BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN016C13

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609997.1|  PREDICTED: cytochrome P450 77A1-like               360   3e-119   Nicotiana tomentosiformis
emb|CAN65790.1|  hypothetical protein VITISV_042049                     354   5e-117   Vitis vinifera
ref|XP_010312564.1|  PREDICTED: cytochrome P450 77A1                    353   8e-117   
ref|XP_006360482.1|  PREDICTED: cytochrome P450 77A1-like               354   9e-117   
ref|XP_009778849.1|  PREDICTED: cytochrome P450 77A1-like isoform X2    353   2e-116   Nicotiana sylvestris
ref|XP_002270736.1|  PREDICTED: cytochrome P450 77A2                    353   2e-116   Vitis vinifera
gb|AGZ83070.1|  CYP77A20                                                352   3e-116   Solanum tuberosum [potatoes]
ref|XP_009778848.1|  PREDICTED: cytochrome P450 77A1-like isoform X1    348   1e-114   Nicotiana sylvestris
sp|P37123.1|C77A1_SOLME  RecName: Full=Cytochrome P450 77A1; AltN...    347   2e-114   Solanum melongena [aubergine]
ref|XP_008231991.1|  PREDICTED: cytochrome P450 77A3-like               348   2e-114   Prunus mume [ume]
ref|XP_009603326.1|  PREDICTED: cytochrome P450 77A2                    347   4e-114   Nicotiana tomentosiformis
ref|XP_011101640.1|  PREDICTED: cytochrome P450 77A2-like               347   5e-114   Sesamum indicum [beniseed]
gb|AJD25187.1|  cytochrome P450 CYP77A27                                344   4e-113   Salvia miltiorrhiza [Chinese salvia]
gb|EYU38068.1|  hypothetical protein MIMGU_mgv1a004860mg                344   6e-113   Erythranthe guttata [common monkey flower]
emb|CDO99869.1|  unnamed protein product                                344   6e-113   Coffea canephora [robusta coffee]
ref|XP_007219021.1|  hypothetical protein PRUPE_ppa004373mg             344   7e-113   Prunus persica
ref|XP_010032101.1|  PREDICTED: cytochrome P450 77A3-like isoform X2    341   1e-112   
ref|XP_009760347.1|  PREDICTED: cytochrome P450 77A2                    341   1e-111   Nicotiana sylvestris
ref|XP_009778850.1|  PREDICTED: cytochrome P450 77A1-like               340   1e-111   Nicotiana sylvestris
ref|XP_004239717.1|  PREDICTED: cytochrome P450 77A2                    340   2e-111   
ref|XP_010032100.1|  PREDICTED: cytochrome P450 77A3-like isoform X1    340   2e-111   Eucalyptus grandis [rose gum]
ref|XP_004307039.1|  PREDICTED: cytochrome P450 77A3-like               341   2e-111   Fragaria vesca subsp. vesca
ref|XP_009610308.1|  PREDICTED: cytochrome P450 77A1-like               338   5e-111   Nicotiana tomentosiformis
ref|XP_009336991.1|  PREDICTED: cytochrome P450 77A3-like               338   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_006345856.1|  PREDICTED: cytochrome P450 77A2-like               338   1e-110   
ref|XP_008345522.1|  PREDICTED: cytochrome P450 77A3-like               338   1e-110   
gb|AGZ83069.1|  CYP77A19                                                338   1e-110   Solanum tuberosum [potatoes]
gb|ADJ57933.1|  cytochrome P450                                         338   2e-110   Solanum torvum [berenjena cimarrona]
ref|XP_008347045.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    337   3e-110   
gb|KHN37844.1|  Cytochrome P450 77A3                                    334   4e-110   Glycine soja [wild soybean]
gb|KHN00917.1|  Cytochrome P450 77A3                                    334   5e-110   Glycine soja [wild soybean]
ref|XP_008375581.1|  PREDICTED: cytochrome P450 77A3-like               335   1e-109   
sp|P37124.1|C77A2_SOLME  RecName: Full=Cytochrome P450 77A2; AltN...    333   7e-109   Solanum melongena [aubergine]
sp|O48928.1|C77A3_SOYBN  RecName: Full=Cytochrome P450 77A3             333   9e-109   Glycine max [soybeans]
ref|XP_003536307.2|  PREDICTED: cytochrome P450 77A3-like               333   2e-108   Glycine max [soybeans]
ref|XP_007143825.1|  hypothetical protein PHAVU_007G104800g             332   2e-108   Phaseolus vulgaris [French bean]
ref|XP_003556278.2|  PREDICTED: cytochrome P450 77A3-like               334   7e-108   
gb|KEH43423.1|  cytochrome P450 family 87 protein                       331   1e-107   Medicago truncatula
ref|XP_007010384.1|  Cytochrome P450 77A3                               330   2e-107   
ref|XP_010552931.1|  PREDICTED: cytochrome P450 77A4                    330   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_010278187.1|  PREDICTED: cytochrome P450 77A2-like               330   3e-107   Nelumbo nucifera [Indian lotus]
ref|XP_011032810.1|  PREDICTED: cytochrome P450 77A3-like               329   4e-107   Populus euphratica
gb|AFK33897.1|  unknown                                                 321   4e-106   Lotus japonicus
ref|XP_002311965.1|  CYP77A3p family protein                            326   7e-106   Populus trichocarpa [western balsam poplar]
gb|KDO46108.1|  hypothetical protein CISIN_1g010526mg                   323   8e-105   Citrus sinensis [apfelsine]
ref|XP_006436671.1|  hypothetical protein CICLE_v10031286mg             323   8e-105   Citrus clementina [clementine]
ref|XP_010464733.1|  PREDICTED: cytochrome P450 77A4-like               323   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006407539.1|  hypothetical protein EUTSA_v10020529mg             323   1e-104   Eutrema salsugineum [saltwater cress]
ref|XP_002882683.1|  CYP77A6                                            322   3e-104   
emb|CDY00955.1|  BnaC05g42450D                                          321   7e-104   
ref|XP_010486669.1|  PREDICTED: cytochrome P450 77A4                    322   8e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010486076.1|  PREDICTED: cytochrome P450 77A4-like               320   9e-104   Camelina sativa [gold-of-pleasure]
emb|CDY08591.1|  BnaA05g28270D                                          319   3e-103   Brassica napus [oilseed rape]
ref|XP_009146826.1|  PREDICTED: cytochrome P450 77A4                    318   5e-103   Brassica rapa
gb|AJD25188.1|  cytochrome P450 CYP77A28                                318   7e-103   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010248417.1|  PREDICTED: cytochrome P450 77A2-like               314   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_006297449.1|  hypothetical protein CARUB_v10013470mg             318   1e-102   Capsella rubella
ref|XP_008456581.1|  PREDICTED: cytochrome P450 77A3-like               317   1e-102   Cucumis melo [Oriental melon]
ref|XP_010452364.1|  PREDICTED: cytochrome P450 77A4-like               317   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_004496181.1|  PREDICTED: cytochrome P450 77A3-like               317   3e-102   Cicer arietinum [garbanzo]
ref|NP_187668.1|  cytochrome P450, family 77, subfamily A, polype...    315   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KJB73379.1|  hypothetical protein B456_011G229800                    315   1e-101   Gossypium raimondii
ref|XP_010490980.1|  PREDICTED: cytochrome P450 77A4                    315   1e-101   Camelina sativa [gold-of-pleasure]
gb|EPS69622.1|  hypothetical protein M569_05145                         313   2e-101   Genlisea aurea
gb|KJB49031.1|  hypothetical protein B456_008G098700                    314   3e-101   Gossypium raimondii
gb|AAO42093.1|  putative cytochrome p450                                314   3e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KDP45018.1|  hypothetical protein JCGZ_01518                         313   7e-101   Jatropha curcas
gb|AAM66094.1|  cytochrom P450-like protein                             312   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423551.1|  PREDICTED: cytochrome P450 77A4-like               313   1e-100   Camelina sativa [gold-of-pleasure]
ref|NP_196086.1|  cytochrome P450, family 77, subfamily A, polype...    312   1e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38447.1|  hypothetical protein AALP_AA3G114600                    324   3e-100   Arabis alpina [alpine rockcress]
ref|XP_002871108.1|  CYP77A4                                            310   9e-100   
ref|XP_006398921.1|  hypothetical protein EUTSA_v10016078mg             310   1e-99    Eutrema salsugineum [saltwater cress]
ref|XP_004140895.1|  PREDICTED: cytochrome P450 77A3-like               308   4e-99    Cucumis sativus [cucumbers]
gb|EPS63295.1|  hypothetical protein M569_11489                         308   6e-99    Genlisea aurea
gb|AFK73721.1|  cytochrome P450                                         304   2e-98    Papaver somniferum
ref|XP_009122576.1|  PREDICTED: cytochrome P450 77A4                    304   2e-97    Brassica rapa
emb|CDX70209.1|  BnaA10g25580D                                          303   2e-97    
ref|XP_004173844.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    304   3e-97    
ref|XP_002871106.1|  CYP77A9                                            302   8e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_006289766.1|  hypothetical protein CARUB_v10003366mg             301   2e-96    
ref|XP_006287416.1|  hypothetical protein CARUB_v10000621mg             299   7e-95    
ref|XP_009130829.1|  PREDICTED: cytochrome P450 77A4                    298   1e-94    Brassica rapa
emb|CDY11297.1|  BnaA03g01330D                                          296   2e-94    Brassica napus [oilseed rape]
ref|XP_010694692.1|  PREDICTED: cytochrome P450 77A2-like               298   2e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_196083.1|  cytochrome P450, family 77, subfamily A, polype...    296   3e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CDX80914.1|  BnaC03g01680D                                          295   6e-94    
ref|XP_002530881.1|  cytochrome P450, putative                          294   1e-93    
ref|XP_010940445.1|  PREDICTED: cytochrome P450 77A2                    293   4e-93    Elaeis guineensis
ref|XP_010110167.1|  Cytochrome P450 77A3                               291   2e-92    Morus notabilis
ref|XP_006407540.1|  hypothetical protein EUTSA_v10022031mg             291   4e-92    Eutrema salsugineum [saltwater cress]
ref|XP_009414952.1|  PREDICTED: cytochrome P450 77A2-like               291   5e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN52206.1|  hypothetical protein Csa_5G615280                       289   1e-91    Cucumis sativus [cucumbers]
ref|XP_009392677.1|  PREDICTED: cytochrome P450 77A2-like               289   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008446777.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    288   4e-91    
ref|XP_008775191.1|  PREDICTED: cytochrome P450 77A2                    286   3e-90    Phoenix dactylifera
emb|CDY44872.1|  BnaC09g50720D                                          284   9e-90    Brassica napus [oilseed rape]
ref|XP_010490979.1|  PREDICTED: cytochrome P450 77A4-like               283   5e-89    Camelina sativa [gold-of-pleasure]
dbj|BAF02252.1|  putative cytochrome P450                               272   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423555.1|  PREDICTED: cytochrome P450 77A4-like               278   3e-87    Camelina sativa [gold-of-pleasure]
gb|KFK24906.1|  hypothetical protein AALP_AA8G040400                    273   3e-86    Arabis alpina [alpine rockcress]
ref|NP_187667.1|  cytochrome P450 protein UNE9                          273   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882682.1|  CYP77A7                                            271   9e-85    
ref|XP_002446399.1|  hypothetical protein SORBIDRAFT_06g015320          265   4e-82    Sorghum bicolor [broomcorn]
gb|AGT16500.1|  hypothetical protein SHCRBa_022_D13_R_80                265   8e-82    Saccharum hybrid cultivar R570
gb|AGT16905.1|  cytochrome P450                                         264   1e-81    Saccharum hybrid cultivar R570
ref|XP_003581190.2|  PREDICTED: cytochrome P450 77A4-like               262   4e-81    Brachypodium distachyon [annual false brome]
emb|CAH66495.1|  H0321H01.4                                             258   3e-79    Oryza sativa [red rice]
ref|NP_001052719.1|  Os04g0407900                                       256   3e-79    
ref|XP_006652247.1|  PREDICTED: cytochrome P450 77A4-like               254   5e-79    
emb|CAE04891.3|  OSJNBa0042I15.13                                       256   8e-79    Oryza sativa Japonica Group [Japonica rice]
gb|ABC68410.1|  cytochrome P450 monooxygenase CYP77A3v2                 244   7e-78    Glycine max [soybeans]
ref|NP_001132177.1|  uncharacterized protein LOC100193602               253   4e-77    
tpg|DAA37962.1|  TPA: putative cytochrome P450 superfamily protein      254   6e-77    
gb|EAZ30650.1|  hypothetical protein OsJ_14702                          233   6e-70    Oryza sativa Japonica Group [Japonica rice]
gb|ABR16500.1|  unknown                                                 217   1e-65    Picea sitchensis
ref|XP_006851629.1|  hypothetical protein AMTR_s00040p00200250          213   3e-62    Amborella trichopoda
ref|XP_009803416.1|  PREDICTED: cytochrome P450 77A3                    207   5e-60    Nicotiana sylvestris
ref|XP_007204450.1|  hypothetical protein PRUPE_ppa026370mg             206   1e-59    Prunus persica
ref|XP_009612631.1|  PREDICTED: cytochrome P450 77A1                    206   1e-59    Nicotiana tomentosiformis
ref|XP_008439972.1|  PREDICTED: cytochrome P450 77A1                    206   2e-59    Cucumis melo [Oriental melon]
ref|XP_007153928.1|  hypothetical protein PHAVU_003G076900g             204   7e-59    Phaseolus vulgaris [French bean]
ref|XP_006858061.1|  hypothetical protein AMTR_s00062p00048540          204   1e-58    
ref|XP_003528678.1|  PREDICTED: cytochrome P450 77A1-like               202   2e-58    Glycine max [soybeans]
ref|XP_004134754.1|  PREDICTED: cytochrome P450 77A1-like               202   4e-58    Cucumis sativus [cucumbers]
ref|XP_004155597.1|  PREDICTED: cytochrome P450 77A1-like               202   4e-58    
ref|XP_010102452.1|  Cytochrome P450 77A3                               201   8e-58    Morus notabilis
ref|XP_004305483.2|  PREDICTED: cytochrome P450 77A4                    201   1e-57    Fragaria vesca subsp. vesca
ref|XP_006348097.1|  PREDICTED: cytochrome P450 77A3-like               200   2e-57    Solanum tuberosum [potatoes]
ref|XP_010276015.1|  PREDICTED: cytochrome P450 77A3                    199   5e-57    Nelumbo nucifera [Indian lotus]
emb|CDP04373.1|  unnamed protein product                                199   5e-57    Coffea canephora [robusta coffee]
ref|XP_010316601.1|  PREDICTED: cytochrome P450 77A1                    199   5e-57    Solanum lycopersicum
gb|EPS68900.1|  hypothetical protein M569_05868                         199   6e-57    Genlisea aurea
ref|XP_010525140.1|  PREDICTED: cytochrome P450 89A2-like               197   1e-56    Tarenaya hassleriana [spider flower]
ref|XP_002265911.1|  PREDICTED: cytochrome P450 77A1                    197   4e-56    Vitis vinifera
emb|CAN68641.1|  hypothetical protein VITISV_030808                     196   4e-56    Vitis vinifera
ref|XP_011037689.1|  PREDICTED: cytochrome P450 77A4-like               196   4e-56    Populus euphratica
ref|XP_004156750.1|  PREDICTED: cytochrome P450 89A2-like               196   5e-56    
ref|XP_011086180.1|  PREDICTED: cytochrome P450 77A3-like               196   7e-56    Sesamum indicum [beniseed]
ref|XP_004235319.1|  PREDICTED: cytochrome P450 89A2-like               196   1e-55    Solanum lycopersicum
ref|XP_006468005.1|  PREDICTED: cytochrome P450 77A3-like               195   1e-55    Citrus sinensis [apfelsine]
gb|KDO75503.1|  hypothetical protein CISIN_1g036686mg                   195   1e-55    Citrus sinensis [apfelsine]
ref|XP_006449061.1|  hypothetical protein CICLE_v10014970mg             195   2e-55    Citrus clementina [clementine]
ref|XP_006657255.1|  PREDICTED: cytochrome P450 77A3-like               195   2e-55    Oryza brachyantha
ref|XP_002305592.1|  cytochrome P450 family protein                     194   2e-55    Populus trichocarpa [western balsam poplar]
ref|XP_010442231.1|  PREDICTED: cytochrome P450 89A2-like               194   2e-55    Camelina sativa [gold-of-pleasure]
ref|XP_002437457.1|  hypothetical protein SORBIDRAFT_10g027430          195   3e-55    Sorghum bicolor [broomcorn]
ref|XP_003610402.1|  Cytochrome P450                                    194   4e-55    Medicago truncatula
ref|XP_010482059.1|  PREDICTED: cytochrome P450 89A2-like               194   6e-55    Camelina sativa [gold-of-pleasure]
ref|XP_004966222.1|  PREDICTED: cytochrome P450 77A3-like               193   8e-55    Setaria italica
ref|XP_010553430.1|  PREDICTED: cytochrome P450 77A3                    193   9e-55    Tarenaya hassleriana [spider flower]
ref|XP_004148114.1|  PREDICTED: cytochrome P450 89A9-like               192   1e-54    
ref|XP_003549954.2|  PREDICTED: cytochrome P450 77A2-like               193   1e-54    
ref|XP_004171811.1|  PREDICTED: cytochrome P450 89A9-like               192   1e-54    
ref|XP_006347571.1|  PREDICTED: cytochrome P450 89A2-like               192   2e-54    Solanum tuberosum [potatoes]
gb|KDP20776.1|  hypothetical protein JCGZ_21247                         192   2e-54    Jatropha curcas
gb|EEE66224.1|  hypothetical protein OsJ_22376                          192   3e-54    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058373.1|  Os06g0680700                                       192   4e-54    
ref|NP_001141481.1|  uncharacterized protein LOC100273592 precursor     191   4e-54    Zea mays [maize]
gb|ACF86457.1|  unknown                                                 191   5e-54    Zea mays [maize]
ref|XP_009622536.1|  PREDICTED: cytochrome P450 89A2-like               191   5e-54    Nicotiana tomentosiformis
ref|XP_002518512.1|  cytochrome P450, putative                          191   6e-54    Ricinus communis
ref|NP_176674.1|  cytochrome P450, family 87, subfamily A, polype...    191   7e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476093.1|  PREDICTED: cytochrome P450 77A3-like               191   7e-54    Camelina sativa [gold-of-pleasure]
ref|XP_010458565.1|  PREDICTED: cytochrome P450 77A3-like               191   8e-54    Camelina sativa [gold-of-pleasure]
ref|XP_006417335.1|  hypothetical protein EUTSA_v10007399mg             190   1e-53    Eutrema salsugineum [saltwater cress]
ref|XP_009128469.1|  PREDICTED: cytochrome P450 89A2-like               190   1e-53    Brassica rapa
ref|XP_010493054.1|  PREDICTED: cytochrome P450 77A3-like               190   1e-53    Camelina sativa [gold-of-pleasure]
gb|EYU33905.1|  hypothetical protein MIMGU_mgv1a004759mg                190   1e-53    Erythranthe guttata [common monkey flower]
ref|XP_008242488.1|  PREDICTED: cytochrome P450 77A3                    190   2e-53    Prunus mume [ume]
gb|KFK24754.1|  hypothetical protein AALP_AA8G020600                    185   2e-53    Arabis alpina [alpine rockcress]
ref|XP_010227164.1|  PREDICTED: cytochrome P450 77A1                    189   2e-53    Brachypodium distachyon [annual false brome]
ref|XP_004171686.1|  PREDICTED: cytochrome P450 89A2-like               189   2e-53    
ref|XP_010528671.1|  PREDICTED: cytochrome P450 89A2-like               189   4e-53    Tarenaya hassleriana [spider flower]
gb|KJB46081.1|  hypothetical protein B456_007G347700                    189   4e-53    Gossypium raimondii
gb|KGN63395.1|  hypothetical protein Csa_2G437050                       187   5e-53    Cucumis sativus [cucumbers]
ref|XP_010665549.1|  PREDICTED: cytochrome P450 77A4                    188   5e-53    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006307273.1|  hypothetical protein CARUB_v10008888mg             188   5e-53    Capsella rubella
emb|CDY56131.1|  BnaA02g20200D                                          187   8e-53    Brassica napus [oilseed rape]
gb|KJB68589.1|  hypothetical protein B456_010G252700                    188   8e-53    Gossypium raimondii
ref|XP_004508228.1|  PREDICTED: uncharacterized protein LOC101501316    193   9e-53    
ref|XP_007026022.1|  Cytochrome P450, family 77, subfamily B, pol...    187   1e-52    Theobroma cacao [chocolate]
gb|KJB46083.1|  hypothetical protein B456_007G347900                    187   1e-52    Gossypium raimondii
gb|KJB18538.1|  hypothetical protein B456_003G058600                    187   2e-52    Gossypium raimondii
ref|NP_172626.1|  cytochrome P450, family 77, subfamily B, polype...    186   3e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553818.1|  PREDICTED: cytochrome P450 89A2-like               187   3e-52    Tarenaya hassleriana [spider flower]
gb|KJB69319.1|  hypothetical protein B456_011G016000                    186   3e-52    Gossypium raimondii
ref|XP_002518513.1|  cytochrome P450, putative                          186   4e-52    Ricinus communis
ref|XP_002970486.1|  hypothetical protein SELMODRAFT_22493              185   4e-52    
ref|NP_178922.1|  putative cytochrome P450                              186   4e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782165.1|  PREDICTED: cytochrome P450 89A2-like               186   5e-52    Nicotiana sylvestris
ref|XP_002970487.1|  hypothetical protein SELMODRAFT_93385              185   7e-52    
ref|XP_004148095.1|  PREDICTED: cytochrome P450 89A2-like               185   8e-52    Cucumis sativus [cucumbers]
ref|XP_002524040.1|  cytochrome P450, putative                          185   1e-51    Ricinus communis
ref|XP_010941087.1|  PREDICTED: cytochrome P450 89A2-like               185   1e-51    Elaeis guineensis
gb|KJB67165.1|  hypothetical protein B456_010G178900                    184   1e-51    Gossypium raimondii
ref|XP_002978564.1|  hypothetical protein SELMODRAFT_108700             184   1e-51    
gb|ADP89483.1|  cytochrome P450 mono-oxygenase superfamily              177   1e-51    Picea mariana [black spruce]
ref|XP_006347570.1|  PREDICTED: cytochrome P450 89A2-like               184   2e-51    Solanum tuberosum [potatoes]
ref|XP_004148112.1|  PREDICTED: cytochrome P450 89A2-like               184   2e-51    
gb|ADP89481.1|  cytochrome P450 mono-oxygenase superfamily              176   2e-51    Picea mariana [black spruce]
ref|XP_006302157.1|  hypothetical protein CARUB_v10020166mg             184   2e-51    Capsella rubella
gb|ADP89490.1|  cytochrome P450 mono-oxygenase superfamily              176   2e-51    Picea glauca
gb|ADP89478.1|  cytochrome P450 mono-oxygenase superfamily              176   3e-51    Picea abies
ref|XP_009118184.1|  PREDICTED: cytochrome P450 77A3                    184   3e-51    Brassica rapa
ref|XP_010931808.1|  PREDICTED: cytochrome P450 77A3                    184   3e-51    Elaeis guineensis
ref|XP_002886780.1|  CYP89A5                                            184   3e-51    
ref|XP_002889880.1|  CYP77B1                                            184   3e-51    Arabidopsis lyrata subsp. lyrata
ref|XP_007029515.1|  Cytochrome P450, family 87, subfamily A, pol...    183   4e-51    
gb|KJB46082.1|  hypothetical protein B456_007G347800                    183   5e-51    Gossypium raimondii
ref|XP_007029747.1|  Cytochrome P450, family 87, subfamily A, pol...    183   5e-51    
ref|XP_011005628.1|  PREDICTED: cytochrome P450 89A2-like               183   6e-51    Populus euphratica
ref|XP_002306325.1|  hypothetical protein POPTR_0005s08140g             183   6e-51    
gb|ADP89484.1|  cytochrome P450 mono-oxygenase superfamily              175   8e-51    Picea omorika
ref|NP_176675.1|  cytochrome P450, family 89, subfamily A, polype...    182   8e-51    Arabidopsis thaliana [mouse-ear cress]
gb|AAK96572.1|  At1g64950/F13O11_25                                     182   8e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419167.1|  hypothetical protein EUTSA_v10002491mg             182   9e-51    
ref|XP_006662509.1|  PREDICTED: cytochrome P450 89A2-like               181   9e-51    
gb|EAY79193.1|  hypothetical protein OsI_34305                          182   1e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_010101456.1|  Cytochrome P450 77A3                               182   1e-50    
ref|XP_011086181.1|  PREDICTED: cytochrome P450 77A3-like               182   1e-50    Sesamum indicum [beniseed]
ref|XP_007029748.1|  Cytochrome P450, family 87, subfamily A, pol...    182   1e-50    
ref|XP_010445937.1|  PREDICTED: cytochrome P450 89A2-like               184   1e-50    
ref|XP_002268331.1|  PREDICTED: cytochrome P450 89A2                    182   2e-50    Vitis vinifera
ref|XP_011005629.1|  PREDICTED: cytochrome P450 89A2-like               182   2e-50    Populus euphratica
gb|EMS64564.1|  Cytochrome P450 89A2                                    181   2e-50    Triticum urartu
ref|XP_008459160.1|  PREDICTED: cytochrome P450 89A2-like               182   2e-50    Cucumis melo [Oriental melon]
ref|XP_008797233.1|  PREDICTED: cytochrome P450 89A2-like               181   2e-50    Phoenix dactylifera
