEPLWIIFARDMVIK  133

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHD
Sbjct  134  LKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHD  178



>gb|KFK28033.1| hypothetical protein AALP_AA8G463100 [Arabis alpina]
Length=411

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SS   DPELIV EV+ KI N +I+RRKLGF SCGTGNPIDDCWRCD +WE NR+RLADC 
Sbjct  26   SSHVSDPELIVDEVHRKI-NESISRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRLADCG  84

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF RDM I+LKEEL
Sbjct  85   IGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFNRDMTIQLKEEL  144

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  145  IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  184



>ref|XP_002866540.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42799.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = +1

Query  121  TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  300
            T S P  DPEL+V+EV+ KI N +++RRKLGF SCGTGNPIDDCWRC+ +WE+NR+RLAD
Sbjct  23   TSSLPVSDPELVVEEVHRKI-NESMSRRKLGFFSCGTGNPIDDCWRCEKDWENNRKRLAD  81

Query  301  CAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  477
            C IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF RDM I+LKE
Sbjct  82   CGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFKRDMTIQLKE  141

Query  478  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  142  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  183



>ref|XP_009150377.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=413

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP  DPELIV+EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR+RLADC
Sbjct  27   LSSPVSDPELIVEEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKRLADC  85

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
             IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF+RDM I+LKEE
Sbjct  86   GIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFSRDMTIQLKEE  145

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  146  LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  186



>gb|EYU22243.1| hypothetical protein MIMGU_mgv1a007460mg [Erythranthe guttata]
Length=406

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 4/161 (2%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FS    DPEL+V EV+ K+  +   RR+LGFLSC TGNPIDDCWRCDPNWE NRQ+LADC
Sbjct  24   FSPTLNDPELVVHEVHRKLNES---RRRLGFLSCNTGNPIDDCWRCDPNWEKNRQKLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK A+GGRDGK+YVVT++G DD VNPKPGTLR+G IQ+EPLWIIFARDMVI+LKEE
Sbjct  81   AIGFGKNAVGGRDGKIYVVTESGNDDPVNPKPGTLRWGVIQEEPLWIIFARDMVIQLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG+++HD
Sbjct  141  LIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGIHVHD  181



>dbj|BAB10560.1| pectate lyase [Arabidopsis thaliana]
Length=410

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S P  DPEL+V+EV+ KI N +I+RRKLGF SCG+GNPIDDCWRCD +WE NR+RLADC 
Sbjct  25   SLPVSDPELVVEEVHRKI-NESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLADCG  83

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD G DD VNP+PGTLRY  IQDEPLWIIF RDM I+LKEEL
Sbjct  84   IGFGKNAIGGRDGEIYVVTDPGNDDPVNPRPGTLRYAVIQDEPLWIIFKRDMTIQLKEEL  143

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  144  IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  183



>ref|NP_568967.1| putative pectate lyase 22 [Arabidopsis thaliana]
 sp|Q93Z25.1|PLY22_ARATH RecName: Full=Probable pectate lyase 22; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL25610.1| AT5g63180/MDC12_15 [Arabidopsis thaliana]
 gb|AED97715.1| putative pectate lyase 22 [Arabidopsis thaliana]
Length=432

 Score =   269 bits (688),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S P  DPEL+V+EV+ KI N +I+RRKLGF SCG+GNPIDDCWRCD +WE NR+RLADC 
Sbjct  47   SLPVSDPELVVEEVHRKI-NESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLADCG  105

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD G DD VNP+PGTLRY  IQDEPLWIIF RDM I+LKEEL
Sbjct  106  IGFGKNAIGGRDGEIYVVTDPGNDDPVNPRPGTLRYAVIQDEPLWIIFKRDMTIQLKEEL  165

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  166  IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  205



>gb|AAY85180.1| pectate lyase [Gossypium hirsutum]
Length=411

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 140/155 (90%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQ+V+  I     ++R LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35   DPELVVQDVHRAI---NASKRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQ EPLWIIFARDM I+LKEELIMNSF
Sbjct  92   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQGEPLWIIFARDMTIQLKEELIMNSF  151

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHD
Sbjct  152  KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHD  186



>emb|CDY41506.1| BnaA06g22590D [Brassica napus]
Length=413

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP  DPELIV EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR+RLADC
Sbjct  27   LSSPVSDPELIVAEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKRLADC  85

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
             IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF+RDM I+LKEE
Sbjct  86   GIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFSRDMTIQLKEE  145

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  146  LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  186



>emb|CDY65626.1| BnaC03g74840D [Brassica napus]
Length=454

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            +   SSP  DPELIV EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR+RL
Sbjct  65   SLALSSPVSDPELIVDEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKRL  123

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF RDM I+L
Sbjct  124  ADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFNRDMTIQL  183

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEELIMNSFKT+DGRGASVHIAGGPCITIQYVTNIIIHGL+IHD
Sbjct  184  KEELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGLHIHD  227



>gb|ACK38190.1| unknown [Medicago truncatula]
Length=328

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SS   DPEL+VQ+V   I N + +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  16   PNFVSSSSVQDPELVVQDVQRSI-NVSRSRRNLGYLSCGTGNPIDDCWRCDPNWENNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+Y+VTD+GDD AVNPKPGTLRYGAIQDEPLWIIF RDMVI+
Sbjct  75   LADCAIGFGKDAIGGKNGKIYIVTDSGDDDAVNPKPGTLRYGAIQDEPLWIIFKRDMVIQ  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LK+EL++NS+KTIDGRGASVHIA G CITI YV N+IIHG+++HD
Sbjct  135  LKQELLVNSYKTIDGRGASVHIANGGCITIHYVNNVIIHGIHVHD  179



>ref|XP_010444198.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
 ref|XP_010444199.1| PREDICTED: probable pectate lyase 22 isoform X1 [Camelina sativa]
 ref|XP_010444200.1| PREDICTED: probable pectate lyase 22 isoform X2 [Camelina sativa]
Length=413

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T   S P  DPEL+V+EV+ KI N  ++RRKLGF SCGTGNPIDDCWRCD +WE NR+RL
Sbjct  24   TLASSLPVSDPELVVEEVHRKI-NELMSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRL  82

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+L
Sbjct  83   ADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQL  142

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KEELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  143  KEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  186



>ref|XP_003618787.1| Pectate lyase [Medicago truncatula]
 gb|AES75005.1| pectate lyase family protein [Medicago truncatula]
 gb|AFK34950.1| unknown [Medicago truncatula]
Length=404

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SS   DPEL+VQ+V   I N + +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  16   PNFVSSSSVQDPELVVQDVQRSI-NVSRSRRNLGYLSCGTGNPIDDCWRCDPNWENNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+Y+VTD+GDD AVNPKPGTLRYGAIQDEPLWIIF RDMVI+
Sbjct  75   LADCAIGFGKDAIGGKNGKIYIVTDSGDDDAVNPKPGTLRYGAIQDEPLWIIFKRDMVIQ  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LK+EL++NS+KTIDGRGASVHIA G CITI YV N+IIHG+++HD
Sbjct  135  LKQELLVNSYKTIDGRGASVHIANGGCITIHYVNNVIIHGIHVHD  179



>gb|KJB30978.1| hypothetical protein B456_005G174600 [Gossypium raimondii]
Length=287

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T   SSP  DPE +VQ+VNE I NAT+ARR LGFLSCGTGNPIDDCWRCD +WE NRQ+L
Sbjct  18   TFVLSSPVQDPEQVVQQVNESIRNATMARRSLGFLSCGTGNPIDDCWRCDHHWEKNRQKL  77

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLRY  IQDEPLWIIFARDM IKL
Sbjct  78   ADCAIGFGKHAIGGRDGKIYVVTDPSDHDPVNPKPGTLRYAVIQDEPLWIIFARDMTIKL  137

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KEEL+MNSFKTIDGRG SVHI+GGPCIT+QYVT
Sbjct  138  KEELLMNSFKTIDGRGVSVHISGGPCITVQYVT  170



>ref|XP_010484044.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=413

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S P  DPEL+V+EV+ K+ N +++RRKLGF SCGTGNPIDDCWRCD +WE NR+RLADC 
Sbjct  28   SLPVSDPELVVEEVHRKV-NESMSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRLADCG  86

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK A+GGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+LKEEL
Sbjct  87   IGFGKNAVGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQLKEEL  146

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  147  IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  186



>ref|XP_009137472.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP PDPE IV+EV++ I  +  ARRKL +LSC TGNPIDDCWR  P+WES+R RLADC
Sbjct  21   FSSPVPDPEAIVEEVHKSINASVAARRKLDYLSCTTGNPIDDCWRRPPHWESHRHRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIRLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHD
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHD  181



>gb|KJB08081.1| hypothetical protein B456_001G062400 [Gossypium raimondii]
Length=401

 Score =   266 bits (680),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  DPEL+VQ+++  I    ++RR L +LSC TGNPIDDCWRCDPNWE NR+RLADCA
Sbjct  20   SSPVKDPELVVQDLHRAI---NVSRRNLKYLSCATGNPIDDCWRCDPNWEKNRRRLADCA  76

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDGKLYVVTD+ DD  VNPKPGTLR+  IQDEPLWI+FARDM I+LKEEL
Sbjct  77   IGFGKNAIGGRDGKLYVVTDSSDDDPVNPKPGTLRHAVIQDEPLWIVFARDMTIQLKEEL  136

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGASVHI GGPCITIQ+VTNIIIHGL+IHD
Sbjct  137  IMNSFKTIDGRGASVHITGGPCITIQFVTNIIIHGLHIHD  176



>gb|AGC94753.1| putative pectate lyase [Euphorbia lathyris]
Length=404

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 139/160 (87%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  +PEL+ ++V++ I      RRKLGFLSCG+GNPIDDCWRCDPNWE NRQRLADCA
Sbjct  23   SSPVQNPELVAEQVHKSI---NTTRRKLGFLSCGSGNPIDDCWRCDPNWEKNRQRLADCA  79

Query  307  IGFGKQAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDGK+YVVTD+  DD V PKPGTLR+  IQ+EPLWIIF RDMVI LKEEL
Sbjct  80   IGFGKHAIGGRDGKIYVVTDSQNDDPVTPKPGTLRHAVIQEEPLWIIFERDMVITLKEEL  139

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHD
Sbjct  140  IMNSFKTIDGRGASVHIAEGPCITIQYVTNVIIHGINIHD  179



>ref|XP_007151585.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
 gb|ESW23579.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
Length=403

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 142/165 (86%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SS  PDPE++VQEV   I     +RR LG+LSCGTGNPIDDCWRC PNWE+NRQR
Sbjct  17   PSFVSSSTLPDPEMVVQEVQRSI---NASRRNLGYLSCGTGNPIDDCWRCHPNWENNRQR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGR+G++Y VTD+GDD AVNPKPGTLRY AIQDEPLWIIF RDMVI 
Sbjct  74   LADCAIGFGKDAIGGRNGRIYEVTDSGDDDAVNPKPGTLRYAAIQDEPLWIIFKRDMVIT  133

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LK+EL++NSFKTIDGRGASVHIAGG CITI YV+N+I+HG++IHD
Sbjct  134  LKQELLVNSFKTIDGRGASVHIAGGGCITIHYVSNVIVHGIHIHD  178



>ref|XP_009628975.1| PREDICTED: probable pectate lyase 18 [Nicotiana tomentosiformis]
Length=407

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +1

Query  133  PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            P  +P+ +V EV+  +     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  27   PLSNPQAVVDEVHRSV---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIG  83