ref|XP_009108016.1|  PREDICTED: cytochrome P450 89A2-like               181   2e-50    Brassica rapa
ref|XP_008459270.1|  PREDICTED: cytochrome P450 89A2-like               181   3e-50    Cucumis melo [Oriental melon]
gb|KDP20777.1|  hypothetical protein JCGZ_21248                         181   3e-50    Jatropha curcas
ref|XP_011015670.1|  PREDICTED: cytochrome P450 89A2-like               181   3e-50    Populus euphratica
gb|KHN42995.1|  Cytochrome P450 89A2                                    177   3e-50    Glycine soja [wild soybean]
gb|KFK33248.1|  hypothetical protein AALP_AA6G350000                    181   3e-50    Arabis alpina [alpine rockcress]
ref|XP_008812264.1|  PREDICTED: cytochrome P450 77A3-like               181   3e-50    Phoenix dactylifera
ref|XP_002466942.1|  hypothetical protein SORBIDRAFT_01g017160          181   4e-50    Sorghum bicolor [broomcorn]
ref|XP_010439394.1|  PREDICTED: cytochrome P450 89A2-like               181   4e-50    Camelina sativa [gold-of-pleasure]
dbj|BAK06611.1|  predicted protein                                      181   4e-50    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY34640.1|  BnaC08g41990D                                          181   4e-50    Brassica napus [oilseed rape]
ref|XP_011037690.1|  PREDICTED: cytochrome P450 77A1-like               181   5e-50    Populus euphratica
ref|NP_001065051.1|  Os10g0513900                                       181   5e-50    
ref|XP_009412014.1|  PREDICTED: cytochrome P450 77A3-like               180   6e-50    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003574176.1|  PREDICTED: cytochrome P450 89A2-like               180   6e-50    Brachypodium distachyon [annual false brome]
ref|XP_008784547.1|  PREDICTED: cytochrome P450 77A3-like               180   7e-50    Phoenix dactylifera
gb|KFK31941.1|  hypothetical protein AALP_AA6G179900                    180   8e-50    Arabis alpina [alpine rockcress]
ref|NP_001057534.1|  Os06g0328900                                       174   9e-50    
gb|ADP89482.1|  cytochrome P450 mono-oxygenase superfamily              172   1e-49    Picea mariana [black spruce]
ref|XP_009603616.1|  PREDICTED: cytochrome P450 89A2-like               180   1e-49    Nicotiana tomentosiformis
gb|EAY79198.1|  hypothetical protein OsI_34310                          179   1e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_004235317.1|  PREDICTED: cytochrome P450 89A2-like               179   1e-49    Solanum lycopersicum
ref|XP_009110714.1|  PREDICTED: cytochrome P450 77A3-like               179   1e-49    Brassica rapa
emb|CAN77554.1|  hypothetical protein VITISV_039372                     179   1e-49    Vitis vinifera
ref|XP_004148097.1|  PREDICTED: cytochrome P450 89A2-like               179   1e-49    Cucumis sativus [cucumbers]
ref|XP_002266269.2|  PREDICTED: cytochrome P450 89A2-like               180   1e-49    Vitis vinifera
ref|XP_002466943.1|  hypothetical protein SORBIDRAFT_01g017170          179   1e-49    Sorghum bicolor [broomcorn]
ref|XP_009393330.1|  PREDICTED: cytochrome P450 77A3-like               179   1e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982612.1|  PREDICTED: cytochrome P450 89A2-like               179   1e-49    Setaria italica
ref|XP_002524036.1|  cytochrome P450, putative                          179   2e-49    
ref|XP_010276939.1|  PREDICTED: cytochrome P450 89A2-like               179   2e-49    Nelumbo nucifera [Indian lotus]
ref|XP_004151744.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    179   2e-49    
ref|XP_004169992.1|  PREDICTED: cytochrome P450 89A2-like               179   2e-49    
ref|XP_006662510.1|  PREDICTED: cytochrome P450 89A2-like               179   2e-49    Oryza brachyantha
gb|KJB26702.1|  hypothetical protein B456_004G255300                    179   2e-49    Gossypium raimondii
gb|KCW45181.1|  hypothetical protein EUGRSUZ_L011822                    172   2e-49    Eucalyptus grandis [rose gum]
ref|XP_010662054.1|  PREDICTED: cytochrome P450 89A2-like               179   2e-49    Vitis vinifera
ref|XP_009370410.1|  PREDICTED: cytochrome P450 77A1-like               179   2e-49    Pyrus x bretschneideri [bai li]
ref|XP_008459156.1|  PREDICTED: cytochrome P450 89A2-like               179   2e-49    Cucumis melo [Oriental melon]
ref|XP_009363721.1|  PREDICTED: cytochrome P450 77A1-like               179   3e-49    Pyrus x bretschneideri [bai li]
ref|XP_004962930.1|  PREDICTED: cytochrome P450 89A2-like               178   3e-49    Setaria italica
ref|XP_002309993.2|  hypothetical protein POPTR_0007s05960g             178   3e-49    
ref|XP_004156751.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    178   3e-49    
ref|XP_002524041.1|  cytochrome P450, putative                          178   3e-49    Ricinus communis
ref|XP_006380442.1|  hypothetical protein POPTR_0007s059451g            173   3e-49    
ref|XP_006662172.1|  PREDICTED: cytochrome P450 89A2-like               179   3e-49    Oryza brachyantha
gb|ACG47544.1|  transposon protein                                      178   4e-49    Zea mays [maize]
ref|XP_002304925.2|  hypothetical protein POPTR_0004s01860g             178   4e-49    Populus trichocarpa [western balsam poplar]
ref|XP_010934620.1|  PREDICTED: cytochrome P450 89A2-like               178   4e-49    Elaeis guineensis
emb|CDY65266.1|  BnaCnng46310D                                          171   4e-49    Brassica napus [oilseed rape]
emb|CAN77555.1|  hypothetical protein VITISV_039373                     178   4e-49    Vitis vinifera
ref|XP_003529424.1|  PREDICTED: cytochrome P450 89A2-like               177   5e-49    
gb|ACL53147.1|  unknown                                                 174   5e-49    
gb|AAG13506.1|AC068924_11  putative cytochrome P450                     177   5e-49    
emb|CDY64815.1|  BnaA08g31590D                                          177   6e-49    
ref|XP_006301252.1|  hypothetical protein CARUB_v10021652mg             177   6e-49    
gb|EMT00202.1|  Cytochrome P450 89A2                                    175   6e-49    
ref|XP_002524035.1|  cytochrome P450, putative                          177   6e-49    
ref|XP_011016836.1|  PREDICTED: cytochrome P450 89A2-like               173   7e-49    
ref|XP_010052825.1|  PREDICTED: cytochrome P450 77A2                    177   7e-49    
ref|XP_007029722.1|  Cytochrome P450, family 87, subfamily A, pol...    177   8e-49    
ref|XP_009362723.1|  PREDICTED: cytochrome P450 77A3-like               177   1e-48    
ref|XP_002524034.1|  cytochrome P450, putative                          177   1e-48    
ref|XP_011086179.1|  PREDICTED: cytochrome P450 77A3-like               177   1e-48    
ref|XP_006661954.1|  PREDICTED: cytochrome P450 89A2-like               177   1e-48    
emb|CDY66574.1|  BnaCnng51480D                                          176   2e-48    
gb|KDP39557.1|  hypothetical protein JCGZ_02577                         176   2e-48    
ref|XP_011044422.1|  PREDICTED: cytochrome P450 89A2-like               176   2e-48    
ref|XP_006302158.1|  hypothetical protein CARUB_v10020167mg             176   2e-48    
ref|XP_011013715.1|  PREDICTED: cytochrome P450 89A2-like               176   2e-48    
ref|XP_006661955.1|  PREDICTED: cytochrome P450 89A2-like               172   3e-48    
ref|XP_010266363.1|  PREDICTED: cytochrome P450 89A2-like               176   3e-48    
ref|XP_007029749.1|  Cytochrome P450, family 87, subfamily A, pol...    176   3e-48    
ref|XP_010276940.1|  PREDICTED: cytochrome P450 89A2-like               176   3e-48    
ref|XP_006437392.1|  hypothetical protein CICLE_v10033851mg             175   4e-48    
ref|XP_009382325.1|  PREDICTED: cytochrome P450 89A2-like               176   4e-48    
gb|KDP21787.1|  hypothetical protein JCGZ_00574                         175   5e-48    
ref|XP_002524037.1|  cytochrome P450, putative                          175   6e-48    
dbj|BAJ93808.1|  predicted protein                                      174   6e-48    
gb|AAY78666.1|  putative cytochrome P450                                175   6e-48    
ref|XP_010941086.1|  PREDICTED: cytochrome P450 89A2-like               175   7e-48    
ref|XP_010672161.1|  PREDICTED: cytochrome P450 89A2-like               175   7e-48    
gb|KHN08060.1|  Cytochrome P450 89A2                                    170   7e-48    
gb|EEE51265.1|  hypothetical protein OsJ_32150                          174   8e-48    
ref|NP_176673.1|  cytochrome P450, family 87, subfamily A, polype...    174   8e-48    
dbj|BAJ94552.1|  predicted protein                                      174   8e-48    
ref|XP_010040475.1|  PREDICTED: cytochrome P450 89A2-like               174   9e-48    
ref|XP_006484712.1|  PREDICTED: cytochrome P450 89A2-like               174   9e-48    
gb|KDO42607.1|  hypothetical protein CISIN_1g010248mg                   174   9e-48    
ref|NP_001061003.1|  Os08g0152400                                       174   1e-47    
ref|XP_004241332.1|  PREDICTED: cytochrome P450 89A2-like               174   1e-47    
gb|EAZ36847.1|  hypothetical protein OsJ_21188                          173   1e-47    
gb|AAG13525.1|AC068924_30  putative cytochrome P450                     174   1e-47    
ref|XP_008800986.1|  PREDICTED: cytochrome P450 89A2-like               174   1e-47    
gb|EAZ05607.1|  hypothetical protein OsI_27825                          174   1e-47    
gb|EAZ00761.1|  hypothetical protein OsI_22787                          174   1e-47    
dbj|BAD33291.1|  putative cytochrome P450                               174   1e-47    
ref|XP_008459157.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    174   1e-47    
ref|XP_006484709.1|  PREDICTED: cytochrome P450 89A2-like               174   2e-47    
ref|XP_006437395.1|  hypothetical protein CICLE_v10033803mg             174   2e-47    
ref|XP_006388469.1|  hypothetical protein POPTR_0177s00210g             174   2e-47    
gb|KCW58465.1|  hypothetical protein EUGRSUZ_H011461                    169   2e-47    
gb|KDO39082.1|  hypothetical protein CISIN_1g037361mg                   174   2e-47    
ref|NP_001065059.1|  Os10g0515900                                       174   2e-47    
gb|EEE68050.1|  hypothetical protein OsJ_26050                          173   2e-47    
ref|XP_006659834.1|  PREDICTED: cytochrome P450 89A2-like               171   2e-47    
ref|XP_006380437.1|  hypothetical protein POPTR_0007s05920g             173   2e-47    
gb|KJB80554.1|  hypothetical protein B456_013G103400                    174   2e-47    
ref|XP_010026130.1|  PREDICTED: cytochrome P450 89A2-like               173   2e-47    
ref|XP_010934624.1|  PREDICTED: cytochrome P450 89A2-like               174   2e-47    
ref|XP_006361087.1|  PREDICTED: cytochrome P450 89A2-like               173   2e-47    
ref|NP_001147503.1|  transposon protein precursor                       174   2e-47    
ref|XP_011005627.1|  PREDICTED: cytochrome P450 89A2-like               173   3e-47    
ref|XP_007029752.1|  Cytochrome P450 89A2                               174   3e-47    
ref|NP_001146067.1|  uncharacterized protein LOC100279598               173   3e-47    
gb|EAY79195.1|  hypothetical protein OsI_34307                          173   3e-47    
gb|EEC77234.1|  hypothetical protein OsI_15784                          165   4e-47    
gb|EMS57097.1|  Cytochrome P450 89A2                                    173   4e-47    
ref|XP_010934623.1|  PREDICTED: cytochrome P450 89A2-like               172   4e-47    
ref|XP_010934622.1|  PREDICTED: cytochrome P450 89A2-like               172   4e-47    
ref|XP_008797231.1|  PREDICTED: cytochrome P450 89A2-like               172   6e-47    
ref|XP_002456895.1|  hypothetical protein SORBIDRAFT_03g044800          172   7e-47    
ref|XP_008379819.1|  PREDICTED: cytochrome P450 89A2-like               172   8e-47    
gb|EAY79199.1|  hypothetical protein OsI_34311                          172   9e-47    
emb|CDP18187.1|  unnamed protein product                                172   9e-47    
ref|XP_006388468.1|  hypothetical protein POPTR_0177s00200g             168   9e-47    
gb|KCW44075.1|  hypothetical protein EUGRSUZ_L025191                    171   1e-46    
ref|XP_009407856.1|  PREDICTED: cytochrome P450 89A2-like               171   1e-46    
ref|XP_002531491.1|  cytochrome P450, putative                          166   1e-46    
ref|XP_002466944.1|  hypothetical protein SORBIDRAFT_01g017180          171   2e-46    
gb|KHN46492.1|  Cytochrome P450 89A2                                    168   2e-46    
ref|XP_008437556.1|  PREDICTED: cytochrome P450 89A2-like               171   2e-46    
ref|XP_004148096.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    170   2e-46    
gb|EMS53275.1|  Cytochrome P450 89A2                                    172   2e-46    
gb|KDO42609.1|  hypothetical protein CISIN_1g008732mg                   171   2e-46    
ref|XP_004956576.1|  PREDICTED: cytochrome P450 89A2-like               171   3e-46    
ref|XP_008375760.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    171   3e-46    
ref|XP_010680105.1|  PREDICTED: cytochrome P450 89A2-like               170   3e-46    
ref|XP_003556183.1|  PREDICTED: cytochrome P450 89A2-like               170   3e-46    
ref|XP_010069931.1|  PREDICTED: cytochrome P450 89A2-like               170   3e-46    
ref|XP_010026131.1|  PREDICTED: cytochrome P450 89A2-like               170   4e-46    
gb|AAB67854.1|  cytochrome P450                                         170   4e-46    
ref|XP_004959779.1|  PREDICTED: cytochrome P450 89A2-like               170   4e-46    
gb|EMT18060.1|  Cytochrome P450 89A2                                    165   4e-46    
dbj|BAB89608.1|  putative cytochrome P450                               170   5e-46    
gb|KCW58461.1|  hypothetical protein EUGRSUZ_H01144                     169   5e-46    
gb|KJB80555.1|  hypothetical protein B456_013G103500                    169   5e-46    
ref|XP_002319773.2|  Cytochrome P450 89A2 family protein                170   5e-46    
gb|EAY73941.1|  hypothetical protein OsI_01826                          170   5e-46    
ref|XP_010680926.1|  PREDICTED: cytochrome P450 89A2-like               169   6e-46    
ref|XP_007131475.1|  hypothetical protein PHAVU_011G016700g             169   6e-46    
gb|AAP54608.2|  Cytochrome P450 family protein                          168   6e-46    
gb|EEC67308.1|  hypothetical protein OsI_34309                          169   7e-46    
ref|XP_002464772.1|  hypothetical protein SORBIDRAFT_01g026530          169   7e-46    
ref|XP_010662052.1|  PREDICTED: cytochrome P450 89A2                    169   8e-46    
gb|ABC68408.1|  cytochrome P450 monooxygenase CYP89H3                   166   8e-46    
emb|CAN69345.1|  hypothetical protein VITISV_006018                     169   9e-46    
dbj|BAK07729.1|  predicted protein                                      169   1e-45    
dbj|BAJ91738.1|  predicted protein                                      169   1e-45    
ref|XP_010558680.1|  PREDICTED: cytochrome P450 89A9                    169   1e-45    
dbj|BAK03964.1|  predicted protein                                      169   1e-45    
ref|XP_010026134.1|  PREDICTED: cytochrome P450 89A2-like               167   1e-45    
ref|XP_011085115.1|  PREDICTED: cytochrome P450 89A2-like               169   2e-45    
ref|XP_008367238.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    169   2e-45    
ref|XP_002265797.1|  PREDICTED: cytochrome P450 89A2-like               168   2e-45    
ref|XP_007029750.1|  Cytochrome P450, family 87, subfamily A, pol...    168   2e-45    
ref|XP_008656896.1|  PREDICTED: cytochrome P450 89A2-like               168   2e-45    
gb|EMT28306.1|  Cytochrome P450 89A2                                    163   2e-45    
ref|XP_006851423.1|  hypothetical protein AMTR_s00040p00085270          168   2e-45    
ref|NP_001065058.2|  Os10g0515400                                       166   2e-45    
gb|EEE51266.1|  hypothetical protein OsJ_32153                          168   2e-45    
ref|XP_008644885.1|  PREDICTED: cytochrome P450 89A2-like               168   2e-45    
ref|XP_009385971.1|  PREDICTED: cytochrome P450 89A2-like               169   2e-45    
gb|KHN08058.1|  Cytochrome P450 89A2                                    167   2e-45    
ref|XP_011028246.1|  PREDICTED: cytochrome P450 89A2-like               168   2e-45    
ref|XP_003571489.1|  PREDICTED: cytochrome P450 89A2                    168   2e-45    
emb|CAN64477.1|  hypothetical protein VITISV_017161                     168   2e-45    
ref|XP_009340043.1|  PREDICTED: cytochrome P450 89A2-like               168   2e-45    
ref|NP_001065056.1|  Os10g0515200                                       168   2e-45    
ref|XP_003556196.1|  PREDICTED: cytochrome P450 89A2                    168   2e-45    
gb|EMT17172.1|  Cytochrome P450 89A2                                    167   3e-45    
ref|XP_010026135.1|  PREDICTED: cytochrome P450 89A2-like               167   3e-45    
ref|XP_010941433.1|  PREDICTED: cytochrome P450 89A2-like               168   3e-45    
ref|XP_010040474.1|  PREDICTED: cytochrome P450 89A2-like               168   3e-45    
ref|XP_011044421.1|  PREDICTED: cytochrome P450 89A2-like               167   3e-45    
gb|AAG13517.1|AC068924_22  putative cytochrome P450                     167   3e-45    
ref|XP_003628670.1|  Cytochrome P450                                    167   3e-45    
gb|EAZ15260.1|  hypothetical protein OsJ_30679                          167   4e-45    
ref|XP_010662058.1|  PREDICTED: cytochrome P450 89A2-like               167   4e-45    
ref|XP_003540011.2|  PREDICTED: cytochrome P450 89A9-like               167   5e-45    
ref|NP_001064139.1|  Os10g0139700                                       167   5e-45    
gb|EMS51260.1|  Cytochrome P450 89A2                                    164   5e-45    
gb|EEC82910.1|  hypothetical protein OsI_27824                          166   6e-45    
dbj|BAC65384.1|  putative cytochrome P450                               166   7e-45    
ref|XP_002463066.1|  hypothetical protein SORBIDRAFT_02g037140          167   7e-45    
ref|XP_009609017.1|  PREDICTED: cytochrome P450 89A2-like               167   7e-45    
ref|XP_010069928.1|  PREDICTED: cytochrome P450 89A2-like               167   7e-45    
gb|AAP54612.2|  transposon protein, putative, unclassified              167   8e-45    
gb|EEC66552.1|  hypothetical protein OsI_32710                          167   8e-45    
ref|XP_002466945.1|  hypothetical protein SORBIDRAFT_01g017190          167   8e-45    
ref|XP_009340042.1|  PREDICTED: cytochrome P450 89A2-like               166   8e-45    
gb|ADP89487.1|  cytochrome P450 mono-oxygenase superfamily              159   8e-45    
ref|XP_006433962.1|  hypothetical protein CICLE_v10003406mg             163   8e-45    
ref|XP_002319775.1|  Cytochrome P450 89A2 family protein                166   9e-45    
ref|XP_003556213.1|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
ref|XP_002303473.2|  hypothetical protein POPTR_0003s10370g             166   1e-44    
gb|KCW58444.1|  hypothetical protein EUGRSUZ_H01122                     166   1e-44    
ref|XP_004503696.1|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
ref|XP_010069932.1|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
ref|XP_004298097.2|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
gb|KCW58443.1|  hypothetical protein EUGRSUZ_H01121                     165   1e-44    
ref|XP_004986722.1|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
ref|XP_004300130.1|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
ref|XP_008374073.1|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
ref|XP_004982617.1|  PREDICTED: cytochrome P450 89A2-like               166   1e-44    
ref|XP_003593333.1|  Cytochrome P450 monooxygenase CYP89A28             166   1e-44    
emb|CDY52965.1|  BnaCnng23930D                                          166   1e-44    
ref|XP_006365724.1|  PREDICTED: cytochrome P450 89A9-like               165   2e-44    
ref|XP_007208889.1|  hypothetical protein PRUPE_ppa026664mg             166   2e-44    
dbj|BAJ94327.1|  predicted protein                                      166   2e-44    
ref|XP_010026125.1|  PREDICTED: cytochrome P450 89A2-like               165   2e-44    
gb|KHN11812.1|  Cytochrome P450 89A2                                    163   2e-44    
ref|XP_007219018.1|  hypothetical protein PRUPE_ppa004356mg             166   2e-44    
ref|XP_002520014.1|  cytochrome P450, putative                          166   2e-44    
ref|XP_010919362.1|  PREDICTED: cytochrome P450 89A2-like               165   2e-44    
ref|XP_006828882.1|  hypothetical protein AMTR_s00001p00181860          165   2e-44    
ref|XP_007029732.1|  Cytochrome P450                                    165   2e-44    
ref|XP_006388472.1|  hypothetical protein POPTR_0177s002201g            157   2e-44    
gb|AAG13498.1|AC068924_3  putative cytochrome P450                      166   2e-44    
ref|XP_002266528.2|  PREDICTED: cytochrome P450 89A2-like isoform X2    165   2e-44    
gb|KCW58445.1|  hypothetical protein EUGRSUZ_H01123                     166   3e-44    
ref|XP_010042755.1|  PREDICTED: cytochrome P450 89A2-like               165   3e-44    
ref|XP_010026126.1|  PREDICTED: cytochrome P450 89A2-like               165   3e-44    
ref|XP_010069929.1|  PREDICTED: cytochrome P450 89A2-like               165   3e-44    
ref|XP_002447302.1|  hypothetical protein SORBIDRAFT_06g032390          165   3e-44    
gb|KCW58467.1|  hypothetical protein EUGRSUZ_H01148                     164   4e-44    
ref|XP_004512444.1|  PREDICTED: cytochrome P450 89A2-like               164   4e-44    
gb|KCW58463.1|  hypothetical protein EUGRSUZ_H011451                    159   5e-44    
dbj|BAK07365.1|  predicted protein                                      164   6e-44    
ref|XP_002524042.1|  cytochrome P450, putative                          164   6e-44    
ref|XP_003612570.1|  Cytochrome P450 89A2                               164   7e-44    
ref|XP_004982618.1|  PREDICTED: cytochrome P450 89A2-like               164   8e-44    
ref|XP_006361088.1|  PREDICTED: cytochrome P450 89A2-like               164   8e-44    
ref|XP_004145912.1|  PREDICTED: cytochrome P450 89A2-like               164   8e-44    
gb|KCW58456.1|  hypothetical protein EUGRSUZ_H01138                     163   9e-44    
gb|KFK23793.1|  hypothetical protein AALP_AAs64732U000200               163   9e-44    
ref|XP_010276945.1|  PREDICTED: cytochrome P450 89A2-like               164   9e-44    
ref|XP_008679798.1|  PREDICTED: putative cytochrome P450 superfam...    164   9e-44    
gb|EAY79200.1|  hypothetical protein OsI_34312                          164   1e-43    
gb|EMT23451.1|  Cytochrome P450 89A2                                    163   1e-43    
ref|XP_010069933.1|  PREDICTED: cytochrome P450 89A2-like               163   1e-43    
ref|NP_001132060.1|  putative cytochrome P450 superfamily protein       163   1e-43    
emb|CDP14026.1|  unnamed protein product                                164   1e-43    
ref|XP_010069936.1|  PREDICTED: cytochrome P450 89A2-like               164   1e-43    
ref|XP_008234459.1|  PREDICTED: cytochrome P450 89A2-like               163   1e-43    
ref|XP_010069927.1|  PREDICTED: cytochrome P450 89A2-like               163   1e-43    
ref|XP_007219004.1|  hypothetical protein PRUPE_ppa004199mg             163   1e-43    
gb|AEM43006.1|  cytochrome P450                                         163   1e-43    
ref|XP_006437396.1|  hypothetical protein CICLE_v10031193mg             163   1e-43    
ref|XP_009340064.1|  PREDICTED: cytochrome P450 89A2-like               162   2e-43    
ref|XP_004309202.2|  PREDICTED: cytochrome P450 89A2-like isoform X2    162   2e-43    
ref|XP_011470351.1|  PREDICTED: cytochrome P450 89A2-like isoform X1    162   3e-43    
gb|KGN49900.1|  hypothetical protein Csa_5G139780                       162   3e-43    
ref|XP_006484708.1|  PREDICTED: cytochrome P450 89A2-like               162   3e-43    
gb|KCW58452.1|  hypothetical protein EUGRSUZ_H01131                     162   3e-43    
ref|XP_010087442.1|  Cytochrome P450 89A2                               162   3e-43    
ref|XP_010069934.1|  PREDICTED: cytochrome P450 89A2-like               162   3e-43    
ref|XP_004972788.1|  PREDICTED: cytochrome P450 89A2-like               162   3e-43    
ref|XP_004295152.1|  PREDICTED: cytochrome P450 89A2-like               162   3e-43    
ref|XP_006588311.1|  PREDICTED: cytochrome P450 89A2-like               162   3e-43    
ref|XP_003579360.1|  PREDICTED: cytochrome P450 89A2-like               162   3e-43    
ref|XP_006437391.1|  hypothetical protein CICLE_v10031236mg             162   4e-43    