Query  313  FGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FGK AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQ EPLWIIFARDMVI+LKEELIM
Sbjct  84   FGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQTEPLWIIFARDMVIQLKEELIM  143

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+++HD
Sbjct  144  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHVHD  181



>gb|KJB30977.1| hypothetical protein B456_005G174600 [Gossypium raimondii]
Length=355

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T   SSP  DPE +VQ+VNE I NAT+ARR LGFLSCGTGNPIDDCWRCD +WE NRQ+L
Sbjct  18   TFVLSSPVQDPEQVVQQVNESIRNATMARRSLGFLSCGTGNPIDDCWRCDHHWEKNRQKL  77

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLRY  IQDEPLWIIFARDM IKL
Sbjct  78   ADCAIGFGKHAIGGRDGKIYVVTDPSDHDPVNPKPGTLRYAVIQDEPLWIIFARDMTIKL  137

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KEEL+MNSFKTIDGRG SVHI+GGPCIT+QYVT
Sbjct  138  KEELLMNSFKTIDGRGVSVHISGGPCITVQYVT  170



>ref|XP_009406385.1| PREDICTED: probable pectate lyase 18 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S+   DPEL+VQEV   +    ++RR+LG+LSCGTGNPIDDCWRCDP+W  NRQRLADCA
Sbjct  26   SAAVRDPELVVQEVQRSL---NVSRRRLGYLSCGTGNPIDDCWRCDPDWADNRQRLADCA  82

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD+GDD  VNPKPGTLRY  IQ+EPLWIIF RDMVI+LKEEL
Sbjct  83   IGFGKNAIGGRDGEIYVVTDSGDDDPVNPKPGTLRYAVIQEEPLWIIFKRDMVIQLKEEL  142

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHD
Sbjct  143  IMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHD  182



>gb|KDO82122.1| hypothetical protein CISIN_1g015702mg [Citrus sinensis]
Length=283

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 136/155 (88%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SSP  DPEL+V+EV++ I     +RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15   APTFISSSPVQDPELVVEEVHKSI---NASRRNLGFLSCGTGNPIDDCWRCDPKWEENRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72   QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
             LKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVT
Sbjct  132  TLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVT  166



>ref|XP_010322529.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 18 [Solanum 
lycopersicum]
Length=405

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  + + +V +V+  I    ++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLA+CA
Sbjct  24   SSPLQNHQYVVDQVDRSI---NVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLANCA  80

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDGK+YVVT++G DD VNPKPGTLRYG IQDEPLWIIFA DMVI+LKEEL
Sbjct  81   IGFGKNAIGGRDGKIYVVTNSGNDDPVNPKPGTLRYGVIQDEPLWIIFASDMVIQLKEEL  140

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHD
Sbjct  141  IMNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGIHIHD  180



>gb|KHN05801.1| Putative pectate lyase 22 [Glycine soja]
Length=412

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 8/171 (5%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  285
            PT   SSP  +P+ +VQEVN KI N +IAR  R LG+LSCG+GNPIDDCWRCDPNWE NR
Sbjct  18   PTLISSSPVLNPQEVVQEVNRKI-NGSIARPRRNLGYLSCGSGNPIDDCWRCDPNWEQNR  76

Query  286  QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-----AVNPKPGTLRYGAIQDEPLWIIFA  450
            QRLADCAIGFGK AIGGRDGK+YVV   GDD     AVNPKPGTLR+  IQDEPLWIIFA
Sbjct  77   QRLADCAIGFGKNAIGGRDGKIYVVDGDGDDDGDDDAVNPKPGTLRHAVIQDEPLWIIFA  136

Query  451  RDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            RDMVI+LKEEL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHD
Sbjct  137  RDMVIQLKEELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHD  187



>ref|XP_010682362.1| PREDICTED: probable pectate lyase 5 [Beta vulgaris subsp. vulgaris]
Length=404

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 3/166 (2%)
 Frame = +1

Query  109  APT-CTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  285
            APT    SSP  DPEL+V EV EKI NAT  RR LG+LSCGTGNPIDDCWRCD  W  NR
Sbjct  16   APTFINSSSPVQDPELVVHEVQEKIRNAT--RRNLGYLSCGTGNPIDDCWRCDHKWLKNR  73

Query  286  QRLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            QRLADC IGFGK AIGG++GK+YVVT+ GDD VNPKPGTLR+G IQD+PLWIIF  DMVI
Sbjct  74   QRLADCGIGFGKGAIGGKNGKMYVVTNKGDDPVNPKPGTLRWGVIQDKPLWIIFDGDMVI  133

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KLK+EL++NSFKTIDGRGA++HIAGGPCITIQYVTN+IIHG++IHD
Sbjct  134  KLKQELMVNSFKTIDGRGANIHIAGGPCITIQYVTNVIIHGIHIHD  179



>gb|KDO82121.1| hypothetical protein CISIN_1g015702mg [Citrus sinensis]
Length=335

 Score =   261 bits (667),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 136/155 (88%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SSP  DPEL+V+EV++ I     +RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15   APTFISSSPVQDPELVVEEVHKSI---NASRRNLGFLSCGTGNPIDDCWRCDPKWEENRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72   QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
             LKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVT
Sbjct  132  TLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVT  166



>gb|KJB30976.1| hypothetical protein B456_005G174600 [Gossypium raimondii]
Length=406

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  115  TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  294
            T   SSP  DPE +VQ+VNE I NAT+ARR LGFLSCGTGNPIDDCWRCD +WE NRQ+L
Sbjct  18   TFVLSSPVQDPEQVVQQVNESIRNATMARRSLGFLSCGTGNPIDDCWRCDHHWEKNRQKL  77

Query  295  ADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            ADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLRY  IQDEPLWIIFARDM IKL
Sbjct  78   ADCAIGFGKHAIGGRDGKIYVVTDPSDHDPVNPKPGTLRYAVIQDEPLWIIFARDMTIKL  137

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KEEL+MNSFKTIDGRG SVHI+GGPCIT+QYVT
Sbjct  138  KEELLMNSFKTIDGRGVSVHISGGPCITVQYVT  170



>gb|AAF19195.1|AF206319_1 pectate lyase 1 [Musa acuminata AAA Group]
Length=407

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S+   DPEL+VQEV   +    ++RR+LG+LSCGTGNPIDDCWRCDP+W  NRQRLADCA
Sbjct  26   SAAVRDPELVVQEVQRSL---NVSRRRLGYLSCGTGNPIDDCWRCDPDWADNRQRLADCA  82

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD+GDD  VNPK GTLRY  IQ+EPLWIIF RDMVI+LKEEL
Sbjct  83   IGFGKNAIGGRDGEIYVVTDSGDDDPVNPKTGTLRYAVIQEEPLWIIFKRDMVIQLKEEL  142

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHD
Sbjct  143  IMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHD  182



>emb|CAA63496.1| pectate lyase [Musa acuminata AAA Group]
Length=398

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S+   DPEL+VQEV   +    ++RR+LG+LSCGTGNPIDDCWRCDP+W  NRQRLADCA
Sbjct  16   SAAVRDPELVVQEVQRSL---NVSRRRLGYLSCGTGNPIDDCWRCDPDWADNRQRLADCA  72

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDG++YVVTD+GDD  VNPKPGTLRY  IQ+EPLWIIF RD+VI+LKEEL
Sbjct  73   IGFGKNAIGGRDGEIYVVTDSGDDDPVNPKPGTLRYAVIQEEPLWIIFKRDIVIQLKEEL  132

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHD
Sbjct  133  IMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHD  172



>gb|KDP30994.1| hypothetical protein JCGZ_11370 [Jatropha curcas]
Length=411

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +1

Query  133  PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            P  D EL+VQ+V+  I ++   RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  32   PVQDQELVVQQVHRAINDS---RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIG  88

Query  313  FGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FGK AIGGR+G++YVVTD G DD V PKPGTLR+  IQDEPLWIIFARDM I+LKEELIM
Sbjct  89   FGKNAIGGRNGRIYVVTDPGNDDPVTPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIM  148

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKT+DGRGASVHIAGGPCITIQ+VTNIIIHGL+IHD
Sbjct  149  NSFKTLDGRGASVHIAGGPCITIQFVTNIIIHGLHIHD  186



>ref|XP_006347419.1| PREDICTED: probable pectate lyase 18-like [Solanum tuberosum]
Length=405

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = +1

Query  133  PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            P  + + +V +V+  I    ++RR LG+LSC TGNPIDDCWRCDPNWE NRQRLA+CAIG
Sbjct  26   PLQNHQYVVDQVHRSI---NVSRRNLGYLSCETGNPIDDCWRCDPNWEKNRQRLANCAIG  82

Query  313  FGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FGK A+GGRDGK+YVVT++G DD VNPKPGTLRYG IQDEPLWIIFARDMVI+LKEELIM
Sbjct  83   FGKNAVGGRDGKIYVVTNSGNDDPVNPKPGTLRYGVIQDEPLWIIFARDMVIQLKEELIM  142

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGA+VHIAGGPCITIQYVTN+IIHG++IHD
Sbjct  143  NSFKTIDGRGATVHIAGGPCITIQYVTNVIIHGIHIHD  180



>ref|XP_004489554.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=405

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SS   DPEL+VQ+V   I NA+  RR LG+LSCGTGNPIDDCWRCD NWE+NRQRLADCA
Sbjct  23   SSAVQDPELVVQDVQRSINNAS--RRNLGYLSCGTGNPIDDCWRCDTNWENNRQRLADCA  80

Query  307  IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGG++GK+Y+VTD+ DD  VNPKPGTLRYG+IQDEPLWIIF RDMVI LK+EL
Sbjct  81   IGFGKDAIGGKNGKIYIVTDSSDDDPVNPKPGTLRYGSIQDEPLWIIFKRDMVITLKQEL  140

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            ++NSFKTIDGRGASVHIA G CITI YV+NIIIHG+N+HD
Sbjct  141  LVNSFKTIDGRGASVHIANGGCITIHYVSNIIIHGINVHD  180



>emb|CDY28857.1| BnaC06g26450D [Brassica napus]
Length=407

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 135/155 (87%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT T SS   DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  20   APTFTASSHVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  76

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDG++YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  77   RLADCAIGFGKHAIGGRDGRIYVVTDSSDNDAVNPKPGTLRHAVIQDEPLWIIFARDMVI  136

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KLKEEL+MNSFKTIDGRGASVHIAGG CIT+QYVT
Sbjct  137  KLKEELMMNSFKTIDGRGASVHIAGGACITVQYVT  171



>ref|XP_003526981.1| PREDICTED: probable pectate lyase 18-like [Glycine max]
Length=408

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 147/167 (88%), Gaps = 4/167 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  285
            P+   SSP  +PE +VQEVN KI N +IAR  R LG+L CG+GNPIDDCWRCDPNWE NR
Sbjct  18   PSFISSSPVRNPEEVVQEVNRKI-NGSIARPRRNLGYLWCGSGNPIDDCWRCDPNWEQNR  76

Query  286  QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  462
            QRLADCAIGFGK AIGGRDGK+YVV D GDD AVNPKPG+LR+  IQDEPLWIIFARDMV
Sbjct  77   QRLADCAIGFGKNAIGGRDGKIYVVDDDGDDDAVNPKPGSLRHAVIQDEPLWIIFARDMV  136

Query  463  IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            I+LKEEL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHD
Sbjct  137  IQLKEELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHD  183



>emb|CDP15081.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            +SP  DPEL+ QEV   IANAT ARRKLG+LSCGTGNPIDDCWRC P+WE NRQRLADC 
Sbjct  24   ASPVRDPELVAQEVQRSIANATRARRKLGYLSCGTGNPIDDCWRCQPDWEQNRQRLADCG  83