>ref|XP_009609997.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana tomentosiformis]
Length=501

 Score =   360 bits (923),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+V EVRKQQIET+VPLIE+RRRA++NPGSDK+AA+FSYLDTLF++ VEGRKS PTN 
Sbjct  233  QRKKVQEVRKQQIETLVPLIEKRRRAVQNPGSDKTAASFSYLDTLFEVKVEGRKSGPTNP  292

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ ++YEEI+S VGDRKVDEKD +KMP
Sbjct  293  ELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQKRMYEEIRSTVGDRKVDEKDMEKMP  352

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIP D  VEFF  AIS DP +WSDPEK
Sbjct  353  YLNAVVKELLRKHPPTYFVLTHAVTEPVKLGGYDIPTDANVEFFSHAISHDPKIWSDPEK  412

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG EDADITGVT VKMMPFG
Sbjct  413  FDPDRFLSGREDADITGVTKVKMMPFG  439



>emb|CAN65790.1| hypothetical protein VITISV_042049 [Vitis vinifera]
Length=515

 Score =   354 bits (909),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK   EVRK+QI+T+VP IERRR ALENPGSDK+AA+FSYLDT+FDL +EGRKSSPTN 
Sbjct  247  QRKAATEVRKRQIKTVVPFIERRRAALENPGSDKTAASFSYLDTIFDLKIEGRKSSPTNP  306

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TA+EWAIAR+IENP IQSKLYEEIK+ VGDRKV EKD +KMP
Sbjct  307  ELVTLCSEFLNGGTDTTGTAVEWAIARMIENPEIQSKLYEEIKTTVGDRKVQEKDMEKMP  366

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAV KELLRKHPPT+F+LTHAVT+P KL GYDIP D  VEFFLP IS+DP LW +PEK
Sbjct  367  YLNAVSKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTDANVEFFLPPISEDPKLWKNPEK  426

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFL GGEDADITGVT VKMMPFG
Sbjct  427  FDPDRFLLGGEDADITGVTGVKMMPFG  453



>ref|XP_010312564.1| PREDICTED: cytochrome P450 77A1 [Solanum lycopersicum]
Length=503

 Score =   353 bits (907),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV +VRK+QIET+VPLIE+RRR L+NPGSDK+A +FSYLDTLFD+ +EGRKS PTNA
Sbjct  235  QRKRVNDVRKRQIETLVPLIEKRRRVLQNPGSDKTATSFSYLDTLFDVKIEGRKSGPTNA  294

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ K+Y+EIK+VVGD+KVDE D +KMP
Sbjct  295  ELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQEKIYKEIKTVVGDKKVDENDIEKMP  354

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAV+KELLRKHPPT+F LTH VT+P KLGGYDIPMD  VEFF+  IS DP +WSDP+K
Sbjct  355  YLNAVIKELLRKHPPTYFTLTHTVTEPVKLGGYDIPMDTNVEFFVHGISHDPNIWSDPDK  414

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG EDADITGV AVKMMPFG
Sbjct  415  FDPDRFLSGREDADITGVKAVKMMPFG  441



>ref|XP_006360482.1| PREDICTED: cytochrome P450 77A1-like [Solanum tuberosum]
Length=511

 Score =   354 bits (908),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QR+RV +VRK+QIET+VPLIE+RR  ++NPGSDK+AA+FSYLDTLFD+ +EGRKS PTN 
Sbjct  243  QRQRVNDVRKRQIETLVPLIEKRRSVVQNPGSDKTAASFSYLDTLFDVKIEGRKSGPTNP  302

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ K+YEEIK+VVGD+KVDE DT+KMP
Sbjct  303  ELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQEKMYEEIKTVVGDKKVDENDTEKMP  362

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIPMD  VEFF+  IS DP +WSDPEK
Sbjct  363  YLNAVVKELLRKHPPTYFTLTHAVTEPVKLGGYDIPMDTNVEFFVYGISHDPNIWSDPEK  422

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG EDADITGV AVKMMPFG
Sbjct  423  FDPDRFLSGREDADITGVKAVKMMPFG  449



>ref|XP_009778849.1| PREDICTED: cytochrome P450 77A1-like isoform X2 [Nicotiana sylvestris]
Length=501

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV EVRKQQIET+VPLIE+RRRA++NPGSDK++A+FSYLDTLFD+ +EG+KS PT+ 
Sbjct  233  QRKRVQEVRKQQIETLVPLIEKRRRAMQNPGSDKTSASFSYLDTLFDVKIEGKKSGPTDP  292

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EWA+ RLIENP IQ ++YEEI + VGDRKVDEKD +KMP
Sbjct  293  ELVTLCSEFLNGGTDTTATALEWAVGRLIENPSIQKRMYEEIINTVGDRKVDEKDIEKMP  352

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIP D  VEFF   IS DP +WSDPEK
Sbjct  353  YLNAVVKELLRKHPPTYFVLTHAVTEPVKLGGYDIPTDASVEFFSHGISHDPNIWSDPEK  412

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG EDADITGVT VKMMPFG
Sbjct  413  FDPDRFLSGREDADITGVTKVKMMPFG  439



>ref|XP_002270736.1| PREDICTED: cytochrome P450 77A2 [Vitis vinifera]
 emb|CBI40213.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK   EVRK+QI+T+VP IERRR ALENPGSDK+AA+FSYLDT+FDL +EGRKSSPTN 
Sbjct  247  QRKAATEVRKRQIKTVVPFIERRRAALENPGSDKTAASFSYLDTIFDLKIEGRKSSPTNP  306

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TA+EWAIAR+IENP IQSKLYEEIK+ VGDRKV EKD +KMP
Sbjct  307  ELVTLCSEFLNGGTDTTGTAVEWAIARMIENPEIQSKLYEEIKTTVGDRKVQEKDMEKMP  366

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAV KELLRKHPPT+F+LTHAVT+P KL GYDIP D  VEFFLP IS+DP LW +PEK
Sbjct  367  YLNAVSKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTDANVEFFLPPISEDPKLWKNPEK  426

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  GGEDADITGVT VKMMPFG
Sbjct  427  FDPDRFFLGGEDADITGVTGVKMMPFG  453



>gb|AGZ83070.1| CYP77A20 [Solanum tuberosum]
Length=503

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QR+RV +VRK+QIET+VPLIE+RR  ++NPGSDK+AA+FSYLDTLFD+ +EGRKS PTN 
Sbjct  235  QRQRVNDVRKRQIETLVPLIEKRRSVVQNPGSDKTAASFSYLDTLFDVKIEGRKSGPTNP  294

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EWAI RLIENP IQ K+YEEIK+VVGD+KVDE DT+KMP
Sbjct  295  ELVTLCSEFLNGGTDTTATALEWAIGRLIENPSIQEKMYEEIKTVVGDKKVDENDTEKMP  354

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIPMD  VEFF+  IS DP +WSDPEK
Sbjct  355  YLNAVVKELLRKHPPTYFTLTHAVTEPVKLGGYDIPMDTNVEFFVYGISHDPNIWSDPEK  414

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG EDADI GV AVKMMPFG
Sbjct  415  FDPDRFLSGREDADIMGVKAVKMMPFG  441



>ref|XP_009778848.1| PREDICTED: cytochrome P450 77A1-like isoform X1 [Nicotiana sylvestris]
Length=502

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVE-GRKSSPTN  177
            QRKRV EVRKQQIET+VPLIE+RRRA++NPGSDK++A+FSYLDTLFD+ +E G+KS PT+
Sbjct  233  QRKRVQEVRKQQIETLVPLIEKRRRAMQNPGSDKTSASFSYLDTLFDVKIEAGKKSGPTD  292

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             ELVTL SEFLNGGTDTTATA+EWA+ RLIENP IQ ++YEEI + VGDRKVDEKD +KM
Sbjct  293  PELVTLCSEFLNGGTDTTATALEWAVGRLIENPSIQKRMYEEIINTVGDRKVDEKDIEKM  352

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            PYLNAVVKELLRKHPPT+F LTHAVT+P KLGGYDIP D  VEFF   IS DP +WSDPE
Sbjct  353  PYLNAVVKELLRKHPPTYFVLTHAVTEPVKLGGYDIPTDASVEFFSHGISHDPNIWSDPE  412

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRFLSG EDADITGVT VKMMPFG
Sbjct  413  KFDPDRFLSGREDADITGVTKVKMMPFG  440