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK A+GGRDG++YVVTD+G DD V PKPGTLRY  IQ+EPLWIIFARDMVI+LKEEL
Sbjct  84   IGFGKNAVGGRDGRIYVVTDSGDDDPVTPKPGTLRYAVIQEEPLWIIFARDMVIQLKEEL  143

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            IMNSFKTIDGRGASVHIAGGPCITIQYVT
Sbjct  144  IMNSFKTIDGRGASVHIAGGPCITIQYVT  172



>emb|CDY48132.1| BnaCnng15740D [Brassica napus]
Length=428

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             S P  DPEL+V+EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR++LADC
Sbjct  42   LSLPVSDPELVVEEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKQLADC  100

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
             IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQD+PLWIIF RDM I+LKEE
Sbjct  101  GIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDQPLWIIFNRDMTIQLKEE  160

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  161  LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  201



>dbj|BAF43572.1| pectate lyase [Prunus persica]
Length=413

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 141/166 (85%), Gaps = 3/166 (2%)
 Frame = +1

Query  112  PTCTFSSPYP-DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            PT   S P   +PEL+VQ+V   I N +++RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  24   PTLIASRPLQQNPELVVQDVQRSI-NDSVSRRNLGYLSCGTGNPIDDCWRCDPNWEQNRQ  82

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD+GD D VNPKPGTLR+  IQDEPLWIIF RDM I
Sbjct  83   RLADCAIGFGKNAIGGRDGKIYVVTDSGDNDPVNPKPGTLRHAVIQDEPLWIIFQRDMTI  142

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +LKEELIMNSFKTIDGRGASVHIAGGPC    +VTNIIIHGL+IHD
Sbjct  143  QLKEELIMNSFKTIDGRGASVHIAGGPCNHRPFVTNIIIHGLHIHD  188



>gb|KFK29019.1| hypothetical protein AALP_AA7G078200 [Arabis alpina]
Length=407

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  22   FSSPVPDPESIVEEVHKSINASVAGRRKLGYLSCATGNPIDDCWRCDPHWETNRQRLADC  81

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            +IGFGK AIGGRDG++YVVTD+G DD V+PKPGTLR+  +QDEPLWIIF RDM IKLKEE
Sbjct  82   SIGFGKNAIGGRDGRIYVVTDSGNDDPVSPKPGTLRHAVVQDEPLWIIFQRDMTIKLKEE  141

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  142  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  172



>gb|AFD54065.1| nodulation pectate lyase mutant [Lotus japonicus]
Length=342

 Score =   259 bits (662),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
             PT  FSSP  DPE +VQEV + I      RRKLGF SCGTGNPIDDCWRCDPNWE+NR+
Sbjct  13   TPTLIFSSPVQDPESVVQEVQKSIIEH---RRKLGFYSCGTGNPIDDCWRCDPNWENNRK  69

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            RLA+CAIGFG+ AIGGRDGK Y+VTD  D AVNPKPGTLR+ AIQ EPLWIIF  DMVIK
Sbjct  70   RLAECAIGFGRHAIGGRDGKFYLVTDPSDHAVNPKPGTLRHAAIQQEPLWIIFKHDMVIK  129

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            L+ +L+MNS+KTIDGRGA+VHIAGGPCI +Q  TNIIIHG++IHD
Sbjct  130  LEMDLVMNSYKTIDGRGANVHIAGGPCIKVQRKTNIIIHGISIHD  174



>ref|XP_006484000.1| PREDICTED: probable pectate lyase 5-like [Citrus sinensis]
Length=402

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 136/155 (88%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SSP  DPEL+V+EV++ I     +RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15   APTFISSSPVQDPELVVEEVHKSI---NASRRNLGFLSCGTGNPIDDCWRCDPKWEENRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72   QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT
Sbjct  132  TLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  166



>gb|KDO82120.1| hypothetical protein CISIN_1g015702mg [Citrus sinensis]
Length=402

 Score =   260 bits (665),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 136/155 (88%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SSP  DPEL+V+EV++ I     +RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15   APTFISSSPVQDPELVVEEVHKSI---NASRRNLGFLSCGTGNPIDDCWRCDPKWEENRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72   QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
             LKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVT
Sbjct  132  TLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVT  166



>ref|XP_009112069.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=428

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             S P  DPEL+V+EV+ +I N +I+RR LG+ SC TGNPIDDCWRCD +WE NR++LADC
Sbjct  42   LSLPVSDPELVVEEVHRQI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKQLADC  100

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
             IGFGK AIGGRDG+ YVVTD G DD VNPKPGTLRY  IQD+PLWIIF RDM I+LKEE
Sbjct  101  GIGFGKNAIGGRDGEFYVVTDPGNDDPVNPKPGTLRYAVIQDQPLWIIFIRDMTIQLKEE  160

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  161  LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  201



>emb|CDY16732.1| BnaA09g06500D [Brassica napus]
Length=428

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             S P  DPEL+V+EV+ +I N +I+RR LG+ SC TGNPIDDCWRCD +WE NR++LADC
Sbjct  42   LSLPVSDPELVVEEVHRQI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKQLADC  100

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
             IGFGK AIGGRDG+ YVVTD G DD VNPKPGTLRY  IQD+PLWIIF RDM I+LKEE
Sbjct  101  GIGFGKNAIGGRDGEFYVVTDPGNDDPVNPKPGTLRYAVIQDQPLWIIFNRDMTIQLKEE  160

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHD
Sbjct  161  LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHD  201



>ref|XP_010695977.1| PREDICTED: probable pectate lyase 18 [Beta vulgaris subsp. vulgaris]
Length=406

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 137/157 (87%), Gaps = 4/157 (3%)
 Frame = +1

Query  109  APTCTFSSPY--PDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESN  282
            AP+   SSP    DPEL+V EV+  I N +IARR LG+LSCGTGNPIDDCWRCDPNW  N
Sbjct  15   APSFVLSSPTVASDPELVVHEVHRSI-NESIARRSLGYLSCGTGNPIDDCWRCDPNWHEN  73

Query  283  RQRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDM  459
            RQRLADCAIGFGK AIGG++G++YVVTD+GDD  VNPKPGTLRYG +QDEPLWIIF RDM
Sbjct  74   RQRLADCAIGFGKNAIGGKNGRIYVVTDSGDDDPVNPKPGTLRYGVVQDEPLWIIFQRDM  133

Query  460  VIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            VI+LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT
Sbjct  134  VIRLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  170



>gb|KDP26717.1| hypothetical protein JCGZ_17875 [Jatropha curcas]
Length=407

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 134/155 (86%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP    SSP  DPE +V+EV++ I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  20   APNYISSSPVQDPETVVEEVHKSI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQ  76

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDM I
Sbjct  77   RLADCAIGFGKHAIGGRDGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMTI  136

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KLKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVT
Sbjct  137  KLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVT  171



>emb|CDY34310.1| BnaA01g14130D [Brassica napus]
Length=406

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCD NWE NRQRLADC
Sbjct  21   FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCSTGNPIDDCWRCDSNWEKNRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  IQDEPLWIIF RDM I LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVIQDEPLWIIFQRDMTIHLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  171



>emb|CDY24847.1| BnaA08g14630D [Brassica napus]
Length=406

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  21   LSSPVPDPEAIVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWETNRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLRY  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRYAVVQDEPLWIIFQRDMTIQLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  171



>gb|AFD54064.1| nodulation pectate lyase mutant [Lotus japonicus]
Length=400

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 137/164 (84%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT  FSSP  DPE +VQEV + I      RRKLGF SCGTGNPIDDCWRCDPNWE+NR+R
Sbjct  14   PTLIFSSPVQDPESVVQEVQKSIIEH---RRKLGFYSCGTGNPIDDCWRCDPNWENNRKR  70

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LA+CAIGFG+ AIGGRDGK Y+VTD  D AVNPKPGTLR+ AIQ EPLWIIF  DMVIKL
Sbjct  71   LAECAIGFGRHAIGGRDGKFYLVTDPSDHAVNPKPGTLRHAAIQQEPLWIIFKHDMVIKL  130

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            + +L+MNS+KTIDGRGA+VHIAGGPCI +Q  TNIIIHG++IHD
Sbjct  131  EMDLVMNSYKTIDGRGANVHIAGGPCIKVQRKTNIIIHGISIHD  174



>ref|XP_006438176.1| hypothetical protein CICLE_v10031429mg [Citrus clementina]
 gb|ESR51416.1| hypothetical protein CICLE_v10031429mg [Citrus clementina]
Length=469

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 136/155 (88%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            APT   SSP  DPEL+V+EV++ I     +RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  82   APTFISSSPVQDPELVVEEVHKSI---NASRRSLGFLSCGTGNPIDDCWRCDPKWEENRQ  138

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  139  QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  198

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT
Sbjct  199  TLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  233



>gb|KEH35002.1| pectate lyase family protein [Medicago truncatula]
Length=287

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SS   +PEL+VQEVN KI NA+ ARR LG+LSCG+GNPIDDCWRCD NWE NRQR
Sbjct  18   PTLISSSLVQNPELVVQEVNRKI-NASSARRNLGYLSCGSGNPIDDCWRCDSNWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD  DD  V PKPGTLR+  IQ EPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKNAIGGKNGKIYVVTDASDDNPVTPKPGTLRHAVIQVEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  137  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  171



>gb|AEX93472.1| nodulation pectate lyase [Lotus japonicus]
 gb|AFD54063.1| nodulation pectate lyase [Lotus japonicus]
Length=400

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 137/164 (84%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT  FSSP  DPE +VQEV + I      RRKLGF SCGTGNPIDDCWRCDPNWE+NR+R
Sbjct  14   PTLIFSSPVQDPESVVQEVQKSIIEH---RRKLGFYSCGTGNPIDDCWRCDPNWENNRKR  70

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LA+CAIGFG+ AIGGRDGK Y+VTD  D AVNPKPGTLR+ AIQ EPLWIIF  DMVIKL
Sbjct  71   LAECAIGFGRHAIGGRDGKFYLVTDPSDHAVNPKPGTLRHAAIQQEPLWIIFKHDMVIKL  130

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            + +L+MNS+KTIDGRGA+VHIAGGPCI +Q  TNIIIHG++IHD
Sbjct  131  EMDLVMNSYKTIDGRGANVHIAGGPCIKVQRKTNIIIHGISIHD  174



>ref|XP_002515037.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF47591.1| Pectate lyase precursor, putative [Ricinus communis]
Length=404

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 134/149 (90%), Gaps = 4/149 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SSP  DPEL+V+EV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  23   SSPVQDPELVVEEVHRSI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  79

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQ+EPLWIIFARDMVIKLKEEL
Sbjct  80   IGFGKHAIGGRDGKIYVVTDSGNDDPVNPKPGTLRHAVIQEEPLWIIFARDMVIKLKEEL  139

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            IMNSFKTIDGRGASVHIAGGPCIT+QYVT
Sbjct  140  IMNSFKTIDGRGASVHIAGGPCITVQYVT  168



>ref|XP_006653139.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 8-like 
[Oryza brachyantha]
Length=483

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            A T T      DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W +NRQ
Sbjct  75   AATMTVPGAVDDPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHNNRQ  133

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADC IGFG+ AIGGRDGK+YVVTD GDD  VNPKPGTLRY  I+DEPLWIIF RDMVI
Sbjct  134  RLADCGIGFGRNAIGGRDGKIYVVTDPGDDDPVNPKPGTLRYAVIRDEPLWIIFKRDMVI  193