>sp|P37123.1|C77A1_SOLME RecName: Full=Cytochrome P450 77A1; AltName: Full=CYPLXXVIIA1; 
AltName: Full=Cytochrome P-450EG6, partial [Solanum melongena]
 emb|CAA50647.1| P450 hydroxylase [Solanum melongena]
Length=499

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV EVRK+QIET+VPLIE+RR  ++NPGSDK+AA+FSYLDTLFD+ VEGRKS PTNA
Sbjct  231  QRKRVNEVRKRQIETLVPLIEKRRSVVQNPGSDKTAASFSYLDTLFDVKVEGRKSGPTNA  290

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW I RL+ENP IQ++LY+EIK++VGD+KVDE D +KMP
Sbjct  291  ELVTLCSEFLNGGTDTTATALEWGIGRLMENPTIQNQLYQEIKTIVGDKKVDENDIEKMP  350

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F LTH+VT+P KL GYDIPMD  VEFF+  IS DP +WSDPEK
Sbjct  351  YLNAVVKELLRKHPPTYFTLTHSVTEPVKLAGYDIPMDTNVEFFVHGISHDPNVWSDPEK  410

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG EDADITGV  VKMMPFG
Sbjct  411  FDPDRFLSGREDADITGVKEVKMMPFG  437



>ref|XP_008231991.1| PREDICTED: cytochrome P450 77A3-like [Prunus mume]
Length=514

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR LEVR +QIE IVP IERRRRALENPGSD  A TFSYLDTLFDL VEGRKS+P++A
Sbjct  246  QRKRALEVRNEQIEYIVPFIERRRRALENPGSDPQATTFSYLDTLFDLKVEGRKSAPSHA  305

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATAIEW IA+LI+NP +Q KLY E+K+ VGDRKVDEKD DKMP
Sbjct  306  ELVSLCSEFLNGGTDTTATAIEWGIAQLIDNPEVQEKLYRELKASVGDRKVDEKDVDKMP  365

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP    VE +LPAIS+DP LWSDP+K
Sbjct  366  YLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTGVNVELYLPAISEDPKLWSDPKK  425

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+SGGE+ADITGVT +KMMPFG
Sbjct  426  FNPDRFVSGGEEADITGVTGIKMMPFG  452



>ref|XP_009603326.1| PREDICTED: cytochrome P450 77A2 [Nicotiana tomentosiformis]
Length=513

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR ++VRKQQIETIVP IE+RR+ L NP SDK+AA+FSYLDTLFDL VEGR S+PTN 
Sbjct  244  QRKRAMDVRKQQIETIVPFIEKRRKILSNPDSDKTAASFSYLDTLFDLKVEGRNSAPTNP  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKM  357
            ELVTL SEFLNGGTDTTATAIEWAIAR+IENP IQS+LYEEIK+ VGD +KVDEKD +KM
Sbjct  304  ELVTLCSEFLNGGTDTTATAIEWAIARIIENPSIQSRLYEEIKNTVGDNKKVDEKDIEKM  363

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            PYLNAVVKELLRKHPPT+F+LTHAV +P KLGGYDIP D  VE FLP ISDDP LWS+PE
Sbjct  364  PYLNAVVKELLRKHPPTYFSLTHAVIEPAKLGGYDIPTDANVEIFLPGISDDPKLWSEPE  423

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF  G E+ADITGVT VKM+PFG
Sbjct  424  KFDPDRFFLGKEEADITGVTGVKMIPFG  451



>ref|XP_011101640.1| PREDICTED: cytochrome P450 77A2-like [Sesamum indicum]
Length=531

 Score =   347 bits (891),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV EVRK+QIET+VPLIE+RR A++NPGSDK+AA+FSYLDTLFDL +EGRKS+P+N 
Sbjct  263  QRKRVQEVRKEQIETLVPLIEKRRNAIQNPGSDKTAASFSYLDTLFDLKIEGRKSAPSNP  322

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            E+VTL SEFLNGGTDTTATAIEWA+AR+IENP IQ++LY+EI+S VG+++VDEKD +KMP
Sbjct  323  EIVTLCSEFLNGGTDTTATAIEWAVARMIENPEIQTRLYDEIRSTVGEKRVDEKDVEKMP  382

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F+LTHAVT+P KL GYDIP    VEFFLP ISDDP +W++PEK
Sbjct  383  YLNAVVKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTGTNVEFFLPGISDDPNIWTNPEK  442

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF +  EDADITGV  VKMMPFG
Sbjct  443  FDPDRFFADREDADITGVKGVKMMPFG  469



>gb|AJD25187.1| cytochrome P450 CYP77A27 [Salvia miltiorrhiza]
Length=512

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV EVR +QI+T+VPLIE+RRRA+++PGSD +AA+FSYLDTLFDL VEGRKS+P++A
Sbjct  244  QRKRVWEVRNEQIQTLVPLIEKRRRAIQSPGSDPTAASFSYLDTLFDLKVEGRKSAPSDA  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            E+VTL SEFLNGGTDTTATAIEWA+ R+IENPGIQ+++ +EI++ VGDRKVDEKD +KMP
Sbjct  304  EIVTLCSEFLNGGTDTTATAIEWAVGRMIENPGIQTRIRDEIRATVGDRKVDEKDVEKMP  363

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F+LTHAVT+P KL GYDIP D  VE FLP ISDDP LWSDPEK
Sbjct  364  YLNAVVKELLRKHPPTYFSLTHAVTEPAKLAGYDIPTDANVEIFLPGISDDPKLWSDPEK  423

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  G E+ADITGV+ VKM+PFG
Sbjct  424  FDPDRFFLGREEADITGVSGVKMIPFG  450



>gb|EYU38068.1| hypothetical protein MIMGU_mgv1a004860mg [Erythranthe guttata]
Length=507

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            Q KRV +VR QQIET+VPLIERRR A++NPGSDKSAA+FSYLDTLFDL +EGRKSSP+NA
Sbjct  239  QWKRVQQVRNQQIETLVPLIERRRSAVQNPGSDKSAASFSYLDTLFDLKIEGRKSSPSNA  298

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            E+VTL SEFLNGGTDTTATAIEWA AR+IENP IQ++L++EI++ VGD++VDEKD +K+P
Sbjct  299  EIVTLCSEFLNGGTDTTATAIEWAAARMIENPEIQARLHDEIRTAVGDKRVDEKDVEKLP  358

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLR+HPPT+F+LTHAVT+P KL GYDIP    VEFFLP ISDDP LW+DPEK
Sbjct  359  YLNAVVKELLRRHPPTYFSLTHAVTEPAKLAGYDIPTGANVEFFLPGISDDPKLWTDPEK  418

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  G EDADITGV  VKM+PFG
Sbjct  419  FDPDRFFLGREDADITGVREVKMIPFG  445



>emb|CDO99869.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV EVR++QIE +VP IE+RR A++NPGSDK+AA+FSYLDTLFDL +EGRKS+P+N 
Sbjct  245  QRKRVQEVRREQIELLVPFIEKRRNAIKNPGSDKTAASFSYLDTLFDLKIEGRKSAPSNP  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEWAIAR+IENP IQ+KLY+EIK VVGDRKV+EKD ++MP
Sbjct  305  ELVTLCSEFLNGGTDTTGTAIEWAIARMIENPDIQTKLYKEIKGVVGDRKVEEKDMERMP  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAV KELLRKHPPT+F+LTHAV +P KLGGYDIP D  VE FLP I++DP LWSDP K
Sbjct  365  YLNAVGKELLRKHPPTYFSLTHAVIEPAKLGGYDIPTDTNVEIFLPTIAEDPKLWSDPAK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG +DADITGVT VKM+PFG
Sbjct  425  FDPDRFLSGRDDADITGVTGVKMVPFG  451



>ref|XP_007219021.1| hypothetical protein PRUPE_ppa004373mg [Prunus persica]
 gb|EMJ20220.1| hypothetical protein PRUPE_ppa004373mg [Prunus persica]
Length=514

 Score =   344 bits (882),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR LEVR +QI+ IVP IERRRRALENPGSD  A TFSYLDTLFDL V+GRKS+P++A
Sbjct  246  QRKRALEVRNEQIDYIVPFIERRRRALENPGSDPQATTFSYLDTLFDLKVDGRKSAPSHA  305

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATAIEW IA+LI+NP +Q KLY E+K+ VGDRKVDEKD DKMP
Sbjct  306  ELVSLCSEFLNGGTDTTATAIEWGIAQLIDNPEVQEKLYREVKASVGDRKVDEKDVDKMP  365

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP    VE +LPAIS+DP LWSDP+K
Sbjct  366  YLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTGVNVELYLPAISEDPKLWSDPKK  425

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+SGGE+ADITGVT +KMMPFG
Sbjct  426  FNPDRFVSGGEEADITGVTGIKMMPFG  452



>ref|XP_010032101.1| PREDICTED: cytochrome P450 77A3-like isoform X2 [Eucalyptus grandis]
Length=446

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R+R  EVR+ Q++ ++P IE+RR+ALENPGSDKSA +FSYLDTLFDL VEGRKS PTNA
Sbjct  178  ERRRAQEVRQAQLDFVIPFIEKRRKALENPGSDKSATSFSYLDTLFDLKVEGRKSGPTNA  237

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATAIEW IA+LI NP +QSKLYEEI+S VGDRKVDEKD DKM 
Sbjct  238  ELVTLCSEFLNGGTDTTATAIEWGIAQLIANPHVQSKLYEEIRSTVGDRKVDEKDVDKMV  297

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F+LTHAVT+PTKL GYDIP D  VE +LPA+ +DP LW +PEK
Sbjct  298  YLNAVVKELLRKHPPTYFSLTHAVTEPTKLAGYDIPTDANVEIYLPAVGEDPKLWKNPEK  357

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDR++SG EDADITGV  VKM+PFG
Sbjct  358  FDPDRYISGDEDADITGVKGVKMLPFG  384



>ref|XP_009760347.1| PREDICTED: cytochrome P450 77A2 [Nicotiana sylvestris]
Length=513

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR ++VRKQQIETIVP IE+RR+ L NP SD++AA+FSYLDTLFD+ VEGR S+PTN 
Sbjct  244  QRKRAMDVRKQQIETIVPFIEKRRKILSNPESDETAASFSYLDTLFDVKVEGRNSAPTNP  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKM  357
            ELVTL SEFLNGGTDTTATAIEWAIAR+IENP IQS+LYEEIK+ V D +KVDEKD +KM
Sbjct  304  ELVTLCSEFLNGGTDTTATAIEWAIARIIENPSIQSRLYEEIKNTVEDNKKVDEKDIEKM  363

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            PYLNAV+KELLRKHPPT+F+LTHAV +P KLGGYDIP D  VE FLP ISDDP LWS+PE
Sbjct  364  PYLNAVIKELLRKHPPTYFSLTHAVIEPAKLGGYDIPTDANVEIFLPGISDDPKLWSEPE  423

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF  G E+ADITGV+ VKM+PFG
Sbjct  424  KFDPDRFFLGKEEADITGVSGVKMIPFG  451



>ref|XP_009778850.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana sylvestris]
Length=498

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +1

Query  34   QIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLN  213
            QIET+VPLIE+RRRA+ NPGSDK+AA+FSYLDTLFD+ +EG+KS PTN ELVTL SEFLN
Sbjct  241  QIETLVPLIEKRRRAIRNPGSDKTAASFSYLDTLFDVKIEGKKSGPTNPELVTLCSEFLN  300

Query  214  GGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVVKELLR  393
            GGTDTTATAIEWAI R+IENP IQ+++YEEI++ VGDRKVDEKD DKMPYLNAVVKELLR
Sbjct  301  GGTDTTATAIEWAIGRMIENPSIQNRIYEEIRNTVGDRKVDEKDMDKMPYLNAVVKELLR  360

Query  394  KHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE  573
            KHPPT+   THAVT+PT LGGYDIP D  VEFF+P IS DP +WSDPEKFDPDRFLSG E
Sbjct  361  KHPPTYVTFTHAVTEPTTLGGYDIPTDANVEFFVPGISHDPKVWSDPEKFDPDRFLSGRE  420

Query  574  DADITGVTAVKMMPFG  621
            DADITGVT VKMMPFG
Sbjct  421  DADITGVTGVKMMPFG  436



>ref|XP_004239717.1| PREDICTED: cytochrome P450 77A2 [Solanum lycopersicum]
Length=511

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR ++VRKQQIETIVP IE+R++ LE+P  D++AA+FSYLDTLFDL +EGR S PTN 
Sbjct  244  QRKRAMDVRKQQIETIVPFIEKRKKILESPEIDETAASFSYLDTLFDLKIEGRNSVPTNT  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEEIK+ VG+ K+DEKD +KMP
Sbjct  304  ELVTLCSEFLNGGTDTTATAIEWAIGRMIENPSIQSRLYEEIKNTVGENKIDEKDIEKMP  363

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAV+KELLRKHPPT+ +LTHAVT+P KLGGYDIP D  VE FLP ISDDP LWS+PEK
Sbjct  364  YLNAVIKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTDVNVEIFLPGISDDPNLWSEPEK  423

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF +G E+AD+TGV+ VKM+PFG
Sbjct  424  FDPDRFFTGKEEADMTGVSGVKMIPFG  450



>ref|XP_010032100.1| PREDICTED: cytochrome P450 77A3-like isoform X1 [Eucalyptus grandis]
 gb|KCW51494.1| hypothetical protein EUGRSUZ_J01011 [Eucalyptus grandis]
Length=506

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R+R  EVR+ Q++ ++P IE+RR+ALENPGSDKSA +FSYLDTLFDL VEGRKS PTNA
Sbjct  238  ERRRAQEVRQAQLDFVIPFIEKRRKALENPGSDKSATSFSYLDTLFDLKVEGRKSGPTNA  297

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATAIEW IA+LI NP +QSKLYEEI+S VGDRKVDEKD DKM 
Sbjct  298  ELVTLCSEFLNGGTDTTATAIEWGIAQLIANPHVQSKLYEEIRSTVGDRKVDEKDVDKMV  357

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+F+LTHAVT+PTKL GYDIP D  VE +LPA+ +DP LW +PEK
Sbjct  358  YLNAVVKELLRKHPPTYFSLTHAVTEPTKLAGYDIPTDANVEIYLPAVGEDPKLWKNPEK  417

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDR++SG EDADITGV  VKM+PFG
Sbjct  418  FDPDRYISGDEDADITGVKGVKMLPFG  444



>ref|XP_004307039.1| PREDICTED: cytochrome P450 77A3-like [Fragaria vesca subsp. vesca]
Length=534

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR LEVRK+Q++ IVP IERRRRA++NPGSD+ A +FSYLDTLFDL VEGRKSSP+N 
Sbjct  266  QRKRALEVRKEQVDYIVPFIERRRRAIQNPGSDREATSFSYLDTLFDLKVEGRKSSPSNE  325

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEF+NGGTDTTATA+EW IA+LI NP IQ KLY E+K+ VGDRKVDEKD +KMP
Sbjct  326  ELVTLCSEFINGGTDTTATALEWGIAQLIVNPQIQEKLYAEVKATVGDRKVDEKDVEKMP  385

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP +  VE +LP IS+D  LWSDPEK
Sbjct  386  YLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTNANVEIYLPGISEDHKLWSDPEK  445

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITGVT V+MMPFG
Sbjct  446  FDPDRFISGREDADITGVTGVRMMPFG  472



>ref|XP_009610308.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana tomentosiformis]
Length=501

 Score =   338 bits (868),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +1

Query  34   QIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLN  213
            QIET+VPLIE+RRRA++NPGSDK+AA+FSYLDTLFD+ VEG KS PTN ELVTL SEFLN
Sbjct  241  QIETLVPLIEKRRRAIQNPGSDKTAASFSYLDTLFDVKVEGTKSGPTNPELVTLCSEFLN  300

Query  214  GGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVVKELLR  393
            GGTDTTATAIEWAI R+IENP IQ ++YEEI++ VGDRKVDEKD DKMPYLNAVVKELLR
Sbjct  301  GGTDTTATAIEWAIGRMIENPSIQKRIYEEIRNTVGDRKVDEKDMDKMPYLNAVVKELLR  360

Query  394  KHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE  573
            KHPPT+   THAVT+PT LGGYDIP    VEFF+P ISDDP +WSDPEKFDPDRFLSG E
Sbjct  361  KHPPTYVTFTHAVTEPTTLGGYDIPTYANVEFFVPGISDDPKVWSDPEKFDPDRFLSGRE  420

Query  574  DADITGVTAVKMMPFG  621
            DADITGVT VKMMPFG
Sbjct  421  DADITGVTGVKMMPFG  436



>ref|XP_009336991.1| PREDICTED: cytochrome P450 77A3-like [Pyrus x bretschneideri]
Length=514

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QR R LEVR +QI+ IVP IERRRRALENPGSD  A +FSYLDTLFDL VEGRKSSP++A
Sbjct  246  QRNRALEVRNKQIQYIVPFIERRRRALENPGSDLKATSFSYLDTLFDLKVEGRKSSPSHA  305

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q KLY+E+K+ VGDRKVDEKD +KMP
Sbjct  306  ELVTLCSEFLNGGTDTTATALEWGIAQLITNPNVQEKLYQEVKATVGDRKVDEKDVEKMP  365

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  VE +LP IS+D  +WS+PEK
Sbjct  366  YLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNVEIYLPGISEDSKIWSNPEK  425

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG E+ADITGVT VKMMPFG
Sbjct  426  FDPDRFVSGREEADITGVTGVKMMPFG  452



>ref|XP_006345856.1| PREDICTED: cytochrome P450 77A2-like [Solanum tuberosum]
Length=511

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR ++VRKQQIETIVP IE+R++ LE+P  D++AA+FSYLDTLFDL +EGR S+PT  
Sbjct  244  QRKRAMDVRKQQIETIVPFIEKRKKILESPEIDETAASFSYLDTLFDLKIEGRNSAPTKP  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEEIK+ VG+ KVDEKD +KMP
Sbjct  304  ELVTLCSEFLNGGTDTTATAIEWAIGRIIENPSIQSRLYEEIKNTVGENKVDEKDIEKMP  363

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAV+KELLRKHPPT+ +LTHAVT+P KLGGYDIP D  VE FLP ISDDP LWS+PEK
Sbjct  364  YLNAVIKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTDVNVEIFLPGISDDPNLWSEPEK  423

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  G EDAD+TG++ VKM+PFG
Sbjct  424  FDPDRFFLGKEDADMTGISGVKMIPFG  450



>ref|XP_008345522.1| PREDICTED: cytochrome P450 77A3-like [Malus domestica]
Length=514

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR LEVR +QI+ IVP IERRRRAL+NPGSD  A +FSYLDTLFDL VEG+KSSP++A
Sbjct  246  QRKRALEVRNKQIQFIVPFIERRRRALKNPGSDVKATSFSYLDTLFDLKVEGQKSSPSHA  305

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI NP IQ KLY EIK+ VGDRKVDEKD +KMP
Sbjct  306  ELVTLCSEFLNGGTDTTATALEWGIAQLIANPDIQEKLYSEIKASVGDRKVDEKDVEKMP  365

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  VE +LP ISDD  LWS+PEK
Sbjct  366  YLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNVEIYLPGISDDSKLWSNPEK  425

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF SG E+ADITGVT +KMMPFG
Sbjct  426  FDPDRFXSGREEADITGVTGIKMMPFG  452



>gb|AGZ83069.1| CYP77A19 [Solanum tuberosum]
Length=511

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR ++VRKQQIETIVP IE+R++ LE+P  D++AA+FSYLDTLFDL +EGR S+PT  
Sbjct  244  QRKRAMDVRKQQIETIVPFIEKRKKILESPEIDETAASFSYLDTLFDLKIEGRNSAPTKP  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEEIK+ VG+ KVDEKD +KMP
Sbjct  304  ELVTLCSEFLNGGTDTTATAIEWAIGRIIENPSIQSRLYEEIKNTVGENKVDEKDIEKMP  363