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
             LK+ELIMNSFKTIDGRGA+VHIA G C+TIQYVTNIIIHGL+IHD
Sbjct  194  TLKQELIMNSFKTIDGRGANVHIANGACLTIQYVTNIIIHGLHIHD  239



>ref|XP_009138507.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCD NWE NRQRLADC
Sbjct  21   FSSPVPDPEAIVEEVHKSINASGAARRKLGYLSCSTGNPIDDCWRCDSNWEKNRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  IQDEPLWIIF RDM I LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVIQDEPLWIIFQRDMTIHLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  171



>ref|XP_009109237.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  21   LSSPVPDPEAIVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWETNRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLRY  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRYAVVQDEPLWIIFQRDMTIQLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVH+AGGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHMAGGPCITIQYVTN  171



>ref|XP_002311747.2| pectate lyase 5 precursor family protein [Populus trichocarpa]
 gb|ABK94358.1| unknown [Populus trichocarpa]
 gb|EEE89114.2| pectate lyase 5 precursor family protein [Populus trichocarpa]
Length=402

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 134/155 (86%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP     SP  DPEL+V+EV+  I     +RRKLGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15   APNFISCSPVQDPELVVEEVHRSI---NASRRKLGFLSCGTGNPIDDCWRCDPKWEKNRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK+AIGGRDGK+YVVTD G DD VNPKPGTLRY  IQ+EPLWIIFARDMVI
Sbjct  72   RLADCAIGFGKRAIGGRDGKIYVVTDPGNDDPVNPKPGTLRYAVIQEEPLWIIFARDMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KLKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVT
Sbjct  132  KLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVT  166



>emb|CBI17713.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 138/160 (86%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            S+P  DPE++VQEV+  I     +RR LG+ SCGTGNPIDDCWRCD NW+ NRQRLADCA
Sbjct  22   SAPVQDPEVVVQEVHRSI---NASRRNLGYFSCGTGNPIDDCWRCDANWDKNRQRLADCA  78

Query  307  IGFGKQAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK A+GG++G++YVVTD+  DD VNP+PGTLR+  IQDEPLWIIF RDMVIKLK+EL
Sbjct  79   IGFGKDAMGGKNGRIYVVTDSEDDDPVNPRPGTLRHAVIQDEPLWIIFKRDMVIKLKQEL  138

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +MNSFKTIDGRGASVHIAGGPCITI Y +NIIIHGL+IHD
Sbjct  139  VMNSFKTIDGRGASVHIAGGPCITIHYASNIIIHGLHIHD  178



>ref|XP_006591479.1| PREDICTED: probable pectate lyase 5-like [Glycine max]
 gb|KHN44386.1| Putative pectate lyase 5 [Glycine soja]
Length=402

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 3/153 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+C  SSP  DPEL+V++V + I     +RR L FLSCGTGNPIDDCWRCDPNWE NR+R
Sbjct  17   PSCICSSPLQDPELVVEDVQKSI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRKR  73

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADC+IGFGK A+GGRDGK+YVVTD GD  VNPKPGTLRYG IQ+EPLWIIF RDMVIKL
Sbjct  74   LADCSIGFGKHAVGGRDGKIYVVTDPGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIKL  133

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            K+EL+MNSFKTIDGRGASVHIAGGPCITIQYVT
Sbjct  134  KQELMMNSFKTIDGRGASVHIAGGPCITIQYVT  166



>gb|KJB15669.1| hypothetical protein B456_002G189900 [Gossypium raimondii]
Length=406

 Score =   258 bits (659),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP+   +SP  DPE +V++VNE I NAT ARRKLGFLSCGTGNPIDDCWRCDPNW  NR+
Sbjct  16   APSIFSASPVQDPEQVVRQVNESIRNATAARRKLGFLSCGTGNPIDDCWRCDPNWAKNRK  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADC IGFGK+AIGGR+GK YVVTD  D D VNPKPGTLR+  IQD+PLWIIFARDMVI
Sbjct  76   RLADCGIGFGKRAIGGRNGKFYVVTDPSDRDPVNPKPGTLRHAVIQDKPLWIIFARDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KLK EL+MNSFKTIDGRG SVHIAGGPCITIQY T
Sbjct  136  KLKAELLMNSFKTIDGRGVSVHIAGGPCITIQYAT  170



>emb|CDY08948.1| BnaC08g11780D [Brassica napus]
Length=406

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  21   LSSPVPDPEAIVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWETNRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  171



>ref|XP_003551943.1| PREDICTED: probable pectate lyase 5-like [Glycine max]
 gb|KHN24116.1| Putative pectate lyase 5 [Glycine soja]
Length=405

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P C  SSP  DPEL+V++V + I     +RR L FLSCGTGNPIDDCWRCDPNWE NR+R
Sbjct  20   PCCICSSPLQDPELVVEDVQKSI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRKR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADC+IGFGK A+GGRDGKLYVVTD GD  VNPKPGTLRYG IQ+EPLWIIF RDMVIKL
Sbjct  77   LADCSIGFGKHAVGGRDGKLYVVTDPGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIKL  136

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            K+EL+MNSFKTIDGRG SVHIAGGPCITIQYVT
Sbjct  137  KQELMMNSFKTIDGRGVSVHIAGGPCITIQYVT  169



>ref|XP_002300069.1| pectate lyase family protein [Populus trichocarpa]
 gb|EEE84874.1| pectate lyase family protein [Populus trichocarpa]
Length=403

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP   FSS   DPEL+VQEV+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  16   APHFVFSSSIQDPELVVQEVHRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWERNRQ  72

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGR+G++YVVTD+G DDAVNPKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  73   RLADCAIGFGKNAIGGRNGRIYVVTDSGNDDAVNPKPGTLRHAVIQDEPLWIIFKRDMVI  132

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            +L++EL+MNS+KTIDGRGASVHIAGGPCITI Y TN
Sbjct  133  QLRQELVMNSYKTIDGRGASVHIAGGPCITIHYATN  168



>ref|XP_010511733.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   255 bits (652),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 132/154 (86%), Gaps = 4/154 (3%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   S+P  DP+ +VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22   PTFIASTPVSDPDFVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79   LADCAIGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            LKEELIMNSFKTIDGRG +VHIAGG CIT+QYVT
Sbjct  139  LKEELIMNSFKTIDGRGVNVHIAGGACITVQYVT  172



>ref|XP_010415362.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   255 bits (652),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 132/154 (86%), Gaps = 4/154 (3%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   S+P   P+L+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22   PTFIASTPVSHPDLVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79   LADCAIGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            LKEELIMNSFKTIDGRG +VHIAGG CIT+QYVT
Sbjct  139  LKEELIMNSFKTIDGRGVNVHIAGGACITVQYVT  172



>gb|EEE60442.1| hypothetical protein OsJ_13660 [Oryza sativa Japonica Group]
Length=443

 Score =   256 bits (655),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLADC IGFG+
Sbjct  65   DPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGFGR  123

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+ELIMNSF
Sbjct  124  NAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQELIMNSF  183

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  184  KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHD  218



>gb|AAG28907.1|AC008113_23 F12A21.12 [Arabidopsis thaliana]
Length=392

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 126/137 (92%), Gaps = 1/137 (1%)
 Frame = +1

Query  196  ARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGKQAIGGRDGKLYVVTDTGD  375
            +RR LG LSCGTGNPIDDCWRCDP WE NRQRLADCAIGFGK AIGGRDGK+YVVTD+ D
Sbjct  31   SRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSSD  90

Query  376  -DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCI  552
             D VNPKPGTLR+  IQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGG CI
Sbjct  91   KDVVNPKPGTLRHAVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGACI  150

Query  553  TIQYVTNIIIHGLNIHD  603
            T+QYVTNIIIHG+NIHD
Sbjct  151  TVQYVTNIIIHGVNIHD  167



>ref|XP_010239620.1| PREDICTED: probable pectate lyase 8 isoform X2 [Brachypodium 
distachyon]
Length=424

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGFG+
Sbjct  46   DPETVASQVHMSIKNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFGR  104

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGKLYVVTD GDD  VNPK GTLRY  IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  105  NAIGGRDGKLYVVTDAGDDDPVNPKEGTLRYAVIQDEPLWIIFKRDMVITLKQELIMNSF  164

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  165  KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHD  199



>ref|XP_011072008.1| PREDICTED: probable pectate lyase 18 [Sesamum indicum]
Length=405

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  127  SSP-YPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            SSP   DPEL+VQEV+ K+     +RRKLGFLSC TGNPIDDCWRCDPNWE NRQ+LADC
Sbjct  23   SSPTLQDPELVVQEVHSKL---NASRRKLGFLSCNTGNPIDDCWRCDPNWEQNRQKLADC  79

Query  304  AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK A+GGRDGK+YVVTD+GDD  VNPKPGTLRY  IQ+EPLWIIFARDMVI+LKEE
Sbjct  80   AIGFGKNAVGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQEEPLWIIFARDMVIQLKEE  139

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHIA GPCITIQYVTN
Sbjct  140  LIMNSFKTIDGRGASVHIANGPCITIQYVTN  170



>emb|CAE02420.2| OSJNBa0095E20.8 [Oryza sativa Japonica Group]
 emb|CAH65848.1| OSIGBa0147B06.7 [Oryza sativa Indica Group]
Length=472

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLADC IGFG+
Sbjct  94   DPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGFGR  152

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+ELIMNSF
Sbjct  153  NAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQELIMNSF  212

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  213  KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHD  247



>ref|XP_003638513.1| Pectate lyase [Medicago truncatula]
 gb|KEH35001.1| pectate lyase family protein [Medicago truncatula]
Length=406

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   SS   +PEL+VQEVN KI NA+ ARR LG+LSCG+GNPIDDCWRCD NWE NRQR
Sbjct  18   PTLISSSLVQNPELVVQEVNRKI-NASSARRNLGYLSCGSGNPIDDCWRCDSNWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGG++GK+YVVTD  DD  V PKPGTLR+  IQ EPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKNAIGGKNGKIYVVTDASDDNPVTPKPGTLRHAVIQVEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  137  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  171



>gb|EEC76710.1| hypothetical protein OsI_14719 [Oryza sativa Indica Group]
Length=473

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLADC IGFG+
Sbjct  95   DPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGFGR  153

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+ELIMNSF
Sbjct  154  NAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQELIMNSF  213

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  214  KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHD  248



>ref|XP_010239619.1| PREDICTED: probable pectate lyase 8 isoform X1 [Brachypodium 
distachyon]
Length=450

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGFG+
Sbjct  72   DPETVASQVHMSIKNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFGR  130

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGKLYVVTD GDD  VNPK GTLRY  IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  131  NAIGGRDGKLYVVTDAGDDDPVNPKEGTLRYAVIQDEPLWIIFKRDMVITLKQELIMNSF  190

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  191  KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHD  225



>ref|XP_010470701.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 132/154 (86%), Gaps = 4/154 (3%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   S+P   P+L+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22   PTFIASTPVSHPDLVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79   LADCAIGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            LKEEL+MNSFKTIDGRG +VHIAGG CIT+QYVT
Sbjct  139  LKEELLMNSFKTIDGRGVNVHIAGGACITVQYVT  172



>ref|XP_010433725.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
 ref|XP_010438969.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
Length=408

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  23   LSSPVPDPESVVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  82

Query  304  AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+GDD  V PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  83   AIGFGKNAIGGRDGRIYVVTDSGDDNPVTPKPGTLRHAVIQDEPLWIIFQRDMTIRLKEE  142

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRG SVHI+GGPCITIQYVTN
Sbjct  143  LIMNSFKTIDGRGVSVHISGGPCITIQYVTN  173