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAV+KELLRKHPPT+ +LTHAVT+P KLGGYDIP D  VE FLP ISDDP LWS+PEK
Sbjct  364  YLNAVIKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTDVNVEIFLPGISDDPNLWSEPEK  423

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  G EDAD+TG++ VKM+PFG
Sbjct  424  FDPDRFFLGKEDADMTGISGVKMIPFG  450



>gb|ADJ57933.1| cytochrome P450 [Solanum torvum]
Length=511

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK  ++VRKQQIETIVP IE+R++ LE+P  DK+AA+FSYLDTLFDL VEGR S+PTN 
Sbjct  244  QRKHAMDVRKQQIETIVPFIEQRKKILESPEIDKTAASFSYLDTLFDLKVEGRNSAPTNP  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATAIEWAI R+IENP IQS+LYEEIK+ VG+ KVDEKD +KMP
Sbjct  304  ELVTLCSEFLNGGTDTTATAIEWAIGRIIENPNIQSRLYEEIKNTVGENKVDEKDIEKMP  363

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+ +LTHAV +P KLGGYDIP D  VE FLP IS+DP LWS+PEK
Sbjct  364  YLNAVVKELLRKHPPTYMSLTHAVIEPVKLGGYDIPTDVNVEIFLPGISEDPKLWSNPEK  423

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  G EDADITGV+ VKM+PFG
Sbjct  424  FDPDRFYLGKEDADITGVSGVKMIPFG  450



>ref|XP_008347045.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Malus 
domestica]
Length=514

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QR R LEVR +QI+ IVP IERRRRALENPGSD  A +FSYLDTLFDL VEGRKSSP++A
Sbjct  246  QRNRALEVRNKQIQYIVPFIERRRRALENPGSDLKATSFSYLDTLFDLKVEGRKSSPSHA  305

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q KLY+E+K+ VGDRKVDEKD +KMP
Sbjct  306  ELVTLCSEFLNGGTDTTATALEWGIAQLITNPNVQEKLYQEVKASVGDRKVDEKDVEKMP  365

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  VE +LP IS+D  +WS+ EK
Sbjct  366  YLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNVEIYLPGISEDSKIWSNAEK  425

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG E+ADITGVT VKMMPFG
Sbjct  426  FDPDRFVSGREEADITGVTGVKMMPFG  452



>gb|KHN37844.1| Cytochrome P450 77A3 [Glycine soja]
Length=437

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYLDTLFDL VEG+KS+P++A
Sbjct  161  QRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYLDTLFDLKVEGKKSAPSDA  220

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q KLYEEIK  VG++KVDEKD +KMP
Sbjct  221  ELVSLCSEFLNGGTDTTATAVEWGIAQLIANPHVQKKLYEEIKRTVGEKKVDEKDVEKMP  280

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI+ DP  WS+PEK
Sbjct  281  YLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDASVEVYTPAIAGDPKNWSNPEK  340

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  341  FDPERFISGGEEADITGVTGVKMMPFG  367



>gb|KHN00917.1| Cytochrome P450 77A3 [Glycine soja]
Length=435

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYLDTLFDL VEG+KS+P++A
Sbjct  161  QRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYLDTLFDLKVEGKKSAPSDA  220

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEIK  VG++KVDEKD +KMP
Sbjct  221  ELVSLCSEFLNGGTDTTATAVEWGIAQLIANPNVQTKLYEEIKRTVGEKKVDEKDVEKMP  280

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI++DP  W +PEK
Sbjct  281  YLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVEVYTPAIAEDPKNWLNPEK  340

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  341  FDPERFISGGEEADITGVTGVKMMPFG  367



>ref|XP_008375581.1| PREDICTED: cytochrome P450 77A3-like [Malus domestica]
Length=514

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QR R LEVR +QI+ IVP IERRRRALENPGSD  A +FSYLDTLFDL VEGRKSSP++A
Sbjct  246  QRNRALEVRNKQIQYIVPFIERRRRALENPGSDLKATSFSYLDTLFDLKVEGRKSSPSHA  305

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q KLY+E+K+ VGDRKVDEKD +KMP
Sbjct  306  ELVTLCSEFLNGGTDTTATALEWGIAQLITNPNVQEKLYQEVKASVGDRKVDEKDVEKMP  365

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTHAVT+PT L GYDIP D  VE +LP IS+D  +WS+ EK
Sbjct  366  YLQAVVKELLRKHPPTYFSLTHAVTEPTTLAGYDIPTDVNVEIYLPGISEDSKIWSNAEK  425

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG E+ADITGVT VKMMPFG
Sbjct  426  FDPDRFVSGREEADITGVTGVKMMPFG  452



>sp|P37124.1|C77A2_SOLME RecName: Full=Cytochrome P450 77A2; AltName: Full=CYPLXXVIIA2; 
AltName: Full=Cytochrome P-450EG5 [Solanum melongena]
 emb|CAA50646.1| CYP77A2 [Solanum melongena]
Length=511

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK  ++VRKQQI+TIVP IE+R++ LE+P  DK+AA+FSYLDTLFDL +EGR S+PT  
Sbjct  244  QRKHAMDVRKQQIKTIVPFIEQRKKILESPEIDKTAASFSYLDTLFDLKIEGRNSTPTYP  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATAIEWAI RLIENP IQS+LYEEIK  VG+ K+DEKD +KMP
Sbjct  304  ELVTLCSEFLNGGTDTTATAIEWAIGRLIENPNIQSQLYEEIKKTVGENKIDEKDIEKMP  363

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+ +LTHAVT+P KLGGYDIP    VE FLP ISDDP LWS+PEK
Sbjct  364  YLNAVVKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTGVNVEIFLPGISDDPNLWSEPEK  423

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  G EDADITGV+ VKM+PFG
Sbjct  424  FDPDRFYLGKEDADITGVSGVKMIPFG  450



>sp|O48928.1|C77A3_SOYBN RecName: Full=Cytochrome P450 77A3 [Glycine max]
 gb|AAB94593.1| CYP77A3p [Glycine max]
Length=513

 Score =   333 bits (854),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYLDTLFDL VEG+KS+P++A
Sbjct  239  QRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYLDTLFDLKVEGKKSAPSDA  298

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEIK  VG++KVDEKD +KMP
Sbjct  299  ELVSLCSEFLNGGTDTTATAVEWGIAQLIANPNVQTKLYEEIKRTVGEKKVDEKDVEKMP  358

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI++DP  W +PEK
Sbjct  359  YLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVEVYTPAIAEDPKNWLNPEK  418

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  419  FDPERFISGGEEADITGVTGVKMMPFG  445



>ref|XP_003536307.2| PREDICTED: cytochrome P450 77A3-like [Glycine max]
Length=536

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYLDTLFDL VEG+KS+P++A
Sbjct  260  QRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYLDTLFDLKVEGKKSAPSDA  319

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q KLYEEIK  VG++KVDEKD +KMP
Sbjct  320  ELVSLCSEFLNGGTDTTATAVEWGIAQLIANPHVQKKLYEEIKRTVGEKKVDEKDVEKMP  379

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI+ DP  WS+PEK
Sbjct  380  YLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDASVEVYTPAIAGDPKNWSNPEK  439

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  440  FDPERFISGGEEADITGVTGVKMMPFG  466



>ref|XP_007143825.1| hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris]
 gb|ESW15819.1| hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris]
Length=506

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR L+VR++QIE + P+I++RRRA++NPGSD +A TFSYLDTLFDL ++G+KS+P++A
Sbjct  234  QRKRALKVRREQIEFLAPIIQQRRRAIQNPGSDHTATTFSYLDTLFDLKIDGKKSAPSDA  293

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEIK  VG++KVDEKD +KMP
Sbjct  294  ELVTLCSEFLNGGTDTTATAVEWGIAQLIANPHVQTKLYEEIKRTVGEKKVDEKDVEKMP  353

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI +DP  WS+PEK
Sbjct  354  YLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVEVYTPAIGEDPKYWSNPEK  413

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SGGE+ADITGVT VKM+PFG
Sbjct  414  FDPDRFISGGEEADITGVTGVKMIPFG  440



>ref|XP_003556278.2| PREDICTED: cytochrome P450 77A3-like [Glycine max]
Length=622

 Score =   334 bits (857),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+ LEVR++Q+E +VP+IE+RRRA++NPGSD +A TFSYLDTLFDL VEG+KS+P++A
Sbjct  348  QRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYLDTLFDLKVEGKKSAPSDA  407

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q+KLYEEIK  VG++KVDEKD +KMP
Sbjct  408  ELVSLCSEFLNGGTDTTATAVEWGIAQLIANPNVQTKLYEEIKRTVGEKKVDEKDVEKMP  467

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI++DP  W +PEK
Sbjct  468  YLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVEVYTPAIAEDPKNWLNPEK  527

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  528  FDPERFISGGEEADITGVTGVKMMPFG  554



>gb|KEH43423.1| cytochrome P450 family 87 protein [Medicago truncatula]
Length=520

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTV-EGRKSSPTN  177
            QRKR LEVRK+Q+E +VP IE+RRRA +NPGSD++A TFSYLDTLFD+ V EG+KS+P+N
Sbjct  247  QRKRALEVRKEQVEFLVPFIEQRRRAFQNPGSDQTATTFSYLDTLFDIKVHEGKKSTPSN  306

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             ELV+L+SEFLNGGTDTTATA+EW IA+LI+NP IQ+KLY+EI S+VGD+KV+EKD +KM
Sbjct  307  EELVSLISEFLNGGTDTTATAVEWGIAQLIDNPEIQAKLYQEINSIVGDKKVEEKDVEKM  366

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            PYL AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE +   I +DP LWS+PE
Sbjct  367  PYLQAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVEVYTAGIGEDPKLWSNPE  426

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDP+RFLS GE+ADITGVT VKMMPFG
Sbjct  427  KFDPERFLSKGEEADITGVTGVKMMPFG  454



>ref|XP_007010384.1| Cytochrome P450 77A3 [Theobroma cacao]
 gb|EOY19194.1| Cytochrome P450 77A3 [Theobroma cacao]
Length=516

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR L+VRK+Q+E IVP IE+RR AL NPGSDKSA +FSYLDTLFDL VEGRKS+P+N+
Sbjct  248  QRKRALQVRKEQVEYIVPFIEKRREALLNPGSDKSAMSFSYLDTLFDLKVEGRKSAPSNS  307

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LIENP +QSKLY+EIK  VGDRKVDE D DKM 
Sbjct  308  ELVTLCSEFLNGGTDTTATALEWGIAQLIENPDVQSKLYDEIKWTVGDRKVDEFDVDKMK  367

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A VKELLR+HPPT+F+LTHA T+P  LGG+DIP D  +E FLP IS+DP +WS+PEK
Sbjct  368  YLQATVKELLRRHPPTYFSLTHAATEPATLGGFDIPTDANLEIFLPGISEDPKIWSNPEK  427

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF S  E ADITGV  VKMMPFG
Sbjct  428  FDPDRFFSEKEAADITGVKGVKMMPFG  454



>ref|XP_010552931.1| PREDICTED: cytochrome P450 77A4 [Tarenaya hassleriana]
Length=526

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R++ L+VR++Q++ +V  IERRRRA+ENPGSDK+AA+FSYLDTLFDL ++GRK++P+NA
Sbjct  258  ERRKALQVRQEQVDFVVGFIERRRRAIENPGSDKTAASFSYLDTLFDLKIDGRKTTPSNA  317

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL+SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR V+E+D +KM 
Sbjct  318  ELVTLLSEFLNGGTDTTGTAIEWGIAQLISNPQIQSRLYDEIKSTVGDRPVEERDVEKMV  377

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKELLRKHPPT+F+LTHA T+PTKL GYDIP    VEF+LP IS+DP LWSDP+K
Sbjct  378  FLQAVVKELLRKHPPTYFSLTHAATEPTKLAGYDIPTGVNVEFYLPGISEDPKLWSDPKK  437

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRFLSG EDAD+TGVT V+MMPFG
Sbjct  438  FDPDRFLSGREDADMTGVTGVRMMPFG  464



>ref|XP_010278187.1| PREDICTED: cytochrome P450 77A2-like [Nelumbo nucifera]
Length=520

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV+EVR++QI+T++P IE+RR  L+NPGSD +AA F+YLDTLFDL VEGRKSSP +A
Sbjct  252  QRKRVMEVRQEQIQTVLPFIEKRRSILKNPGSDMTAAPFAYLDTLFDLEVEGRKSSPNDA  311

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SE LNGGTDTTATA+EW IARLIENP IQSKLY EIKS VGDRKVDEKD + M 
Sbjct  312  ELVTLCSELLNGGTDTTATALEWGIARLIENPDIQSKLYAEIKSTVGDRKVDEKDIENMV  371

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLR+HPPT+ +LTHAVTQP  LGGYD+P D  VE FLP IS+DP LWS+PEK
Sbjct  372  YLNAVVKELLRRHPPTYLSLTHAVTQPATLGGYDVPTDANVEIFLPPISEDPNLWSEPEK  431

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF SG E+ADITG+  +KM+PFG
Sbjct  432  FNPDRFASGKEEADITGLKGLKMVPFG  458



>ref|XP_011032810.1| PREDICTED: cytochrome P450 77A3-like [Populus euphratica]
Length=517

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR  EVRK Q+  +V  IE+RR A+ NPGSDKSA +FSYLDTLFDLTVEGRKS+P+N 
Sbjct  249  QRKRASEVRKAQVNFMVSFIEKRRNAIRNPGSDKSAMSFSYLDTLFDLTVEGRKSTPSNE  308

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q+KLY EIK+ VGDRKVDEKD +KM 
Sbjct  309  ELVTLCSEFLNGGTDTTATAVEWGIAQLIANPEVQTKLYNEIKAAVGDRKVDEKDVEKME  368

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT+F L+HAVT+PT LGGYDIP+D  VEFF   I +DP +W++PEK
Sbjct  369  YLHAVVKELLRKHPPTYFVLSHAVTEPTTLGGYDIPLDANVEFFSYGIGEDPKVWNNPEK  428

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+S GEDADITGVT VKMMPFG
Sbjct  429  FNPDRFISDGEDADITGVTGVKMMPFG  455



>gb|AFK33897.1| unknown [Lotus japonicus]
Length=347

 Score =   321 bits (822),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRVLEVRK+QIE +VP IE+R+RA+ENPGSD++A TFSYLDTLFD+ VEGRKS+P++ 
Sbjct  79   QRKRVLEVRKEQIEFLVPYIEQRKRAIENPGSDQTATTFSYLDTLFDMKVEGRKSTPSDG  138

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L+SEFLNGGTDTTATA+EW +A+LI NP IQ +LY EIKS VGD+KVDEKD +KM 
Sbjct  139  ELVSLISEFLNGGTDTTATAVEWGMAQLIANPDIQKRLYNEIKSTVGDKKVDEKDVEKML  198

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKE +R++PPTFFA T+AVT+P  L GYDIP +  VE ++PAI +DPTLWS+PEK
Sbjct  199  YLQAVVKEQMRRNPPTFFAPTYAVTEPITLAGYDIPTNANVEVYIPAIGNDPTLWSNPEK  258

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDP+RF+SGGEDADITGV  V+M+PFG
Sbjct  259  FDPERFISGGEDADITGVKEVRMVPFG  285



>ref|XP_002311965.1| CYP77A3p family protein [Populus trichocarpa]
 gb|EEE89332.1| CYP77A3p family protein [Populus trichocarpa]
Length=514

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR  EVRK Q+  +V  IE+RR A+ NPGSDKSA +FSYLDTLFDLT EGRKS+P+N 
Sbjct  246  QRKRASEVRKAQVNFMVSFIEKRRNAIRNPGSDKSAMSFSYLDTLFDLTFEGRKSTPSNE  305

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI NP +Q+KLY EIKS VGDRKVDEKD +KM 
Sbjct  306  ELVTLCSEFLNGGTDTTATAVEWGIAQLIANPEVQTKLYNEIKSTVGDRKVDEKDVEKME  365

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL+AVVKELLRKHPPT+F L+HAVT+PT L GYDIP+D  VEFF   I +DP +W++PEK
Sbjct  366  YLHAVVKELLRKHPPTYFVLSHAVTEPTTLAGYDIPLDASVEFFSYGIGEDPKVWNNPEK  425

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+S GEDADITGVT VKMMPFG
Sbjct  426  FNPDRFISDGEDADITGVTGVKMMPFG  452



>gb|KDO46108.1| hypothetical protein CISIN_1g010526mg [Citrus sinensis]
Length=508

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR  EVRK+Q++ +VP IE RR+ L+NPGSDK+A +FSYLDTLFDL +EGR S P+N 
Sbjct  237  QRKRAREVRKEQVDFMVPFIELRRKMLQNPGSDKTAMSFSYLDTLFDLKIEGRTSGPSNE  296

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVDEKDTD  351
            ELVTL SEFLNGGTDTTATA+EW IA+LI NPG+Q K+Y+EIK  VGD   RKVDEKD +
Sbjct  297  ELVTLCSEFLNGGTDTTATAVEWGIAQLIANPGVQEKVYDEIKRTVGDNPDRKVDEKDVE  356

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
            KMPYL AVVKELLRKHPPT+F+LTHAVT+ T L GYDIP D  VE FLP I DDP LW+ 
Sbjct  357  KMPYLQAVVKELLRKHPPTYFSLTHAVTEATTLAGYDIPTDANVEIFLPGIGDDPKLWAH  416

Query  532  PEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            PE+FDP+RF+SG EDADITGVT VKMMPFG
Sbjct  417  PERFDPERFVSGREDADITGVTGVKMMPFG  446



>ref|XP_006436671.1| hypothetical protein CICLE_v10031286mg [Citrus clementina]
 ref|XP_006492188.1| PREDICTED: cytochrome P450 77A3-like [Citrus sinensis]
 gb|ESR49911.1| hypothetical protein CICLE_v10031286mg [Citrus clementina]
Length=508

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR  EVRK+Q++ +VP IE RR+ L+NPGSDK+A +FSYLDTLFDL +EGR S P+N 
Sbjct  237  QRKRAREVRKEQVDFMVPFIELRRKMLQNPGSDKTAMSFSYLDTLFDLKIEGRTSGPSNE  296

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVDEKDTD  351
            ELVTL SEFLNGGTDTTATA+EW IA+LI NPG+Q K+Y+EIK  VGD   RKVDEKD +
Sbjct  297  ELVTLCSEFLNGGTDTTATAVEWGIAQLIANPGVQEKVYDEIKRTVGDDPDRKVDEKDVE  356

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
            KMPYL AVVKELLRKHPPT+F+LTHAVT+ T L GYDIP D  VE FLP I DDP LW+ 
Sbjct  357  KMPYLQAVVKELLRKHPPTYFSLTHAVTEATTLAGYDIPTDANVEIFLPGIGDDPKLWAH  416

Query  532  PEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            PE+FDP+RF+SG EDADITGVT VKMMPFG
Sbjct  417  PERFDPERFVSGREDADITGVTGVKMMPFG  446



>ref|XP_010464733.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYLDTLFDL +EGRK++P+N 
Sbjct  245  ERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYLDTLFDLKIEGRKTTPSNE  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDRKV+EKD DKM 
Sbjct  305  ELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEIKSTVGDRKVEEKDVDKMV  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   VEF+LPAI++DP LWSDP+K
Sbjct  365  FLQAVVKEILRKHPPTYFTLTHSVTEETTVAGYDVPVGINVEFYLPAINEDPKLWSDPKK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  425  FNPDRFISGKEEADITGVTGVKMMPFG  451



>ref|XP_006407539.1| hypothetical protein EUTSA_v10020529mg [Eutrema salsugineum]
 gb|ESQ48992.1| hypothetical protein EUTSA_v10020529mg [Eutrema salsugineum]
Length=513

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR LEVR++Q++ +V  IERRRRA++NPGSDK+A++FSYLDTLFDL +EGRK++P+N 
Sbjct  245  QRKRALEVRREQVDLVVGFIERRRRAIQNPGSDKTASSFSYLDTLFDLKIEGRKTTPSNE  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQ +LY+EIKS VGDR V+EKD DKM 
Sbjct  305  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQCRLYDEIKSTVGDRSVEEKDVDKMV  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKE+LRKHPPT+F LTH+VT+PT + GYD+P+   VEF+LP I++DP +WS+P+K
Sbjct  365  HLQAFVKEILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVEFYLPGINEDPKIWSNPQK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITGVT VKMM FG
Sbjct  425  FDPDRFISGKEDADITGVTGVKMMTFG  451



>ref|XP_002882683.1| CYP77A6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58942.1| CYP77A6 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYLDTLFDL  EGRK++P+N 
Sbjct  245  ERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYLDTLFDLKTEGRKTTPSNE  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR+V+EKD DKM 
Sbjct  305  ELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEIKSTVGDREVEEKDVDKMV  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKE+LRKHPPT+F LTH+VT+PT +GGYD+P+   VEF+LP I++DP LWSDP+K
Sbjct  365  FLQAVVKEILRKHPPTYFTLTHSVTEPTTVGGYDVPVGINVEFYLPGINEDPKLWSDPKK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF++G E+ADITGVT VKMMPFG
Sbjct  425  FNPDRFIAGKEEADITGVTGVKMMPFG  451



>emb|CDY00955.1| BnaC05g42450D [Brassica napus]
Length=516

 Score =   321 bits (822),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R+R LEVR++Q+E +V  IERRRRAL NPG+DK+A +FSYLDTLFDL +EGRK++P+N 
Sbjct  248  ERRRALEVRREQVELVVGFIERRRRALRNPGTDKTATSFSYLDTLFDLKIEGRKTTPSNE  307

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR V+EKD +KM 
Sbjct  308  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDRAVEEKDVEKMV  367

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKE+LRKHPPT+F LTH VT+PT + GYD+P    VEF+LP I++DP +WS+P+K
Sbjct  368  FLQAFVKEILRKHPPTYFTLTHTVTEPTTVAGYDVPAGINVEFYLPGINEDPKIWSNPKK  427

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITGVT VKMMPFG
Sbjct  428  FDPDRFVSGKEDADITGVTGVKMMPFG  454



>ref|XP_010486669.1| PREDICTED: cytochrome P450 77A4 [Camelina sativa]
Length=544

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYLDTLFDL +EGRK++P+N 
Sbjct  276  ERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYLDTLFDLKIEGRKTTPSNE  335

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTT TA+EW IA+LI NP +QS+LY+EIKS VGDRKV+EKD DKM 
Sbjct  336  ELVSLCSEFLNGGTDTTGTALEWGIAQLIVNPEVQSRLYDEIKSTVGDRKVEEKDVDKMV  395

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   VEF+LPAI++DP LWSDP+K
Sbjct  396  FLQAVVKEILRKHPPTYFTLTHSVTEETTVAGYDVPVGINVEFYLPAINEDPKLWSDPKK  455

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  456  FNPDRFISGKEEADITGVTGVKMMPFG  482



>ref|XP_010486076.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYLDTLFDL +EGRK++P+N 
Sbjct  245  ERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYLDTLFDLKIEGRKTTPSNE  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNG TDTT TAIEW IA+LI NP +QS+LY+EIKS VGDRKV+EKD DKM 
Sbjct  305  ELVSLCSEFLNGSTDTTGTAIEWGIAQLIVNPEVQSRLYDEIKSTVGDRKVEEKDVDKMV  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   VEF+LPAI++DP LWSDP+K
Sbjct  365  FLQAVVKEILRKHPPTYFTLTHSVTEETTVAGYDVPVGINVEFYLPAINEDPKLWSDPKK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  425  FNPDRFISGKEEADITGVTGVKMMPFG  451



>emb|CDY08591.1| BnaA05g28270D [Brassica napus]
Length=516

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R+R LEVR++Q++ +V  +ERRRRAL NPG+DK+A +FSYLDTLFDL +EGRK++P+N 
Sbjct  248  ERRRALEVRREQVDLVVGFVERRRRALRNPGTDKTATSFSYLDTLFDLKIEGRKTTPSNE  307

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR V+EKD +KM 
Sbjct  308  ELVTLCSEFLNGGTDTTGTAIEWGIAQLISNPEIQSRLYDEIKSTVGDRAVEEKDVEKMV  367

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKE+LRKHPPT+F LTH VT+PT + GYD+P    VEF+LP I++DP +WS+P+K
Sbjct  368  FLQAFVKEILRKHPPTYFTLTHTVTEPTTVAGYDVPAGINVEFYLPGINEDPKIWSNPKK  427

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITGVT VKMMPFG
Sbjct  428  FDPDRFVSGKEDADITGVTGVKMMPFG  454



>ref|XP_009146826.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=516

 Score =   318 bits (816),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R+R LEVR++Q++ +V  +ERRRRAL NPG+DK+A +FSYLDTLF+L +EGRK++P+N 
Sbjct  248  ERRRALEVRREQVDLVVGFVERRRRALRNPGTDKTATSFSYLDTLFELKIEGRKTTPSNE  307

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR V+EKD +KM 
Sbjct  308  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDRAVEEKDVEKMV  367

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKE+LRKHPPT+F LTH VT+PT + GYD+P    VEF+LP I++DP +WSDP+K
Sbjct  368  FLQAFVKEILRKHPPTYFTLTHTVTEPTTVAGYDVPAGINVEFYLPGINEDPKIWSDPKK  427

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITGVT VKMMPFG
Sbjct  428  FDPDRFVSGKEDADITGVTGVKMMPFG  454



>gb|AJD25188.1| cytochrome P450 CYP77A28 [Salvia miltiorrhiza]
Length=505

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 178/207 (86%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV  VRK+QIET+VPLIE+RR+     GS  ++ +F+YLDTLFDL VEGRKS+PTN 
Sbjct  239  QRKRVQAVRKKQIETLVPLIEKRRQEWIKHGS--ASNSFAYLDTLFDLKVEGRKSAPTNE  296

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EWA+ARLIENP IQ +L +EI++ VG++KVDEKD ++MP
Sbjct  297  ELVTLCSEFLNGGTDTTATAVEWAVARLIENPAIQCRLADEIRATVGEKKVDEKDVERMP  356

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+FALTHAVT+PT+LGGYDIP    VEFF   I++DP +WSDPE+
Sbjct  357  YLNAVVKELLRKHPPTYFALTHAVTEPTRLGGYDIPTSASVEFFSAGIAEDPKVWSDPER  416

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF +G E+ADITGVT VKMMPFG
Sbjct  417  FDPDRFFAGREEADITGVTGVKMMPFG  443



>ref|XP_010248417.1| PREDICTED: cytochrome P450 77A2-like [Nelumbo nucifera]
Length=388

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 174/207 (84%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR ++VR++QI TI+P IE+RR  L+N        +F+YLDTLFDL +EGRKS PT+ 
Sbjct  124  QRKRSMQVREEQIRTILPFIEKRRSLLKN----NPETSFAYLDTLFDLEIEGRKSRPTDT  179

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTTATA+EW IARLIENP IQSKLY EIKS VGDRKVDEKD ++M 
Sbjct  180  ELVSLCSEFLNGGTDTTATALEWGIARLIENPEIQSKLYTEIKSKVGDRKVDEKDAEEMV  239

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNAVVKELLRKHPPT+FALTHAVTQP  LGGYD+P D  VE FLPAI++DP++WS+PEK
Sbjct  240  YLNAVVKELLRKHPPTYFALTHAVTQPATLGGYDVPTDANVEIFLPAIAEDPSIWSEPEK  299

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF +G EDADITGV  VKM+PFG
Sbjct  300  FNPDRFATGKEDADITGVKGVKMLPFG  326



>ref|XP_006297449.1| hypothetical protein CARUB_v10013470mg [Capsella rubella]
 gb|EOA30347.1| hypothetical protein CARUB_v10013470mg [Capsella rubella]
Length=515

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R LEVR++Q++ IV  IERRRRA++NPG+DK+A++FSYLDTLFDL  EGRKS+P+N 
Sbjct  247  ERARALEVRREQVDFIVKFIERRRRAIQNPGTDKTASSFSYLDTLFDLKTEGRKSTPSNE  306

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTT TAIEW IA+LI NP +QS+LY+EIKS VGDR+V+EKD DKM 
Sbjct  307  ELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEVQSRLYDEIKSTVGDREVEEKDVDKMV  366

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKE+LRKHPPT+F LTH+VT+ T + GYD+P+   +EF+LP I++DP LWSDP+K
Sbjct  367  FLQAVVKEILRKHPPTYFTLTHSVTEQTTVAGYDVPVGINIEFYLPGINEDPKLWSDPKK  426

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F PDRF+SG E+ADITGVT VKMMPFG
Sbjct  427  FKPDRFISGKEEADITGVTGVKMMPFG  453



>ref|XP_008456581.1| PREDICTED: cytochrome P450 77A3-like [Cucumis melo]
Length=514

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR +EVR++QIE +V  I RR++AL+NPGSD +A +FSYLDTLFDL V+GRKS+PT+A
Sbjct  245  QRKRAMEVRREQIEFVVQFINRRKKALQNPGSDINATSFSYLDTLFDLKVDGRKSTPTDA  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGG DTTATAIEW IA LI NP IQ KL+EEIK +VGDRKVDE D +K+P
Sbjct  305  ELVTLCSEFLNGGVDTTATAIEWGIAELISNPNIQKKLHEEIKQLVGDRKVDESDVEKLP  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTH+V +PTKLGGYDIPM+  VE +L  IS+DP LW +PEK
Sbjct  365  YLQAVVKELLRKHPPTYFSLTHSVIEPTKLGGYDIPMEASVEVYLAGISNDPKLWKNPEK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+P+RF+SG E+ D+TG+  +KM+PFG
Sbjct  425  FEPERFISGEEEVDMTGIKGMKMIPFG  451



>ref|XP_010452364.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYLDTLFDLT+EGR+++P+N 
Sbjct  244  ERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYLDTLFDLTIEGRETTPSNE  303

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKM  357
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VG DR V+EKD DKM
Sbjct  304  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDDRSVEEKDVDKM  363

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             YL A VKELLRKHPPT+F+LTHAVT+ T LGGYDIP    VE +LP +S+DP +WS+P+
Sbjct  364  VYLQAFVKELLRKHPPTYFSLTHAVTETTTLGGYDIPAGVNVEVYLPGMSEDPRIWSNPK  423

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF+ G E+ADITG+T VKM+PFG
Sbjct  424  KFDPDRFMLGKENADITGITGVKMIPFG  451



>ref|XP_004496181.1| PREDICTED: cytochrome P450 77A3-like [Cicer arietinum]
Length=521

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEG-RKSSPTN  177
            QRK  L+VRK+Q+E +VP IE+RRRA++NPGSD++A TFSYLDTLFD+ VEG +KSSP+N
Sbjct  248  QRKNALKVRKEQVEFMVPFIEQRRRAIQNPGSDQTATTFSYLDTLFDIKVEGSKKSSPSN  307

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             ELV+L+SEFLNGGTDTTATA+EW IA+LI+NP IQ+KLY+EI ++VGD+KV+EKD +KM
Sbjct  308  EELVSLLSEFLNGGTDTTATAVEWGIAQLIDNPEIQAKLYQEINAIVGDKKVEEKDVEKM  367

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            PYL AVVKELLRKHPPT F LTHAVT+ T LGGYDIP +  VE +   I +DP LW++PE
Sbjct  368  PYLQAVVKELLRKHPPTHFVLTHAVTEDTSLGGYDIPTNTNVEVYTAGIGEDPKLWTNPE  427

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDP+RF+S GE+ADITGVT V+MMPFG
Sbjct  428  KFDPERFVSKGEEADITGVTGVRMMPFG  455



>ref|NP_187668.1| cytochrome P450, family 77, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
 gb|AAG51390.1|AC011560_22 putative cytochrome P450; 45201-43660 [Arabidopsis thaliana]
 gb|AAF76359.1| cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAV97806.1| At3g10570 [Arabidopsis thaliana]
 gb|AAX12870.1| At3g10570 [Arabidopsis thaliana]
 gb|AEE74926.1| cytochrome P450, family 77, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
Length=513

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R LEVR +Q++ IV LIERRRRA++ PG+DK+A++FSYLDTLFDL  EGR ++P+N 
Sbjct  245  ERARALEVRCEQVDFIVKLIERRRRAIQKPGTDKTASSFSYLDTLFDLKTEGRITTPSNE  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR+V+EKD DKM 
Sbjct  305  ELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEIKSTVGDREVEEKDVDKMV  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKE+LRKHPPT+F LTH+VT+PT + GYD+P+   VEF+LP I++DP LWSDP+K
Sbjct  365  FLQAVVKEILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVEFYLPGINEDPKLWSDPKK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  425  FNPDRFISGKEEADITGVTGVKMMPFG  451



>gb|KJB73379.1| hypothetical protein B456_011G229800 [Gossypium raimondii]
Length=505

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 171/208 (82%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+ L+VRK QI+ IVP IE+RR AL NPGSD+SA +FSYLDTLFDL VEGRKS+P+N+
Sbjct  234  QRKQALQVRKHQIDYIVPFIEKRREALLNPGSDRSAMSFSYLDTLFDLKVEGRKSAPSNS  293

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LIEN  IQSKL +EIKS VGDR+VDE D +K+ 
Sbjct  294  ELVTLCSEFLNGGTDTTATALEWGIAQLIENQDIQSKLLDEIKSTVGDRRVDETDIEKLK  353

Query  361  YLNAVVKELLRKHPPTFFALTHAVT-QPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            YL AVVKELLR+HPPT+F+LTHA T +   LGGYDIP D  +E +LP I DDP +WSDPE
Sbjct  354  YLQAVVKELLRRHPPTYFSLTHAATEEAATLGGYDIPTDANLEIYLPGIGDDPKIWSDPE  413

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF  G ED DI GV  VKMMPFG
Sbjct  414  KFDPDRFYLGKEDGDIMGVKGVKMMPFG  441



>ref|XP_010490980.1| PREDICTED: cytochrome P450 77A4 [Camelina sativa]
Length=512

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V +I+RRRRA++NPGSDK+A++FSYLDTLFDL +EGR+++P+N 
Sbjct  243  ERKRALEVRREQVDYVVGVIDRRRRAIQNPGSDKTASSFSYLDTLFDLKIEGRETTPSNE  302

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKM  357
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VG DR VDEKD DKM
Sbjct  303  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDDRSVDEKDVDKM  362

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             YL A VKELLRKHPPT+F+LTHAVT+ T LGGYDIP    VE +LP +S+DP +WS+P+
Sbjct  363  VYLQAFVKELLRKHPPTYFSLTHAVTETTTLGGYDIPAGVNVEVYLPGMSEDPRIWSNPK  422

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF+ G E+ADITG+T VKM+PFG
Sbjct  423  KFDPDRFMLGKENADITGITGVKMIPFG  450



>gb|EPS69622.1| hypothetical protein M569_05145, partial [Genlisea aurea]
Length=470

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QR RV  +R+QQI TI+PLI+RRRRA+ NPGSDKSAA FSYLDTLFDL ++GRKSSP++ 
Sbjct  207  QRNRVQAIREQQIRTILPLIQRRRRAVHNPGSDKSAAPFSYLDTLFDLKIDGRKSSPSDP  266

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            E+VTL SE LNGGTDTTATA+EWAIARL+  P +Q ++  EI+  VGD K+DEKD +K+P
Sbjct  267  EIVTLCSEILNGGTDTTATAVEWAIARLVAGPDMQDRIRREIRDAVGDAKLDEKDVEKLP  326

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A VKELLR+HPPTFF+LTHAVT+P KLGGYDIP D  VE FLP I  DP LWSDP+K
Sbjct  327  YLQAFVKELLRRHPPTFFSLTHAVTEPAKLGGYDIPTDANVEIFLPEIGLDPNLWSDPDK  386

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDP+RFLSG  +AD+TGV+ VKM+PFG
Sbjct  387  FDPERFLSGKVEADMTGVSGVKMIPFG  413



>gb|KJB49031.1| hypothetical protein B456_008G098700 [Gossypium raimondii]
Length=519

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR L+VRKQQ+E I P I++RR AL NPGS+ SA  FSYLDTLFDL VEGR S+P+N+
Sbjct  248  QRKRALQVRKQQLENITPFIQQRRVALRNPGSNNSAMRFSYLDTLFDLKVEGRNSAPSNS  307

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEF+NGGTDTTAT +EW IA+LI NP IQSKL++EIKS VGDR V+EKD + M 
Sbjct  308  ELVSLCSEFINGGTDTTATVLEWGIAQLIHNPNIQSKLFDEIKSTVGDRTVEEKDVENMK  367

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A+VKE+LRKHPPT+F LTHA T+ T LGG++IP+D  +E FLP IS+DP +WS+PEK
Sbjct  368  YLQAIVKEVLRKHPPTYFLLTHAATEATTLGGFNIPIDANLEVFLPGISEDPKIWSNPEK  427

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF  G EDADITGVT VKM+PFG
Sbjct  428  FDPDRFYLGKEDADITGVTMVKMIPFG  454



>gb|AAO42093.1| putative cytochrome p450 [Arabidopsis thaliana]
Length=513

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R LEVR  Q++ IV LIERRRRA++ PG+DK+A++FSYLDTLFDL  EGR ++P+N 
Sbjct  245  ERARALEVRCGQVDFIVKLIERRRRAIQKPGTDKTASSFSYLDTLFDLKTEGRITTPSNE  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELV+L SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR+V+EKD DKM 
Sbjct  305  ELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEIKSTVGDREVEEKDVDKMV  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L AVVKE+LRKHPPT+F LTH+VT+PT + GYD+P+   VEF+LP I++DP LWSDP+K
Sbjct  365  FLQAVVKEILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVEFYLPGINEDPKLWSDPKK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF+SG E+ADITGVT VKMMPFG
Sbjct  425  FNPDRFISGKEEADITGVTGVKMMPFG  451



>gb|KDP45018.1| hypothetical protein JCGZ_01518 [Jatropha curcas]
Length=513

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKRV +VRK+Q+E +VPLI++RR+ALENP SD  A +FSYLDTLF L +EGRKSSP++ 
Sbjct  245  QRKRVSQVRKEQVEFMVPLIQKRRKALENPKSDPKAISFSYLDTLFGLKIEGRKSSPSDQ  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTTATA+EW IA+LI+NP +Q+KLY EIK VVGD+KV E D +KM 
Sbjct  305  ELVTLCSEFLNGGTDTTATAVEWGIAQLIDNPDVQNKLYNEIKEVVGDKKVTETDVEKME  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPTFF LTHAVT+ T LGGYDIP+D  VE F  AI +DP +WS+PEK
Sbjct  365  YLQAVVKELLRKHPPTFFLLTHAVTEATTLGGYDIPIDANVEIFSTAIGEDPRIWSNPEK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF SG E ADITGVT VKM PFG
Sbjct  425  FNPDRFSSGKEQADITGVTGVKMTPFG  451



>gb|AAM66094.1| cytochrom P450-like protein [Arabidopsis thaliana]
Length=512

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYLDTLFDL +EGRK++P+N 
Sbjct  243  ERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYLDTLFDLKIEGRKTTPSNE  302

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKM  357
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VG DR+VDEKD DKM
Sbjct  303  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDDRRVDEKDVDKM  362

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    VE +LP IS+DP +W++P+
Sbjct  363  VFLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNVEVYLPGISEDPRIWNNPK  422

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF+ G EDADITG++ VKM+PFG
Sbjct  423  KFDPDRFMLGKEDADITGISGVKMIPFG  450



>ref|XP_010423551.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=540

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V +IERRRRA++NPGSD++A++FSYLDTLFDL +EGR+++P+N 
Sbjct  271  ERKRALEVRREQVDYVVGVIERRRRAIQNPGSDETASSFSYLDTLFDLKIEGRETTPSNE  330