>ref|NP_001268051.1| pectate lyase precursor [Vitis vinifera]
 gb|AAF63756.1|AF243475_1 pectate lyase [Vitis vinifera]
Length=398

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 137/159 (86%), Gaps = 4/159 (3%)
 Frame = +1

Query  130  SPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAI  309
            +P  DPE++VQEV+  I     +RR LG+ SCGTGNPIDDCWRCD NW+ NRQRLADCAI
Sbjct  18   APVQDPEVVVQEVHRSI---NASRRNLGYFSCGTGNPIDDCWRCDANWDKNRQRLADCAI  74

Query  310  GFGKQAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELI  486
            GFGK A+GG++G++YVVTD+  DD VNP+PGTLR+  IQDEPLWIIF RDMVIKLK+EL+
Sbjct  75   GFGKDAMGGKNGRIYVVTDSEDDDPVNPRPGTLRHAVIQDEPLWIIFKRDMVIKLKQELV  134

Query  487  MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            MNSFKTIDGRGASVHIAGGPCITI Y +NIIIHGL+IHD
Sbjct  135  MNSFKTIDGRGASVHIAGGPCITIHYASNIIIHGLHIHD  173



>ref|NP_001052103.1| Os04g0137100 [Oryza sativa Japonica Group]
 dbj|BAF14017.1| Os04g0137100 [Oryza sativa Japonica Group]
Length=492

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLADC IGFG+
Sbjct  95   DPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGFGR  153

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+ELIMNSF
Sbjct  154  NAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQELIMNSF  213

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  214  KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHD  248



>ref|XP_002526952.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF35439.1| Pectate lyase precursor, putative [Ricinus communis]
Length=396

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 133/164 (81%), Gaps = 11/164 (7%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP PDPEL+VQ+V+  I     +RR L +LSCGTGNPIDDCWRCDPNWE+NR+R
Sbjct  19   PHLVLSSPLPDPELVVQDVHRSI---NASRRNLAYLSCGTGNPIDDCWRCDPNWETNRKR  75

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGR+G+ YVVT         KPGTLR+  IQDEPLWIIF RDMVI+L
Sbjct  76   LADCAIGFGKDAIGGRNGRFYVVT--------XKPGTLRHAVIQDEPLWIIFKRDMVIQL  127

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            K+EL+MNSFKTIDGRGASVHIA GPCITI Y TNIIIHGLNIHD
Sbjct  128  KQELVMNSFKTIDGRGASVHIANGPCITIHYATNIIIHGLNIHD  171



>ref|XP_006283843.1| hypothetical protein CARUB_v10004942mg [Capsella rubella]
 gb|EOA16741.1| hypothetical protein CARUB_v10004942mg [Capsella rubella]
Length=409

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  24   LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  83

Query  304  AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+GDD  V+PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  84   AIGFGKNAIGGRDGRIYVVTDSGDDNPVSPKPGTLRHAVIQDEPLWIIFQRDMTIRLKEE  143

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHI+GGPCITIQYVTN
Sbjct  144  LIMNSFKTIDGRGASVHISGGPCITIQYVTN  174



>ref|XP_002518146.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF44279.1| Pectate lyase precursor, putative [Ricinus communis]
Length=376

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V  V   I N+T  RRKLG+ SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  73   DPEEVVAMVEMSIRNST-ERRKLGYFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGR  131

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  132  NAIGGRDGRFYVVTDAGDDDPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  191

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ+VTN+IIHGL+IHD
Sbjct  192  KTIDGRGANVHIANGACITIQFVTNVIIHGLHIHD  226



>ref|XP_010448519.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
Length=406

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21   LSSPVPDPESVVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+GDD  V PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGDDNPVTPKPGTLRHAVIQDEPLWIIFQRDMTIRLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRG SVHI+GGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGVSVHISGGPCITIQYVTN  171



>ref|XP_010929962.1| PREDICTED: probable pectate lyase 5 [Elaeis guineensis]
Length=409

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 4/154 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            +PT   S+   DPEL+V+EV+  + N+   RR+LG+LSCGTGNPIDDCWRCD NWESNRQ
Sbjct  22   SPTPKPSAAVQDPELVVREVHRSLNNS---RRRLGYLSCGTGNPIDDCWRCDQNWESNRQ  78

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIF RDMVI
Sbjct  79   RLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFQRDMVI  138

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYV  567
            KLKEELIMNS+KT+DGRGASVHIAGGPCITIQYV
Sbjct  139  KLKEELIMNSYKTLDGRGASVHIAGGPCITIQYV  172



>dbj|BAK06362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGFG+
Sbjct  88   DPETVVSQVHMSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFGR  146

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD GDD  VNPK GTLRY  IQDEPLWIIF RDMVI L +ELIMNSF
Sbjct  147  NAIGGRDGKIYVVTDAGDDDPVNPKKGTLRYAVIQDEPLWIIFKRDMVITLSQELIMNSF  206

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  207  KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHD  241



>ref|XP_003601871.1| Pectate lyase [Medicago truncatula]
 gb|AES72122.1| pectate lyase family protein [Medicago truncatula]
Length=403

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 132/153 (86%), Gaps = 3/153 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SSP  DPEL+VQ+V + I ++   RR L FLSCG+GNPIDDCWRCD NWE NRQR
Sbjct  18   PSFIQSSPLQDPELVVQDVQKSINDS---RRNLAFLSCGSGNPIDDCWRCDKNWEKNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD GD AVNPKPGTLRYG IQ+EPLWIIF RDMVIKL
Sbjct  75   LADCAIGFGKHAIGGRDGKIYVVTDPGDHAVNPKPGTLRYGVIQEEPLWIIFKRDMVIKL  134

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            K+EL+MNSFKTIDGRG +VHIAGGPCIT+Q+VT
Sbjct  135  KQELMMNSFKTIDGRGTNVHIAGGPCITVQFVT  167



>gb|KJB37784.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=328

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = +1

Query  139  PDPELIVQEVNE----KIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            PDPE +  EV       I N T  RRKLGF +CGTGNPIDDCWRCDPNW+ NR+RLADC 
Sbjct  64   PDPEAVAAEVESIIDMNIRNVT-ERRKLGFFTCGTGNPIDDCWRCDPNWQKNRKRLADCG  122

Query  307  IGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFG+ AIGGRDG+ YVVTD   DD VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+EL
Sbjct  123  IGFGRNAIGGRDGRFYVVTDPNDDDPVNPKPGTLRHAVIQDEPLWIVFKRDMVIRLKQEL  182

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRG +VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  183  IMNSFKTIDGRGVNVHIANGACITIQYVTNVIIHGLHIHD  222



>ref|XP_011010949.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=403

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 4/156 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            A    FSS   DPEL+VQEV   I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  16   ATHLVFSSSIQDPELVVQEVQRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWERNRQ  72

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGR+G++YVVTD+G DDAVNPKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  73   RLADCAIGFGKNAIGGRNGRIYVVTDSGNDDAVNPKPGTLRHAVIQDEPLWIIFKRDMVI  132

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            +L++EL+MNS+KTIDGRGASVHIAGGPCITI Y TN
Sbjct  133  QLRQELVMNSYKTIDGRGASVHIAGGPCITIHYATN  168



>emb|CAA22985.1| putative pectate lyase [Arabidopsis thaliana]
 emb|CAB79388.1| putative pectate lyase [Arabidopsis thaliana]
Length=404

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21   LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G D+ V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHI+GGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHISGGPCITIQYVTN  171



>gb|AAK25850.1|AF360140_1 putative pectate lyase [Arabidopsis thaliana]
Length=408

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  23   LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  82

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G D+ V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  83   AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  142

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHI+GGPCITIQYVTN
Sbjct  143  LIMNSFKTIDGRGASVHISGGPCITIQYVTN  173



>ref|XP_002867644.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43903.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=406

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21   LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G D+ V+PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHI+GGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHISGGPCITIQYVTN  171



>ref|NP_567707.1| putative pectate lyase 18 [Arabidopsis thaliana]
 ref|NP_001190827.1| putative pectate lyase 18 [Arabidopsis thaliana]
 sp|Q9C5M8.2|PLY18_ARATH RecName: Full=Probable pectate lyase 18; AltName: Full=Pectate 
lyase A10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAW38990.1| At4g24780 [Arabidopsis thaliana]
 gb|AEE84955.1| putative pectate lyase 18 [Arabidopsis thaliana]
 gb|AEE84956.1| putative pectate lyase 18 [Arabidopsis thaliana]
Length=408

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  23   LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  82

Query  304  AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G D+ V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  83   AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  142

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHI+GGPCITIQYVTN
Sbjct  143  LIMNSFKTIDGRGASVHISGGPCITIQYVTN  173



>ref|XP_004502358.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=405

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 3/153 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SSP  DPEL+VQ+V + I  +   RR L FLSCGTGNPIDDCWRCDPNWE NR+R
Sbjct  20   PSFIHSSPLQDPELVVQDVQKSINGS---RRNLAFLSCGTGNPIDDCWRCDPNWEKNRKR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  471
            LADCAIGFGK AIGGRDGK+YVVTD GD  V PKPGTLRYG IQ+EPLWIIF RDMVIKL
Sbjct  77   LADCAIGFGKHAIGGRDGKIYVVTDPGDHPVKPKPGTLRYGVIQEEPLWIIFKRDMVIKL  136

Query  472  KEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            K+EL+MNSFKTIDGRG +VHIAGGPCITIQ+VT
Sbjct  137  KQELMMNSFKTIDGRGTNVHIAGGPCITIQFVT  169



>ref|XP_009631254.1| PREDICTED: probable pectate lyase 18 [Nicotiana tomentosiformis]
Length=406

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SS   +P+ +V +V+  I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  19   PALFASSTLQNPQSVVDQVHRSINNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LA+CAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLRY  IQ+EPLWIIFARDMVI+
Sbjct  77   LAECAIGFGKNAIGGRDGKIYVVTDSGNDDPVNPKPGTLRYAVIQNEPLWIIFARDMVIQ  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LKEELIMNSFKTIDGRGASVHI GGPCITIQYVTN
Sbjct  137  LKEELIMNSFKTIDGRGASVHITGGPCITIQYVTN  171



>ref|XP_004975048.1| PREDICTED: probable pectate lyase 15-like isoform X3 [Setaria 
italica]
Length=440

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARR L +LSCGTGNPIDDCWRCD +W  NRQRLADC IGFG+
Sbjct  62   DPEAVVDDVHVSIRNST-ARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGFGR  120

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DDAVNP+ GTLRYG IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  121  NAIGGRDGKIYVVTDPSDDDAVNPRKGTLRYGVIQDEPLWIIFKRDMVITLKQELIMNSF  180

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHD
Sbjct  181  KTIDGRGANVHISGGACITIQYVSNVIIHGLHIHD  215



>gb|KJB37785.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=377

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = +1

Query  139  PDPELIVQEVNE----KIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            PDPE +  EV       I N T  RRKLGF +CGTGNPIDDCWRCDPNW+ NR+RLADC 
Sbjct  64   PDPEAVAAEVESIIDMNIRNVT-ERRKLGFFTCGTGNPIDDCWRCDPNWQKNRKRLADCG  122

Query  307  IGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFG+ AIGGRDG+ YVVTD   DD VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+EL
Sbjct  123  IGFGRNAIGGRDGRFYVVTDPNDDDPVNPKPGTLRHAVIQDEPLWIVFKRDMVIRLKQEL  182

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRG +VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  183  IMNSFKTIDGRGVNVHIANGACITIQYVTNVIIHGLHIHD  222