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKM  357
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VG DR V+EKD +KM
Sbjct  331  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDDRSVEEKDVNKM  390

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             YL A VKELLRKHPPT+F+LTHAVT+ T LGGYDIP    VE +LP +S+DP +WS+P+
Sbjct  391  VYLQAFVKELLRKHPPTYFSLTHAVTETTTLGGYDIPAGVNVEVYLPGMSEDPRIWSNPK  450

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF+ G E+ADITG+T VKM+PFG
Sbjct  451  KFDPDRFMLGKENADITGITGVKMIPFG  478



>ref|NP_196086.1| cytochrome P450, family 77, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9LZ31.1|C77A4_ARATH RecName: Full=Cytochrome P450 77A4; AltName: Full=Fatty acid 
epoxidase [Arabidopsis thaliana]
 emb|CAB86008.1| cytochrom P450-like protein [Arabidopsis thaliana]
 gb|AED90769.1| cytochrome P450, family 77, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
Length=512

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYLDTLFDL +EGRK++P+N 
Sbjct  243  ERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYLDTLFDLKIEGRKTTPSNE  302

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKM  357
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VG DR+VDEKD DKM
Sbjct  303  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDDRRVDEKDVDKM  362

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    VE +LP IS+DP +W++P+
Sbjct  363  VFLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNVEVYLPGISEDPRIWNNPK  422

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF+ G EDADITG++ VKM+PFG
Sbjct  423  KFDPDRFMLGKEDADITGISGVKMIPFG  450



>gb|KFK38447.1| hypothetical protein AALP_AA3G114600 [Arabis alpina]
Length=1027

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RK+ LEVR++Q++ +V  IERRRRA+ NPGSDK+A++FSYLDTLFDL +EGRK+ P+N 
Sbjct  759  ERKKALEVRREQVDFVVKFIERRRRAIANPGSDKTASSFSYLDTLFDLKIEGRKTMPSNE  818

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EIKS VGD  V+EKD DKM 
Sbjct  819  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIKSTVGDSPVEEKDVDKMV  878

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A VKE+LRKHPPT+F LTH+VT+PTK+GGYD+P+   VEF+LP I++DP +WS+P+K
Sbjct  879  YLQAFVKEILRKHPPTYFTLTHSVTEPTKVGGYDVPVGINVEFYLPGINEDPKIWSNPKK  938

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITGVT VKMMPFG
Sbjct  939  FDPDRFVSGKEDADITGVTGVKMMPFG  965


 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 160/207 (77%), Gaps = 8/207 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R R L++R++ ++ +V  IE+RR A+    S+ S+++FSYLDTLFDL     +++P+N 
Sbjct  245  ERNRALKLRRELVDFVVGFIEKRRTAIR---SESSSSSFSYLDTLFDL-----ETTPSNE  296

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+EIKS VGD  V++KD  KM 
Sbjct  297  DLVTLCSEFLNAGTDTTGAAIEWGIAELISNPEIQSRLYDEIKSTVGDCPVEDKDVGKMV  356

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L  VVKELLR HPPT+F L+H VT+PT L GY+IP+   VEF+LP IS+DP +WSDP+K
Sbjct  357  FLQGVVKELLRLHPPTYFTLSHGVTEPTTLSGYNIPVGVNVEFYLPGISEDPNIWSDPKK  416

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG E+AD+TGV  VKMMPFG
Sbjct  417  FDPDRFVSGKEEADMTGVAGVKMMPFG  443



>ref|XP_002871108.1| CYP77A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47367.1| CYP77A4 [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V +IERRRRA++NPGSDK+A++FSYLDTLFDL +EGRK++P+N 
Sbjct  242  ERKRALEVRREQVDYVVGVIERRRRAIQNPGSDKTASSFSYLDTLFDLKIEGRKTTPSNE  301

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKM  357
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI+S VG DR+V+EKD DKM
Sbjct  302  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIESTVGDDRRVNEKDVDKM  361

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    VE +LP IS+DP +W++P+
Sbjct  362  VFLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNVEIYLPGISEDPRIWNNPK  421

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF+ G EDADITG++ VKM+PFG
Sbjct  422  KFDPDRFMLGKEDADITGISGVKMIPFG  449



>ref|XP_006398921.1| hypothetical protein EUTSA_v10016078mg [Eutrema salsugineum]
 gb|ESQ40374.1| hypothetical protein EUTSA_v10016078mg [Eutrema salsugineum]
Length=510

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR L+VR++Q++ +V  IERRRRA+ NPGSDK+A++FSYLDTLFDL VEGR+++P N 
Sbjct  242  ERKRALQVRREQVDFVVGFIERRRRAIRNPGSDKTASSFSYLDTLFDLKVEGRETTPCNE  301

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI+S  GDR+++EKD +KM 
Sbjct  302  ELVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIRSTAGDRRIEEKDVEKMV  361

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKELLRKHPPT+F+LTHAV + T L GYDIP    VE +LP IS+DP +W++P+K
Sbjct  362  FLQAFVKELLRKHPPTYFSLTHAVMETTTLAGYDIPAGVNVEVYLPGISEDPRIWTNPKK  421

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITG++ VKM+PFG
Sbjct  422  FDPDRFISGKEDADITGISGVKMIPFG  448



>ref|XP_004140895.1| PREDICTED: cytochrome P450 77A3-like [Cucumis sativus]
 gb|KGN46023.1| Cytochrome P450 77A3 [Cucumis sativus]
Length=513

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR +EVR++QIE +V  I RR++AL+NPGSD  A +FSYLDTLFDL V+GRKS+PT+A
Sbjct  245  QRKRAMEVRREQIEFVVQFINRRKKALQNPGSDNKATSFSYLDTLFDLKVDGRKSTPTDA  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGG DTTATAIEW IA LI NP +Q KLYEEIK +VGDRKVDE D  K+P
Sbjct  305  ELVTLCSEFLNGGVDTTATAIEWGIAELITNPNVQKKLYEEIKQLVGDRKVDESDVQKLP  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTH+  + +KLGGYDIPM+  VE +L  +S+DP +W +PEK
Sbjct  365  YLQAVVKELLRKHPPTYFSLTHSGIEASKLGGYDIPMEASVEVYLAGMSNDPKVWKNPEK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+P+RF+SG E+ D+TG+  +KM+PFG
Sbjct  425  FEPERFMSGEEEVDMTGIKGMKMIPFG  451



>gb|EPS63295.1| hypothetical protein M569_11489, partial [Genlisea aurea]
Length=496

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 178/210 (85%), Gaps = 3/210 (1%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSD---KSAATFSYLDTLFDLTVEGRKSSP  171
            QRK+V +VRK+Q+E ++PLIERRR A+ NPGSD    +AA FSYLDT+FDL +EGRK+ P
Sbjct  231  QRKKVRQVRKKQMEILIPLIERRREAIRNPGSDGSSSAAAAFSYLDTIFDLKIEGRKTYP  290

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTD  351
            ++ E+VTL SEFLNGGTDTTATA+EW IARLIENP +QS+LYEEI++ VG RKV++KD +
Sbjct  291  SDQEIVTLCSEFLNGGTDTTATAVEWGIARLIENPDVQSRLYEEIRTTVGSRKVEDKDIE  350

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
            KMPYLNAVVKELLRKHPPT+F L+HAVT+P +LGGY++P    VEFF  AI++DP +WSD
Sbjct  351  KMPYLNAVVKELLRKHPPTYFVLSHAVTEPARLGGYEVPAGASVEFFSAAIAEDPKVWSD  410

Query  532  PEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            P+KFDPDRF +  EDADITGV  VKMMPFG
Sbjct  411  PQKFDPDRFFADREDADITGVAGVKMMPFG  440



>gb|AFK73721.1| cytochrome P450 [Papaver somniferum]
Length=429

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRK+  +VR+ QI+T+VP IERRR ++ NP  D + A FSYLDTLF+L VEGRKSS +NA
Sbjct  161  QRKKAKQVRENQIKTLVPFIERRRSSIANPELDTTEAKFSYLDTLFELKVEGRKSSMSNA  220

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT+TA+EW IARLI+NP IQ KLYE+IKS VGDR VDEKD   + 
Sbjct  221  ELVTLCSEFLNGGTDTTSTAVEWGIARLIQNPEIQRKLYEDIKSTVGDRVVDEKDIPNLV  280

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YLNA  KELLRKHPPT+F LTH+V +P KL GYDIP   G+EFFL AI++DP  WSDP +
Sbjct  281  YLNAFTKELLRKHPPTYFTLTHSVAEPVKLAGYDIPTYVGLEFFLTAIAEDPKHWSDPVQ  340

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRFLSG EDAD+TG+  VKMMPFG
Sbjct  341  FNPDRFLSGKEDADLTGIRGVKMMPFG  367



>ref|XP_009122576.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=500

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 174/207 (84%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RK  LE+R++ +E +V  IE+RR A++NPGSDK+A++F+YLDTLF+L ++GR+++P++ 
Sbjct  232  ERKLALELRRKLVEFVVGFIEKRRSAIQNPGSDKTASSFAYLDTLFNLKIDGRETTPSDE  291

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            +LVTL SEFLN GTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR VDEKD DKM 
Sbjct  292  DLVTLCSEFLNAGTDTTGTAIEWGIAQLITNPKIQSRLYDEIKSTVGDRTVDEKDLDKMV  351

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKE+LR+HPPT+F LTH VT+PT L GYDIP+   VEF+LP +S+DP +WS P+K
Sbjct  352  FLKAFVKEILRRHPPTYFTLTHGVTEPTTLSGYDIPVGANVEFYLPGMSEDPNIWSKPDK  411

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  412  FDPDRFITGGEDADLTGVAGVKMMPFG  438



>emb|CDX70209.1| BnaA10g25580D [Brassica napus]
Length=500

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 174/207 (84%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RK  LE+R++ +E +V  IE+RR A++NPGSDK+A++F+YLDTLF+L ++GR+++P++ 
Sbjct  232  ERKLALELRRKLVEFVVGFIEKRRSAIQNPGSDKTASSFAYLDTLFNLKIDGRETTPSDE  291

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            +LVTL SEFLN GTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR VDEKD DKM 
Sbjct  292  DLVTLCSEFLNAGTDTTGTAIEWGIAQLITNPKIQSRLYDEIKSTVGDRTVDEKDLDKMV  351

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKE+LR+HPPT+F LTH VT+PT L GYDIP+   VEF+LP +S+DP +WS P+K
Sbjct  352  FLKAFVKEILRRHPPTYFTLTHGVTEPTTLSGYDIPVGANVEFYLPGMSEDPNIWSKPDK  411

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  412  FDPDRFITGGEDADLTGVAGVKMMPFG  438



>ref|XP_004173844.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis 
sativus]
Length=513

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            QRKR +EVR++QIE + P+ + +++AL+NPGSD  A +FSYLDTLFDL V+GRKS+PT+A
Sbjct  245  QRKRAMEVRREQIEFVXPVHQSKKKALQNPGSDNKATSFSYLDTLFDLKVDGRKSTPTDA  304

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGG DTTATAIEW IA LI NP +Q KLYEEIK +VGDRKVDE D  K+P
Sbjct  305  ELVTLCSEFLNGGVDTTATAIEWGIAELITNPNVQKKLYEEIKQLVGDRKVDESDVQKLP  364

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKELLRKHPPT+F+LTH+  + +KLGGYDIPM+  VE +L  +S+DP +W +PEK
Sbjct  365  YLQAVVKELLRKHPPTYFSLTHSGIEASKLGGYDIPMEASVEVYLAGMSNDPKVWKNPEK  424

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+P+RF+SG E+ D+TG+  +KM+PFG
Sbjct  425  FEPERFMSGEEEVDMTGIKGMKMIPFG  451



>ref|XP_002871106.1| CYP77A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47365.1| CYP77A9 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RK+ LE+R++ +E +V  IE+RR A+ NPGSDK+A +F+YLDTLFDL V+GR+++P++ 
Sbjct  237  ERKKALELRRKLVEFVVGFIEKRRSAVRNPGSDKTATSFAYLDTLFDLRVDGRETTPSDE  296

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKM  357
            +LVTL SEFLN GTDTT TAIEW IA LI NP IQS+LY+EIKS VGD R V+EKD DKM
Sbjct  297  DLVTLCSEFLNAGTDTTGTAIEWGIAELISNPEIQSRLYDEIKSTVGDDRTVEEKDLDKM  356

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L A VKELLR+HPPT+F LTH VT+PT L GYDIP+   VEF+LP IS+DP +WS PE
Sbjct  357  VFLQAFVKELLRRHPPTYFTLTHGVTEPTNLSGYDIPVGANVEFYLPGISEDPKIWSKPE  416

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  417  KFDPDRFITGGEDADLTGVAGVKMMPFG  444



>ref|XP_006289766.1| hypothetical protein CARUB_v10003366mg [Capsella rubella]
 gb|EOA22664.1| hypothetical protein CARUB_v10003366mg [Capsella rubella]
Length=511

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR L+VR++Q++ +V  IERRRRA++NPGSD++A++FSYLDTLFDL +EGR+++P+N 
Sbjct  242  ERKRALDVRREQVDYVVGFIERRRRAIKNPGSDETASSFSYLDTLFDLNIEGRETAPSNE  301

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDKM  357
            ELVTL SE LNGGTDTT TAIEW +A+LI NP +QS+LY+EIKS VG DR+V+EKD DKM
Sbjct  302  ELVTLCSELLNGGTDTTGTAIEWGMAQLIANPEMQSRLYDEIKSTVGDDRRVEEKDMDKM  361

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L A VKELLRKHPPT+F+LTHAVT+ T L GYDIP    VE F+P IS+DP +WS+P+
Sbjct  362  VFLQAFVKELLRKHPPTYFSLTHAVTETTTLAGYDIPAGVNVEIFIPGISEDPRIWSNPK  421

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            +FDPDRF+SG E+ADITG + VKM+PFG
Sbjct  422  EFDPDRFISGKEEADITGNSGVKMIPFG  449



>ref|XP_006287416.1| hypothetical protein CARUB_v10000621mg, partial [Capsella rubella]
 gb|EOA20314.1| hypothetical protein CARUB_v10000621mg, partial [Capsella rubella]
Length=553

 Score =   299 bits (765),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RK+ LE+R++ +E +V  IE+RR A+ NPGSD++A++F+YLDTLFDL V+GR+++P++ 
Sbjct  284  ERKKALELRRELVEFVVGFIEKRRSAIRNPGSDETASSFAYLDTLFDLRVDGRETTPSDE  343

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKM  357
            +LVTL SEFLN GTDTT TAIEW IA LI NP IQS+LY EIKS VGD R V+E+D D+M
Sbjct  344  DLVTLCSEFLNAGTDTTGTAIEWGIAELISNPEIQSRLYNEIKSTVGDDRDVEERDLDRM  403

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L A VKELLR+HPPT+F LTH VT+PTKL GYDIP+   VEF+LP IS+DP +WS P 
Sbjct  404  VFLRAFVKELLRRHPPTYFTLTHGVTEPTKLSGYDIPVGANVEFYLPGISEDPKIWSKPG  463

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  464  KFDPDRFITGGEDADLTGVAGVKMMPFG  491



>ref|XP_009130829.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=533

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 172/207 (83%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V LIE+RRRA+ N    K+A +FSYLDTLFDL VEGR+++P+N 
Sbjct  269  ERKRALEVRREQVDLVVSLIEKRRRAIRN----KTAPSFSYLDTLFDLKVEGRETAPSNE  324

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            E+VTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI+S  GDR+++E D DKM 
Sbjct  325  EIVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIRSTAGDRRIEEGDVDKMV  384

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKELLRKHPPT+F+LTHAV + T LGGYD+P    VE ++P IS+DP +WS+P+K
Sbjct  385  FLQAFVKELLRKHPPTYFSLTHAVMETTSLGGYDVPAGVNVEVYIPGISEDPRIWSNPKK  444

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITG++ VKM+PFG
Sbjct  445  FDPDRFISGKEDADITGISGVKMIPFG  471



>emb|CDY11297.1| BnaA03g01330D [Brassica napus]
Length=503

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 172/207 (83%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R+R LEVR++Q++ +V LIE+RRRA+ N    K+A +FSYLDTLFDL VEGR+++P+N 
Sbjct  239  ERRRALEVRREQVDLVVSLIEKRRRAIRN----KTAPSFSYLDTLFDLKVEGRETAPSNE  294

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            E+VTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI+S  GDR+++E D DKM 
Sbjct  295  EIVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIRSTAGDRRIEEGDVDKMV  354

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKELLRKHPPT+F+LTHAV + T LGGYD+P    VE ++P IS+DP +WS+P+K
Sbjct  355  FLQAFVKELLRKHPPTYFSLTHAVMETTSLGGYDVPAGVNVEVYIPGISEDPRIWSNPKK  414

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITG++ VKM+PFG
Sbjct  415  FDPDRFISGKEDADITGISGVKMIPFG  441



>ref|XP_010694692.1| PREDICTED: cytochrome P450 77A2-like [Beta vulgaris subsp. vulgaris]
Length=551

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 168/208 (81%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE-NPGSDKSAATFSYLDTLFDLTVEGRKSSPTN  177
            QRK  LEVRK+QIET+ P IE+RR  +     SD +AA FSYLDTLF+L VEGR S PT 
Sbjct  282  QRKEALEVRKKQIETLRPFIEQRRAIIRAGLASDPTAAPFSYLDTLFELQVEGRISGPTE  341

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             E+VTL SEF+NGGTDTTATAIEWA+ARLIENP +Q +L++EI++ VG R V E D D +
Sbjct  342  PEIVTLCSEFINGGTDTTATAIEWAMARLIENPAMQERLHDEIRAAVGSRPVQEGDLDNL  401

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            PYL+A VKELLRKHPPT+F+LTHAVT+PT LG Y+IP  C VE +LP ISDDP +WS+PE
Sbjct  402  PYLHAFVKELLRKHPPTYFSLTHAVTEPTTLGDYNIPTGCNVEIYLPGISDDPKIWSEPE  461

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDP+RFLSG EDAD+TGV  VKM+PFG
Sbjct  462  KFDPERFLSGREDADMTGVKGVKMIPFG  489



>ref|NP_196083.1| cytochrome P450, family 77, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB85569.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AED90767.1| cytochrome P450, family 77, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=509

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 171/208 (82%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RK  LE+R++ ++ +V  IE+RR A+ N GSDK+A++F+YLDTLFDL V+GR++SP++ 
Sbjct  240  ERKNSLELRRKLVQFVVGFIEKRRLAIRNLGSDKTASSFAYLDTLFDLRVDGRETSPSDE  299

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKM  357
            +LVTL SEFLN GTDTT TAIEW IA LI NP IQS+LY+EIKS VGD R V+EKD +KM
Sbjct  300  DLVTLCSEFLNAGTDTTGTAIEWGIAELISNPKIQSRLYDEIKSTVGDDRTVEEKDLNKM  359

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L A VKELLR+HPPT+F LTH VT+PT L GYDIP+   VEF+LP IS+DP +WS PE
Sbjct  360  VFLQAFVKELLRRHPPTYFTLTHGVTEPTNLAGYDIPVGANVEFYLPGISEDPKIWSKPE  419

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  420  KFDPDRFITGGEDADLTGVAGVKMMPFG  447



>emb|CDX80914.1| BnaC03g01680D [Brassica napus]
Length=503

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 171/207 (83%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RKR LEVR++Q++ +V LIE+RRRA+ N    K+A +FSYLDTLFDL VEGR+++P+N 
Sbjct  239  ERKRALEVRREQVDLVVSLIEKRRRAIRN----KTAPSFSYLDTLFDLKVEGRETAPSNE  294

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            E+VTL SEFLNGGTDTT TAIEW IA+LI NP IQS+LY+EI+S  GDR ++E D DKM 
Sbjct  295  EIVTLCSEFLNGGTDTTGTAIEWGIAQLIANPEIQSRLYDEIRSTAGDRSIEEGDVDKMV  354