>ref|XP_004134015.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 ref|XP_004157662.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN56767.1| hypothetical protein Csa_3G133180 [Cucumis sativus]
Length=447

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            +PE I   V+  I NAT ARR+LGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  69   NPEEIAAMVDMSIRNAT-ARRELGFFSCGTGNPIDDCWRCDPNWQQNRKRLADCGIGFGR  127

Query  322  QAIGGRDGKLYVVTDTGDDA-VNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD+GDD  VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  128  NAIGGRDGRFYVVTDSGDDNPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  187

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTID RG +VHIA G C+TIQ+VTN+I+HGLNIHD
Sbjct  188  KTIDARGTNVHIANGACLTIQFVTNVIVHGLNIHD  222



>ref|XP_002314576.1| pectate lyase 5 precursor family protein [Populus trichocarpa]
 gb|EEF00747.1| pectate lyase 5 precursor family protein [Populus trichocarpa]
Length=402

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 132/155 (85%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP+     P  DPEL+V+EV+  I     +RR L FLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15   APSFISCLPVQDPELVVEEVHRSI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLA+CAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWI FARDMVI
Sbjct  72   RLANCAIGFGKNAIGGRDGKIYVVTDSGHDDPVNPKPGTLRHAVIQDEPLWITFARDMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            +LKEELIMNSFKTIDGRGA+VHIAGGPCITIQYVT
Sbjct  132  RLKEELIMNSFKTIDGRGANVHIAGGPCITIQYVT  166



>ref|XP_008438392.1| PREDICTED: probable pectate lyase 8 [Cucumis melo]
Length=447

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            +PE I   V+  I NAT ARR+LGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  69   NPEEIAAMVDMSIRNAT-ARRELGFFSCGTGNPIDDCWRCDPNWQQNRKRLADCGIGFGR  127

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD+GDD  VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  128  NAIGGRDGRFYVVTDSGDDNPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  187

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTID RG +VHIA G C+TIQ+VTN+I+HGLNIHD
Sbjct  188  KTIDARGTNVHIANGACLTIQFVTNVIVHGLNIHD  222



>ref|XP_004975047.1| PREDICTED: probable pectate lyase 15-like isoform X2 [Setaria 
italica]
Length=473

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARR L +LSCGTGNPIDDCWRCD +W  NRQRLADC IGFG+
Sbjct  95   DPEAVVDDVHVSIRNST-ARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGFGR  153

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DDAVNP+ GTLRYG IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  154  NAIGGRDGKIYVVTDPSDDDAVNPRKGTLRYGVIQDEPLWIIFKRDMVITLKQELIMNSF  213

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHD
Sbjct  214  KTIDGRGANVHISGGACITIQYVSNVIIHGLHIHD  248



>gb|AAM65103.1| putative pectate lyase [Arabidopsis thaliana]
Length=406

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
             SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21   LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  304  AIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
            AIGFGK AIGGRDG++YVVTD+G+ + V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81   AIGFGKNAIGGRDGRIYVVTDSGNYNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  140

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LIMNSFKTIDGRGASVHI+GGPCITIQYVTN
Sbjct  141  LIMNSFKTIDGRGASVHISGGPCITIQYVTN  171



>ref|XP_002446075.1| hypothetical protein SORBIDRAFT_06g001410 [Sorghum bicolor]
 gb|EES10403.1| hypothetical protein SORBIDRAFT_06g001410 [Sorghum bicolor]
Length=381

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGFG+
Sbjct  74   DPEAVANDVHVSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFGR  132

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DD VNP+ GTLRY  IQ+EPLWIIF RDMVI LKEELIMNSF
Sbjct  133  NAIGGRDGKIYVVTDPSDDDPVNPRKGTLRYAVIQEEPLWIIFKRDMVITLKEELIMNSF  192

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQY+TN+IIHGL+IHD
Sbjct  193  KTIDGRGANVHIANGACITIQYITNVIIHGLHIHD  227



>ref|XP_009788173.1| PREDICTED: probable pectate lyase 18 [Nicotiana sylvestris]
Length=406

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  127  SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            SS   +P+ +V  V+  I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLA+CA
Sbjct  24   SSTLQNPQSVVDPVHRSINNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLAECA  81

Query  307  IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFGK AIGG+DGK+YVVTD+G DD VNPKPGTLRY  IQ+EPLW+IFARDMVI+LKEEL
Sbjct  82   IGFGKNAIGGKDGKIYVVTDSGNDDPVNPKPGTLRYAVIQNEPLWVIFARDMVIQLKEEL  141

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            IMNSFKTIDGRGASVHIAGGPCITIQYVTN
Sbjct  142  IMNSFKTIDGRGASVHIAGGPCITIQYVTN  171



>ref|XP_010935686.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=425

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCDP+W  NR+RLADC IGFG+
Sbjct  47   DPEMVASMVQMSIRNST-ARRALGYLSCGTGNPIDDCWRCDPDWHHNRKRLADCGIGFGR  105

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNP+PGTLR+  +QDEPLWI+F RDMVI LKEELIMNSF
Sbjct  106  NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVVQDEPLWIVFQRDMVITLKEELIMNSF  165

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  166  KTIDGRGANVHIANGACITIQFITNVIIHGLHIHD  200



>ref|XP_004975046.1| PREDICTED: probable pectate lyase 15-like isoform X1 [Setaria 
italica]
Length=509

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V +V+  I N+T ARR L +LSCGTGNPIDDCWRCD +W  NRQRLADC IGFG+
Sbjct  131  DPEAVVDDVHVSIRNST-ARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGFGR  189

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD + DDAVNP+ GTLRYG IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  190  NAIGGRDGKIYVVTDPSDDDAVNPRKGTLRYGVIQDEPLWIIFKRDMVITLKQELIMNSF  249

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHD
Sbjct  250  KTIDGRGANVHISGGACITIQYVSNVIIHGLHIHD  284



>ref|XP_008804450.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=426

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  48   DPELVASEVHMTINNHT-ARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIGFGR  106

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNP+PGTLRY  IQD+PLWI+F RDMVI LKEELIMNSF
Sbjct  107  NAIGGRDGRYYVVTDPGDDDPVNPRPGTLRYAVIQDQPLWIVFKRDMVITLKEELIMNSF  166

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  167  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHD  201



>gb|EYU32621.1| hypothetical protein MIMGU_mgv1a006198mg [Erythranthe guttata]
Length=453

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V+ V     N+T  RR+LG+ SCGTGNPIDDCWRCDPNW  NR+RLADC IGFG+
Sbjct  74   DPEEVVRMVEMATRNSTDRRRRLGYFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGR  133

Query  322  QAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD+G DD V PKPGTLRY  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  134  NAIGGRDGRFYVVTDSGNDDPVTPKPGTLRYAVIQDEPLWIVFQRDMVITLKQELIMNSF  193

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTID RGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  194  KTIDARGANVHIANGACITIQFITNVIIHGLHIHD  228



>ref|XP_010935685.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=453

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCDP+W  NR+RLADC IGFG+
Sbjct  75   DPEMVASMVQMSIRNST-ARRALGYLSCGTGNPIDDCWRCDPDWHHNRKRLADCGIGFGR  133

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNP+PGTLR+  +QDEPLWI+F RDMVI LKEELIMNSF
Sbjct  134  NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVVQDEPLWIVFQRDMVITLKEELIMNSF  193

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  194  KTIDGRGANVHIANGACITIQFITNVIIHGLHIHD  228



>ref|XP_008804449.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=451

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  73   DPELVASEVHMTINNHT-ARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIGFGR  131

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNP+PGTLRY  IQD+PLWI+F RDMVI LKEELIMNSF
Sbjct  132  NAIGGRDGRYYVVTDPGDDDPVNPRPGTLRYAVIQDQPLWIVFKRDMVITLKEELIMNSF  191

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  192  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHD  226



>gb|KJB37786.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=447

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = +1

Query  139  PDPELIVQEVNE----KIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  306
            PDPE +  EV       I N T  RRKLGF +CGTGNPIDDCWRCDPNW+ NR+RLADC 
Sbjct  64   PDPEAVAAEVESIIDMNIRNVT-ERRKLGFFTCGTGNPIDDCWRCDPNWQKNRKRLADCG  122

Query  307  IGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  483
            IGFG+ AIGGRDG+ YVVTD   DD VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+EL
Sbjct  123  IGFGRNAIGGRDGRFYVVTDPNDDDPVNPKPGTLRHAVIQDEPLWIVFKRDMVIRLKQEL  182

Query  484  IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            IMNSFKTIDGRG +VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  183  IMNSFKTIDGRGVNVHIANGACITIQYVTNVIIHGLHIHD  222



>ref|XP_011042354.1| PREDICTED: probable pectate lyase 5 [Populus euphratica]
Length=402

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
            AP+    SP  DPEL+V+EV+  I     +RR L  LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15   APSFISCSPVQDPELVVEEVHRSI---NASRRNLASLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLA+CAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWI FAR+MVI
Sbjct  72   RLANCAIGFGKNAIGGRDGKIYVVTDSGHDDPVNPKPGTLRHAVIQDEPLWITFARNMVI  131

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            +LKEELIMNSFKTIDGRGA+VHIAGGPCITIQYVT
Sbjct  132  RLKEELIMNSFKTIDGRGANVHIAGGPCITIQYVT  166



>gb|EPS68938.1| hypothetical protein M569_05827, partial [Genlisea aurea]
Length=394

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  303
            F+    DPE + + V     N+T  RRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC
Sbjct  9    FNYTMEDPEEVARMVEMATRNSTERRRKLGFFSCGTGNPIDDCWRCDPNWHKNRRRLADC  68

Query  304  AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  480
             IGFG+ AIGGRDG+ YVV+D GDD  VNP+PGTLR+  IQD PLWI+F RDMVI LK+E
Sbjct  69   GIGFGRNAIGGRDGRFYVVSDPGDDDPVNPRPGTLRHAVIQDRPLWIVFKRDMVITLKQE  128

Query  481  LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            LIMNSFKTIDGRGA+VH+A G CIT+Q+VTNIIIHGL+IHD
Sbjct  129  LIMNSFKTIDGRGANVHVAYGACITVQFVTNIIIHGLHIHD  169



>ref|XP_011073763.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=444

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE + + V     N+T  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  66   DPEEVARMVEMATRNST-ERRKLGFFSCGTGNPIDDCWRCDPNWQRNRKRLADCGIGFGR  124

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD AVNPKPGTLR+  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  125  NAIGGRDGRYYVVTDPGDDDAVNPKPGTLRHAVIQDEPLWIVFKRDMVITLKQELIMNSF  184

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRG +VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  185  KTIDGRGVNVHIANGACITIQFITNVIIHGLHIHD  219



>ref|XP_008789532.1| PREDICTED: probable pectate lyase 8 [Phoenix dactylifera]
Length=322

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DP+++   V   I N++ ARR LG+LSCGTGNPIDDCWRCDP W  +R+RLADC IGFG 
Sbjct  6    DPDMVASMVQMSIRNSS-ARRALGYLSCGTGNPIDDCWRCDPAWHHHRKRLADCGIGFGH  64

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             A+GGRDG+LYVVTD GDD  VNP+PGTLR+ AIQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  65   NAVGGRDGRLYVVTDPGDDDPVNPRPGTLRHAAIQDEPLWIVFKRDMVITLKQELIMNSF  124

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  125  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHD  159



>gb|EYU46355.1| hypothetical protein MIMGU_mgv1a007094mg [Erythranthe guttata]
Length=419

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE I   V   I N+T  RRKLGFLSCGTGNPIDDCWRCD NW  NR+RLADCAIGFG+
Sbjct  40   DPEAIAAMVESNIRNST-ERRKLGFLSCGTGNPIDDCWRCDRNWIRNRKRLADCAIGFGR  98

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             A+GGRDG+ YVVTD + DDAVNP+PGTLR+  IQD PLWI+F RDMVI LK+ELIMNSF
Sbjct  99   NAVGGRDGRYYVVTDPSDDDAVNPRPGTLRHAVIQDRPLWIVFKRDMVITLKQELIMNSF  158

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+I+HGL+IHD
Sbjct  159  KTIDGRGANVHIANGACITIQYVTNVIVHGLHIHD  193



>gb|EYU17974.1| hypothetical protein MIMGU_mgv1a006571mg [Erythranthe guttata]
Length=438

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = +1

Query  124  FSSPYP--DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLA  297
            F +P+   DPE I   VN  I N+T  RRKLGF SCGTGNPIDDCWRCD NW  NR+RLA
Sbjct  53   FDNPHAVDDPEAIATMVNMAIRNST-ERRKLGFFSCGTGNPIDDCWRCDRNWIRNRRRLA  111

Query  298  DCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  474
            DC+IGFG+ A+GGRDG+ YVVTD  D DAVNP+PGTLR+  IQD PLWI+F RDMVI LK
Sbjct  112  DCSIGFGRNAVGGRDGRFYVVTDPNDYDAVNPRPGTLRHAVIQDRPLWIVFKRDMVITLK  171

Query  475  EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +ELIMNSFKTID RGA+VHIAGG CITIQYVTNIIIHGL+IHD
Sbjct  172  QELIMNSFKTIDARGANVHIAGGACITIQYVTNIIIHGLHIHD  214



>ref|XP_010444201.1| PREDICTED: probable pectate lyase 22 isoform X3 [Camelina sativa]
Length=365

 Score =   246 bits (629),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +1

Query  193  IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGKQAIGGRDGKLYVVTDTG  372
            ++RRKLGF SCGTGNPIDDCWRCD +WE NR+RLADC IGFGK AIGGRDG++YVVTD G
Sbjct  1    MSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPG  60

Query  373  -DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPC  549
             DD VNPKPGTLRY  I+DEPLWIIF RDM I+LKEELIMNSFKT+DGRGASVHI+GGPC
Sbjct  61   NDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPC  120

Query  550  ITIQYVTNIIIHGLNIHD  603
            ITIQYVTNIIIHGL+IHD
Sbjct  121  ITIQYVTNIIIHGLHIHD  138



>gb|EYU43815.1| hypothetical protein MIMGU_mgv1a006554mg [Erythranthe guttata]
Length=439

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V+ V     N+T  RRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IGFG+
Sbjct  59   DPEEVVRMVEMATRNST-ERRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGR  117

Query  322  QAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ Y+VTD G DD VNP+PGTLRY  IQ +PLWI+F RDMVI LK+ELIMNSF
Sbjct  118  NAIGGRDGRFYIVTDPGNDDPVNPRPGTLRYAVIQTQPLWILFKRDMVITLKQELIMNSF  177

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  178  KTIDGRGANVHIANGGCITIQYVTNVIIHGLHIHD  212



>ref|XP_010435229.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=461

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            DPE +  EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  79   DPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  138

Query  313  FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  139  FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  198

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  199  NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHD  236



>ref|XP_010440534.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=466

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            DPE +  EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  84   DPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  143

Query  313  FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  144  FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  203

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  204  NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHD  241



>ref|XP_010440536.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=462

 Score =   249 bits (636),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            DPE +  EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  80   DPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  139

Query  313  FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  140  FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  199

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  200  NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHD  237



>ref|XP_008796023.1| PREDICTED: probable pectate lyase 5 [Phoenix dactylifera]
Length=409

 Score =   248 bits (632),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 4/143 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+VQEV   + ++   RR+LG+LSCGTGNPIDDCWRCD NWESNRQRLADCAIGFGK
Sbjct  33   DPELVVQEVQRSLNSS---RRRLGYLSCGTGNPIDDCWRCDRNWESNRQRLADCAIGFGK  89

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIF +DMVIKLKEELIMNS+
Sbjct  90   NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFQQDMVIKLKEELIMNSY  149

Query  499  KTIDGRGASVHIAGGPCITIQYV  567
            KT+DGRGASVHIAGGPCITIQYV
Sbjct  150  KTLDGRGASVHIAGGPCITIQYV  172



>gb|KDP33375.1| hypothetical protein JCGZ_12924 [Jatropha curcas]
Length=449

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V  V   I N+T  RR+LG+ SCGTGNPIDDCWRCDPNW+ NR+RLA+C IGFG+
Sbjct  71   DPEEVVAMVEMSIRNST-ERRQLGYFSCGTGNPIDDCWRCDPNWQKNRKRLAECGIGFGR  129

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  130  NAIGGRDGRFYVVTDAGDDDPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  189

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRG +VHIA G CITIQ+VTN+IIHGL+IHD
Sbjct  190  KTIDGRGVNVHIANGACITIQFVTNVIIHGLHIHD  224



>ref|XP_006854398.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
 gb|ERN15865.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
Length=457

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE++   V   I NAT  RR+LGF SCGTGNPIDDCWRCDP W   R+RLADC IGFG+
Sbjct  79   DPEMVASMVEMSIHNAT-QRRRLGFFSCGTGNPIDDCWRCDPLWARRRKRLADCGIGFGR  137

Query  322  QAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             A+GGRDG+ YVVTD+ D DAVNP+PGTLR+  IQDEPLWI+F RDMVIKLK+ELIMNSF
Sbjct  138  NAVGGRDGRYYVVTDSSDNDAVNPRPGTLRHAVIQDEPLWIVFNRDMVIKLKQELIMNSF  197

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRG +VHIAGG CIT+Q+VTNIIIHGL+IHD
Sbjct  198  KTIDGRGVNVHIAGGACITVQFVTNIIIHGLHIHD  232



>ref|XP_011097349.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=406

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SS   DP+++VQ+V++ I     +RR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  20   PILASSSSLQDPDIVVQDVHKSI---NASRRNLGYLSCATGNPIDDCWRCDPNWEQNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GG+ G++YVVTD+GDD  VNP+PGTLR+  IQD PLWIIF RDMVI+
Sbjct  77   LADCAIGFGKNAMGGKGGRIYVVTDSGDDDPVNPRPGTLRHAVIQDGPLWIIFRRDMVIR  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            L +EL+MNS KTIDGRGASVHIAGG CITI +VTN+IIHG++IHD
Sbjct  137  LNQELVMNSHKTIDGRGASVHIAGGACITIHHVTNVIIHGIHIHD  181



>ref|NP_001147553.1| pectate lyase 8 [Zea mays]
 gb|ACG27904.1| pectate lyase 8 precursor [Zea mays]
Length=467

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   +    DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W SNRQR
Sbjct  92   PSRAVTGAVEDPEAVANDVHVSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQR  150

Query  292  LADCAIGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADC IGFG+ AIGGRDGK+YVVTD + DD VNP+ GTLR+  IQ+EPLWIIF RDMVI 
Sbjct  151  LADCGIGFGRNAIGGRDGKVYVVTDPSDDDPVNPREGTLRHAVIQEEPLWIIFKRDMVIT  210

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            L+EELIMNSFKTIDGRGA+VHIA G C+TIQYVTN+IIHGL+IHD
Sbjct  211  LREELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHD  255



>ref|XP_004497757.1| PREDICTED: probable pectate lyase 15-like [Cicer arietinum]
Length=452

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE++   V   I N T  RR LGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  74   DPEVVASMVEMHIQNNT-QRRNLGFFSCGTGNPIDDCWRCDPNWQRNRKRLADCGIGFGR  132

Query  322  QAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK YVVTD  D DAVNP+PGTLR+  IQD PLWI+F RDMVI+LK+ELI+NSF
Sbjct  133  NAIGGRDGKFYVVTDPSDNDAVNPRPGTLRHAVIQDRPLWIVFKRDMVIQLKQELIVNSF  192

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRG++VHIA G CITIQYVTN+IIHGL+IHD
Sbjct  193  KTIDGRGSNVHIANGGCITIQYVTNVIIHGLHIHD  227



>ref|XP_008667903.1| PREDICTED: pectate lyase 8 isoform X1 [Zea mays]
 tpg|DAA38670.1| TPA: pectate lyase 8 [Zea mays]
Length=479

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   +    DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W SNRQR
Sbjct  91   PSRAVTGAVEDPEAVANDVHVSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQR  149

Query  292  LADCAIGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADC IGFG+ AIGGRDGK+YVVTD + DD VNP+ GTLR+  IQ+EPLWIIF RDMVI 
Sbjct  150  LADCGIGFGRNAIGGRDGKVYVVTDPSDDDPVNPREGTLRHAVIQEEPLWIIFKRDMVIT  209

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            L+EELIMNSFKTIDGRGA+VHIA G C+TIQYVTN+IIHGL+IHD
Sbjct  210  LREELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHD  254



>ref|XP_003524720.1| PREDICTED: pectate lyase-like [Glycine max]
 gb|KHN45984.1| Putative pectate lyase 5 [Glycine soja]
Length=404

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P+   SS   DPEL+VQEV   I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  18   PSFVSSSAVRDPELVVQEVQRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWENNRQR  74

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADC+IGFGK AIGG++G++YVVTD+GDD AVNP+PGTLRY AIQDEPLWI+F RDMVI 
Sbjct  75   LADCSIGFGKDAIGGKNGRIYVVTDSGDDDAVNPRPGTLRYAAIQDEPLWIMFKRDMVIT  134

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LKEEL++NSFKTIDGRGASVHIAGG CITI YV+N
Sbjct  135  LKEELLVNSFKTIDGRGASVHIAGGGCITIHYVSN  169



>dbj|BAF43573.1| pectate lyase [Prunus persica]
Length=425

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V  V+  I N+T  RRKLGF SCGTGNPIDDCWRCD NW+ NR+RLADC IGFG+
Sbjct  47   DPEEVVAMVDMSIRNST-ERRKLGFFSCGTGNPIDDCWRCDSNWQKNRKRLADCGIGFGR  105

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI+LK+ELIMNSF
Sbjct  106  NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQNEPLWIVFKRDMVIQLKQELIMNSF  165

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRG +VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  166  KTIDGRGVNVHIANGACITIQFVTNIIIHGLHIHD  200



>ref|XP_007222160.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
 gb|ADD62392.1| pectase lyase [Prunus persica]
 gb|EMJ23359.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
Length=445

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V  V+  I N+T  RRKLGF SCGTGNPIDDCWRCD NW+ NR+RLADC IGFG+
Sbjct  67   DPEEVVAMVDMSIRNST-ERRKLGFFSCGTGNPIDDCWRCDSNWQKNRKRLADCGIGFGR  125

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI+LK+ELIMNSF
Sbjct  126  NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQNEPLWIVFKRDMVIQLKQELIMNSF  185

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRG +VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  186  KTIDGRGVNVHIANGACITIQFVTNIIIHGLHIHD  220



>emb|CDY32557.1| BnaC02g17500D [Brassica napus]
Length=406

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            PT   S+   DPEL+VQEVN+KI     +RR LG LSCGTGNPIDDCWRCD  WE NRQR
Sbjct  20   PTFIDSAHVSDPELVVQEVNQKI---NASRRNLGVLSCGTGNPIDDCWRCDKKWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  77   LADCAIGFGKHAIGGRDGKIYVVTDPSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            LKEEL+MNSFKTIDGRGA+VHIAGG CIT QYVT
Sbjct  137  LKEELLMNSFKTIDGRGANVHIAGGACITAQYVT  170



>ref|XP_003555714.2| PREDICTED: probable pectate lyase 1-like [Glycine max]
Length=489

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            +PE +V  V   I N+T  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  111  NPEEVVSMVEMSIQNST-ERRKLGFFSCGTGNPIDDCWRCDPNWQRNRKRLADCGIGFGR  169

Query  322  QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK YVVTD   DD VNPKPGTLR+  IQD+PLWI+F RDMVI+LK+ELIMNSF
Sbjct  170  NAIGGRDGKFYVVTDPRDDDPVNPKPGTLRHAVIQDKPLWIVFKRDMVIQLKQELIMNSF  229

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRG +VHIA G CITIQ+VTN+IIHGL+IHD
Sbjct  230  KTIDGRGVNVHIANGACITIQFVTNVIIHGLHIHD  264



>ref|XP_004236303.1| PREDICTED: probable pectate lyase 18 [Solanum lycopersicum]
Length=403

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            +P+ +V EV+  I  +   RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  26   NPQQVVDEVHRSINGS---RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  82

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD AV PKPGTLR+  IQ EPLWIIFARDMVI+LKEELIMNSF
Sbjct  83   NAIGGRDGKIYVVTDSGDDNAVTPKPGTLRHAVIQTEPLWIIFARDMVIQLKEELIMNSF  142

Query  499  KTIDGRGASVHIAGGPCITIQYVTN  573
            KTIDGRGASVHIAGGPCITIQYVTN
Sbjct  143  KTIDGRGASVHIAGGPCITIQYVTN  167



>emb|CDY12666.1| BnaA02g13340D [Brassica napus]
Length=406

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 129/155 (83%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
             PT   S+   DPEL+VQEVN+KI     +RR LG LSCGTGNPIDDCWRCD  WE NRQ
Sbjct  19   GPTFIDSAHVSDPELVVQEVNQKI---NASRRNLGVLSCGTGNPIDDCWRCDKKWEKNRQ  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  76   RLADCAIGFGKHAIGGRDGKIYVVTDPSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KLKEEL+MNSFKTIDGRGA+VHIAGG CIT QYVT
Sbjct  136  KLKEELLMNSFKTIDGRGANVHIAGGACITAQYVT  170



>ref|XP_009127577.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 129/155 (83%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  288
             PT   S+   DPEL+VQEVN+KI     +RR LG LSCGTGNPIDDCWRCD  WE NRQ
Sbjct  19   GPTFIDSAHVSDPELVVQEVNQKI---NASRRNLGVLSCGTGNPIDDCWRCDKKWEKNRQ  75

Query  289  RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  465
            RLADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  76   RLADCAIGFGKHAIGGRDGKIYVVTDPSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVI  135

Query  466  KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            KLKEEL+MNSFKTIDGRGA+VHIAGG CIT QYVT
Sbjct  136  KLKEELLMNSFKTIDGRGANVHIAGGACITAQYVT  170



>ref|XP_009762540.1| PREDICTED: probable pectate lyase 18 [Nicotiana sylvestris]
Length=407

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DP+ +V EV+  +     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  30   DPQAVVDEVHRSV---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  86

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             A+GGRDGK+YVVTD+GDD  VNPKPGTLR+  +Q EPLWIIFARDMVI+LKEELIMNSF
Sbjct  87   NAVGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVVQTEPLWIIFARDMVIQLKEELIMNSF  146

Query  499  KTIDGRGASVHIAGGPCITIQYVTN  573
            KTIDGRGASVHIAGGPCITIQYVTN
Sbjct  147  KTIDGRGASVHIAGGPCITIQYVTN  171



>ref|XP_007163701.1| hypothetical protein PHAVU_001G256900g [Phaseolus vulgaris]
 gb|ESW35695.1| hypothetical protein PHAVU_001G256900g [Phaseolus vulgaris]
Length=452

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = +1

Query  118  CTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLA  297
            C  SSP  DPEL+V++V + I     +RR L FLSCGTGNPIDDCWRCD NWE NR+ LA
Sbjct  69   CICSSPLQDPELVVEDVQKSI---NASRRNLAFLSCGTGNPIDDCWRCDANWEKNRKNLA  125

Query  298  DCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  477
            +C+IGFGK AIGGRDGK+YVV+D GD  VNPKPGTLRYG IQ+EPLWIIF RDMVI+LK+
Sbjct  126  ECSIGFGKHAIGGRDGKIYVVSDPGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIRLKQ  185

Query  478  ELIMNSFKTIDGRGASVHIAGGPCITIQYVT  570
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVT
Sbjct  186  ELMMNSFKTIDGRGASVHIAGGPCITIQYVT  216



>gb|KHG06252.1| hypothetical protein F383_10745 [Gossypium arboreum]
Length=429

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 133/159 (84%), Gaps = 6/159 (4%)
 Frame = +1

Query  142  DPELIVQEV----NEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAI  309
            DPE +  EV    +  I NAT  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC I
Sbjct  47   DPEAVAAEVETIIDMNIRNAT-ERRKLGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCGI  105

Query  310  GFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELI  486
            GFG+ AIGGRDG+ YVVTD+ DD  VNPKPGTLR+  IQ++PLWI+F RDMVIKLK+EL+
Sbjct  106  GFGRNAIGGRDGRFYVVTDSNDDDPVNPKPGTLRHAVIQEQPLWIVFKRDMVIKLKQELL  165

Query  487  MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            +NSFKTIDGRG +VHIA G CITIQYVTN+I+HGL+IHD
Sbjct  166  VNSFKTIDGRGVNVHIANGACITIQYVTNVIVHGLHIHD  204



>ref|XP_010940647.1| PREDICTED: probable pectate lyase 8 [Elaeis guineensis]
Length=448

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCDP+W  NR+RLADC IGFG+
Sbjct  70   DPEVVASMVQMSIRNST-ARRALGYLSCGTGNPIDDCWRCDPDWHLNRKRLADCGIGFGR  128

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             A+GGRDG+ YVVTD GDD  VNP+PGTLR+  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  129  NAVGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQDEPLWIVFKRDMVITLKQELIMNSF  188

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ+VTNIIIHGL++HD
Sbjct  189  KTIDGRGANVHIANGACITIQFVTNIIIHGLHVHD  223



>ref|XP_009593549.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=447

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V  V E I N+T  RR+LG+ SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  69   DPEQVVSMVAESIRNST-ERRRLGYFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGR  127

Query  322  QAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD+  DD VNP+PGTLR+  IQ+EPLWI+F RDMVI+LK+ELIMNSF
Sbjct  128  NAIGGRDGRYYVVTDSRDDDPVNPRPGTLRHAVIQEEPLWIVFNRDMVIQLKQELIMNSF  187

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTID RG +VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  188  KTIDARGYNVHIANGACITIQFVTNIIIHGLHIHD  222



>gb|KJB33886.1| hypothetical protein B456_006G036300 [Gossypium raimondii]
Length=407

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 130/155 (84%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  291
            P    SSP  DPE +V EV++ I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  20   PNLASSSPVQDPEFVVDEVHKSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  76

Query  292  LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  468
            LADCAIGFGK A+GG++G++YV+TD GDD  VNP+PGTLR+  IQDEPLWIIF RDMVI 
Sbjct  77   LADCAIGFGKHAMGGKNGRIYVITDAGDDDPVNPRPGTLRHAVIQDEPLWIIFKRDMVIT  136

Query  469  LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN  573
            LK+EL+MNSFKTIDGRGASVHI+GGPCITI YV+N
Sbjct  137  LKQELLMNSFKTIDGRGASVHISGGPCITIHYVSN  171



>ref|XP_010918897.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  48   DPELVASEVHMAINNHT-ARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIGFGR  106

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             A+GGRDG+ Y VTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI LKEELIMNSF
Sbjct  107  NAVGGRDGRYYAVTDPGDDDPVNPRPGTLRHAVIQEEPLWIVFKRDMVITLKEELIMNSF  166

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  167  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHD  201



>ref|XP_006351443.1| PREDICTED: probable pectate lyase 18-like [Solanum tuberosum]
Length=403

 Score =   245 bits (626),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            +P+ +V EV   I  +   RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  26   NPQQVVDEVQRSINGS---RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  82

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD AV PKPGTLR+  IQ EPLWIIFARDMVI+LKEELIMNSF
Sbjct  83   NAIGGRDGKIYVVTDSGDDNAVTPKPGTLRHAVIQTEPLWIIFARDMVIQLKEELIMNSF  142

Query  499  KTIDGRGASVHIAGGPCITIQYVTN  573
            KTIDGRGASVHIAGGPCITIQYVTN
Sbjct  143  KTIDGRGASVHIAGGPCITIQYVTN  167



>ref|XP_010450168.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=461

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            DPE    EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  79   DPEKGADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  138

Query  313  FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  139  FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  198

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  199  NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHD  236



>emb|CDY18738.1| BnaC08g08780D [Brassica napus]
Length=476

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIA---NATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            DP+ +  EV   +    +   ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  94   DPDRVADEVASLVQMSEHNKTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  153

Query  313  FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FG+ AIGGRDG+ Y+VTD T DDA+NPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  154  FGRNAIGGRDGRFYIVTDPTDDDAINPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  213

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRG++VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  214  NSFKTIDGRGSNVHIANGACITIQFITNVIIHGLHIHD  251



>ref|XP_010450167.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=465

 Score =   247 bits (630),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  312
            DPE    EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  83   DPEKGADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  142

Query  313  FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  489
            FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  143  FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  202

Query  490  NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHD
Sbjct  203  NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHD  240



>gb|AAM12784.1| putative pectate-lyase [Capsicum annuum]
Length=324

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            +P+ +V EV+  I  +   RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  26   NPQQVVDEVHRSINGS---RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  82

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDGK+YVVTD+GDD  V PKPGTLR+  IQ EPLWIIFARDMVI+LKEELIMNSF
Sbjct  83   NAIGGRDGKIYVVTDSGDDDPVTPKPGTLRHAVIQTEPLWIIFARDMVIQLKEELIMNSF  142

Query  499  KTIDGRGASVHIAGGPCITIQYVTN  573
            KTIDGRGASVHIAGGPCITIQYVTN
Sbjct  143  KTIDGRGASVHIAGGPCITIQYVTN  167



>ref|XP_006360328.1| PREDICTED: probable pectate lyase 15-like [Solanum tuberosum]
Length=454

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPE +V  V E I N+T  RRKLG+ SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  76   DPEEVVAMVAESIRNST-ERRKLGYFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGR  134

Query  322  QAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             AIGGRDG+ YVVTD   DD VNP+PGT+R+  IQ+EPLWI+F+RDMVI+LK+ELIMNSF
Sbjct  135  NAIGGRDGRYYVVTDNRDDDPVNPRPGTIRHAVIQEEPLWIVFSRDMVIQLKQELIMNSF  194

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTID RG +VHIA G C+TIQ+VTNIIIHGL+IHD
Sbjct  195  KTIDARGYNVHIANGACLTIQFVTNIIIHGLHIHD  229



>ref|XP_010918895.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=451

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +1

Query  142  DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  321
            DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  73   DPELVASEVHMAINNHT-ARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIGFGR  131

Query  322  QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  498
             A+GGRDG+ Y VTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI LKEELIMNSF
Sbjct  132  NAVGGRDGRYYAVTDPGDDDPVNPRPGTLRHAVIQEEPLWIVFKRDMVITLKEELIMNSF  191

Query  499  KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHD  603
            KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHD
Sbjct  192  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHD  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370