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKELLRKHPPT+F+LTHAV + T LGGYD+P    VE ++P IS+DP +WS+P++
Sbjct  355  FLQAFVKELLRKHPPTYFSLTHAVMETTSLGGYDVPAGVNVEVYIPGISEDPRIWSNPKQ  414

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+SG EDADITG++ VKM+PFG
Sbjct  415  FDPDRFISGKEDADITGISGVKMIPFG  441



>ref|XP_002530881.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31487.1| cytochrome P450, putative [Ricinus communis]
Length=482

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   IERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTAT  237
            IE+RRRAL+NPGS   A +FSYLDTLFDL +EGRKSSPT+ ELVTL SEFLNGGTDTTAT
Sbjct  233  IEKRRRALQNPGSTSQAMSFSYLDTLFDLQIEGRKSSPTDPELVTLCSEFLNGGTDTTAT  292

Query  238  AIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVVKELLRKHPPTFFA  417
            A+EW IA+LI+NP +Q KLY EI   VG+RKV+EKD +KM YL AVVKELLRKHPPTFF 
Sbjct  293  AVEWGIAQLIDNPDVQEKLYNEIIKTVGNRKVNEKDVEKMEYLQAVVKELLRKHPPTFFL  352

Query  418  LTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVT  597
            LTHAV++PT LGGYDIP D  +E F  AI  DP +WS+P+KFDPDRF+SG E+ADITGVT
Sbjct  353  LTHAVSEPTTLGGYDIPTDTNIEIFSQAIGQDPKIWSNPKKFDPDRFISGNEEADITGVT  412

Query  598  AVKMMPFG  621
             +KM PFG
Sbjct  413  GIKMTPFG  420



>ref|XP_010940445.1| PREDICTED: cytochrome P450 77A2 [Elaeis guineensis]
Length=524

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 171/208 (82%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSS-PTN  177
            QR+  L+VRK+QIETI+PLIE+R+  L++P  D SAA FSYLD+L DL VEGR ++ P+N
Sbjct  255  QRRHALQVRKEQIETILPLIEKRKAILKDPTIDPSAAPFSYLDSLLDLKVEGRSAAAPSN  314

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             ELVTL SEF+NGGTDTTATAIEWAIARLIE+P  Q++++ EI +  GDR VDE+DT+KM
Sbjct  315  EELVTLCSEFINGGTDTTATAIEWAIARLIEDPSRQARIHGEIIAECGDRPVDERDTEKM  374

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             YL A VKELLRKHPPT+F+LTHA  QP KLGGYDIP +  +E FLP IS+DP  WS+P 
Sbjct  375  VYLQAFVKELLRKHPPTYFSLTHAAIQPAKLGGYDIPTNANLEIFLPTISEDPRFWSNPT  434

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
             F+PDRFL+GGE+AD+TGVT ++M+PFG
Sbjct  435  GFNPDRFLTGGENADMTGVTGIRMIPFG  462



>ref|XP_010110167.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXC25405.1| Cytochrome P450 77A3 [Morus notabilis]
Length=501

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 167/209 (80%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            Q K+ LEVRK+Q + I P I++R+RALENPGSDK+A +FSYLDTLFDL +EGR S PT  
Sbjct  235  QWKKALEVRKEQTDFIYPFIQQRKRALENPGSDKAATSFSYLDTLFDLKIEGRSSVPTKD  294

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG--DRKVDEKDTDK  354
            ELVTL SEFLNGGTDTT TA+EW IA+LI NP +Q KLYEEI++VVG  DRKVDEKD +K
Sbjct  295  ELVTLCSEFLNGGTDTTGTAVEWGIAQLIANPEVQRKLYEEIQNVVGSSDRKVDEKDVEK  354

Query  355  MPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDP  534
            MPYL AVVKELLRKHPPT F+LTHAVT+ TKL GYDIP D  V+ FL  ISDDP +WSDP
Sbjct  355  MPYLEAVVKELLRKHPPTPFSLTHAVTETTKLAGYDIPTDANVDIFLSGISDDPNVWSDP  414

Query  535  EKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            E+FDP+RFL GGE     G   + M+PFG
Sbjct  415  ERFDPNRFL-GGEQG---GGNDMTMLPFG  439



>ref|XP_006407540.1| hypothetical protein EUTSA_v10022031mg [Eutrema salsugineum]
 gb|ESQ48993.1| hypothetical protein EUTSA_v10022031mg [Eutrema salsugineum]
Length=520

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 171/208 (82%), Gaps = 2/208 (1%)
 Frame = +1

Query  4    RKRVLEVRKQQIETIVPLIERRRRALENP-GSDKSAATFSYLDTLFDL-TVEGRKSSPTN  177
            R R LE+R++ +E +V  IE+R++A+ NP GSD++A++FSYLDTLFDL  VEG +++P++
Sbjct  249  RNRALELRRELVEFVVRFIEKRKKAIWNPEGSDETASSFSYLDTLFDLRVVEGSETTPSD  308

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+EIKS VGDR V+EKD DKM
Sbjct  309  EDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDEIKSTVGDRAVEEKDVDKM  368

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L AVVKELLR+HPPT+F L+H VT+PT L GY+IP+   +EF+LP IS+DP +WSDP+
Sbjct  369  VFLQAVVKELLRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNIEFYLPGISEDPKIWSDPK  428

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRF+SG EDADITGV  VKMMPFG
Sbjct  429  KFDPDRFVSGREDADITGVAGVKMMPFG  456



>ref|XP_009414952.1| PREDICTED: cytochrome P450 77A2-like [Musa acuminata subsp. malaccensis]
Length=537

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 171/207 (83%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
             +K+VLE+RK+Q+ET+V LI RRR  L++P  + +AA FSYLD+L DL VEGR ++PT A
Sbjct  269  HQKKVLEIRKEQVETVVSLINRRRSILKDPSLEPNAAPFSYLDSLLDLKVEGRDTAPTEA  328

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEF+NGGTDTT+TAIEWA+AR+I++P IQ+KLY+EI + VGDR VD+++ +KMP
Sbjct  329  ELVTLCSEFINGGTDTTSTAIEWAMARIIDDPNIQAKLYKEIVAEVGDRPVDDRNIEKMP  388

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A VKELLRKHPPT+F+LTHA  +P KLGGYDIP D  +E FL  I++DP LWS+P +
Sbjct  389  YLQAFVKELLRKHPPTYFSLTHAAVEPAKLGGYDIPPDANLELFLLTIAEDPRLWSNPLE  448

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF++GGE ADITG   +KM+PFG
Sbjct  449  FNPDRFITGGETADITGSAGIKMIPFG  475



>gb|KGN52206.1| hypothetical protein Csa_5G615280 [Cucumis sativus]
Length=504

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 165/212 (78%), Gaps = 5/212 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTV-----EGRKS  165
            +R R   VR++Q+E +V LI RRRRALENP SD  A +FSYLDTLFD  +     EG+ S
Sbjct  231  ERNRANLVRRKQVEFVVELINRRRRALENPASDGDATSFSYLDTLFDFKIDGRGGEGKSS  290

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKD  345
            S T+ ELVTL SEFLNGGTDTTAT IEW +A LI N  IQ K+ EEIK  VG+RKV+E+D
Sbjct  291  SATDEELVTLCSEFLNGGTDTTATVIEWGMAELIANEEIQRKIVEEIKETVGERKVEEED  350

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KM YL AVVKE+LRKHPPTFFALTH+VT+ TKL GYDIP D  VEFFLPAI  DP LW
Sbjct  351  VEKMVYLQAVVKEVLRKHPPTFFALTHSVTETTKLAGYDIPNDTNVEFFLPAIGRDPKLW  410

Query  526  SDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
             +P+KF+P+RF SG E+ADITGV+ V+MMPFG
Sbjct  411  KNPDKFEPERFYSGMEEADITGVSGVRMMPFG  442



>ref|XP_009392677.1| PREDICTED: cytochrome P450 77A2-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
             +K+VLE+RK+Q+E +V LI RRR  L++P  + +AA FSYLD+L DL VEGR S+PT  
Sbjct  242  HQKKVLEIRKEQVEAVVALINRRRAILKDPSLEPNAAPFSYLDSLLDLKVEGRDSAPTET  301

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            +LVTL SEF+NGGTDTT+TAIEWA+AR+I++P IQ+ LYEEI + VGDR VD++D +KMP
Sbjct  302  QLVTLCSEFINGGTDTTSTAIEWAMARIIDDPNIQANLYEEIVAEVGDRPVDDRDIEKMP  361

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A VKELLRKHPPT+F+LTHA  +P +LGGYDIP D  +E FLP I++DP LWS P +
Sbjct  362  YLQAFVKELLRKHPPTYFSLTHAAVEPARLGGYDIPPDANLELFLPTIAEDPRLWSSPLE  421

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F+PDRF++GGE ADITG   ++M+PFG
Sbjct  422  FNPDRFITGGETADITGSAGIRMIPFG  448



>ref|XP_008446777.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis 
melo]
Length=503

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 163/211 (77%), Gaps = 4/211 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGR----KSS  168
            +R R   VRK+Q+E +V LI RRRRALENP SD  A  FSYLDTLFD  ++GR     SS
Sbjct  231  ERNRATLVRKKQVEFVVELINRRRRALENPASDGDATPFSYLDTLFDFRIDGRSGGGNSS  290

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDT  348
             T  ELVTL SEFLNGGTDTTAT IEW +A LI N  IQ K+ EEIK  VG+RKV+E+D 
Sbjct  291  ATEEELVTLCSEFLNGGTDTTATVIEWGMAELIANEEIQRKIVEEIKETVGERKVEEEDV  350

Query  349  DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
            +KM YL +VVKE+LRKHPPTFFALTH+VT+ TKL GYDIP D  VEFFLPAI  DP LW 
Sbjct  351  EKMVYLQSVVKEVLRKHPPTFFALTHSVTEATKLAGYDIPKDTNVEFFLPAIGRDPKLWK  410

Query  529  DPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            +P+KF+P+RF SG E+ADITGV+ V+MMPFG
Sbjct  411  NPDKFEPERFYSGMEEADITGVSGVRMMPFG  441



>ref|XP_008775191.1| PREDICTED: cytochrome P450 77A2 [Phoenix dactylifera]
Length=524

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 171/208 (82%), Gaps = 1/208 (0%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSS-PTN  177
            QR+  L+VR++QI+T++PLIE+RR  L++P  D SAA FSYLD+L DL V+GR ++ P+ 
Sbjct  255  QRRHALQVRREQIDTVLPLIEKRRAILKDPRVDPSAAPFSYLDSLLDLKVDGRSAAAPSE  314

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             ELVTL SEF+NGGTDTTATAIEW IARLIE+P  Q+++++EI +V GDR VDE+DT+KM
Sbjct  315  EELVTLCSEFINGGTDTTATAIEWGIARLIEDPSRQARIHDEILAVCGDRPVDERDTEKM  374

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             YL A VKELLRKHPPT+F+LTHA  QP KLGGYDIP +  ++ FLP I++DP  WS+P 
Sbjct  375  VYLQAFVKELLRKHPPTYFSLTHAAIQPAKLGGYDIPTNANLDIFLPTIAEDPRFWSNPT  434

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            +F+PDRFL+GGE AD+TGVT ++M+PFG
Sbjct  435  EFNPDRFLTGGEIADMTGVTGIRMIPFG  462



>emb|CDY44872.1| BnaC09g50720D [Brassica napus]
Length=496

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 168/207 (81%), Gaps = 4/207 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +RK  LE+R++ +E +V  IE+RR A++NP    +A++F+YLDTLF+L ++GR+++P++ 
Sbjct  232  ERKLALELRRKLVEFVVGFIEKRRSAIQNP----TASSFAYLDTLFNLKIDGRETTPSDE  287

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            +LVTL SEFLN GTDTT TAIEW IA+LI NP IQS+LY+EIKS VGDR VDEKD D M 
Sbjct  288  DLVTLCSEFLNAGTDTTGTAIEWGIAQLITNPKIQSRLYDEIKSTVGDRTVDEKDLDTMV  347

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            +L A VKE+LR+HPPT+F L+H VT+PT L GYDIP+   VEF+LP +S+DP +W  P+K
Sbjct  348  FLKAFVKEILRRHPPTYFTLSHGVTEPTTLSGYDIPVGANVEFYLPGMSEDPNIWFKPDK  407

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF++GGEDAD+TGV  VKMMPFG
Sbjct  408  FDPDRFITGGEDADLTGVAGVKMMPFG  434



>ref|XP_010490979.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=508

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 161/196 (82%), Gaps = 1/196 (1%)
 Frame = +1

Query  37   IETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNG  216
            +E +V  IE+RR A+ NPGSD++A++F+YLDTLFDL V GR+++P++ +LVTL SEFLN 
Sbjct  251  VEFVVRFIEKRRSAILNPGSDETASSFAYLDTLFDLKVHGRETTPSDEDLVTLCSEFLNA  310

Query  217  GTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLR  393
            GTDTT TAIEW +A LI NP IQS+LY+EIKS VGD R V+EKD DK+ +L A VKELLR
Sbjct  311  GTDTTGTAIEWGVAELISNPEIQSRLYDEIKSTVGDDRSVEEKDLDKLVFLRAFVKELLR  370

Query  394  KHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE  573
            +HPPT+F LTH VT+PT L GYDIP+   VEF+LP IS+DP +W  P+KFDPDRF++GGE
Sbjct  371  RHPPTYFTLTHGVTEPTNLSGYDIPVGANVEFYLPGISEDPKIWFKPDKFDPDRFITGGE  430

Query  574  DADITGVTAVKMMPFG  621
            DAD+TGV  VKMMPFG
Sbjct  431  DADLTGVAGVKMMPFG  446



>dbj|BAF02252.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=298

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 164/208 (79%), Gaps = 5/208 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDL-TVEGRKSSPTN  177
            +R R L++R++ ++ +V  IE+RR+A+       + ++FSYLDTLFDL  +EG +++P++
Sbjct  32   ERNRALKLRRELVDFVVGFIEKRRKAIRT----ATVSSFSYLDTLFDLRIIEGSETTPSD  87

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+EIKS VGDR VDE+D DKM
Sbjct  88   EDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDEIKSTVGDRAVDERDVDKM  147

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
              L AVVKE+LR+HPPT+F L+H VT+PT L GY+IP+   +EF+LP IS+DP +WS+P+
Sbjct  148  VLLQAVVKEILRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNIEFYLPGISEDPKIWSEPK  207

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRFLSG EDADITGV  VKMMPFG
Sbjct  208  KFDPDRFLSGREDADITGVAGVKMMPFG  235



>ref|XP_010423555.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=508

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 160/196 (82%), Gaps = 1/196 (1%)
 Frame = +1

Query  37   IETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNG  216
            +E +V  IE+RR A+ NPGSD++A++F+YLDTLFDL V GR+++P++ +LVTL SEFLN 
Sbjct  251  VEFVVGFIEKRRSAILNPGSDETASSFAYLDTLFDLKVHGRETTPSDEDLVTLCSEFLNA  310

Query  217  GTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLR  393
            GTDTT TAIEW +A LI  P IQ++LY+EIKS VGD R V+EKD DK+ +L A VKELLR
Sbjct  311  GTDTTGTAIEWGVAELISFPEIQTRLYDEIKSTVGDDRNVEEKDLDKLVFLRAFVKELLR  370

Query  394  KHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGE  573
            +HPPT+F LTH VT+PT L GYDIP+   VEF+LP IS+DP +W  P+KFDPDRF++GGE
Sbjct  371  RHPPTYFTLTHGVTEPTNLSGYDIPVGANVEFYLPGISEDPKIWFKPDKFDPDRFITGGE  430

Query  574  DADITGVTAVKMMPFG  621
            DAD+TGV  VKMMPFG
Sbjct  431  DADLTGVAGVKMMPFG  446



>gb|KFK24906.1| hypothetical protein AALP_AA8G040400 [Arabis alpina]
Length=420

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 164/207 (79%), Gaps = 9/207 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNA  180
            +R++ L+VR++QI+ +V +IE+R         +K+   FSYLDTL DL +EGR+++P+N 
Sbjct  161  ERRKALQVRREQIDYVVGIIEKR---------NKTTTFFSYLDTLLDLKIEGRETTPSNE  211

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMP  360
            ELVTL SEFLNGGTDTT TAIEW IA +I NP IQ ++Y+EI+S+VGDR+++E D ++M 
Sbjct  212  ELVTLCSEFLNGGTDTTGTAIEWGIAEMIANPEIQCRIYDEIRSIVGDRRIEEGDVERMV  271

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A VKELLRKHPPT+F+LTHAV + T LGGYDIP+   VE F+P I++DP +W +P+K
Sbjct  272  YLQAFVKELLRKHPPTYFSLTHAVMETTTLGGYDIPVGVNVEVFIPGINEDPKIWVNPKK  331

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            FDPDRF+ G EDADITG++ VKM+PFG
Sbjct  332  FDPDRFMLGKEDADITGISGVKMIPFG  358



>ref|NP_187667.1| cytochrome P450 protein UNE9 [Arabidopsis thaliana]
 gb|AAG51393.1|AC011560_25 putative cytochrome P450; 47418-45874 [Arabidopsis thaliana]
 gb|AAF76358.1| cytochrome P450, putative [Arabidopsis thaliana]
 gb|AEE74925.1| cytochrome P450 protein UNE9 [Arabidopsis thaliana]
Length=514

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 164/208 (79%), Gaps = 5/208 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDL-TVEGRKSSPTN  177
            +R R L++R++ ++ +V  IE+RR+A+       + ++FSYLDTLFDL  +EG +++P++
Sbjct  248  ERNRALKLRRELVDFVVGFIEKRRKAIRT----ATVSSFSYLDTLFDLRIIEGSETTPSD  303

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+EIKS VGDR VDE+D DKM
Sbjct  304  EDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDEIKSTVGDRAVDERDVDKM  363

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
              L AVVKE+LR+HPPT+F L+H VT+PT L GY+IP+   +EF+LP IS+DP +WS+P+
Sbjct  364  VLLQAVVKEILRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNIEFYLPGISEDPKIWSEPK  423

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRFLSG EDADITGV  VKMMPFG
Sbjct  424  KFDPDRFLSGREDADITGVAGVKMMPFG  451



>ref|XP_002882682.1| CYP77A7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58941.1| CYP77A7 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDL-TVEGRKSSPTN  177
            +R R L++R++ ++ +V  IE+RRR +      ++A++FSYLDTLFDL  VEG +++P++
Sbjct  247  ERDRALKLRRELVDFVVKFIEKRRRVI----LIETASSFSYLDTLFDLRVVEGSETTPSD  302

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKM  357
             +LVTL SEFLN GTDTT  AIEW IA LI NP IQS+LY+EIK  VGDR VDE+D +KM
Sbjct  303  EDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDEIKLTVGDRAVDERDVEKM  362

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
             +L AVVKE+LR+HPPT+F L+H VT+PT L GY+IP+   +EF+LP IS+DP +WS+P+
Sbjct  363  VFLQAVVKEILRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNIEFYLPGISEDPKIWSEPK  422

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            KFDPDRFLSG EDADITGV  VKMMPFG
Sbjct  423  KFDPDRFLSGREDADITGVAGVKMMPFG  450



>ref|XP_002446399.1| hypothetical protein SORBIDRAFT_06g015320 [Sorghum bicolor]
 gb|EES10727.1| hypothetical protein SORBIDRAFT_06g015320 [Sorghum bicolor]
Length=544

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 164/219 (75%), Gaps = 12/219 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKS----------AATFSYLDTLFDLTV  150
             ++R L VR++QI+T++PLI RRR  L +     S          AA FSYLD++ DL +
Sbjct  261  HQRRALAVRREQIDTLLPLISRRRAILRDMQQRSSSPSPPPDPNVAAPFSYLDSVLDLHI  320

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-R  327
            EGR  +PT+ ELVTL +E +NGGTDTTATAIEW +AR+++NP IQ++L+EEI   VGD R
Sbjct  321  EGRDGAPTDDELVTLCAELINGGTDTTATAIEWGMARIVDNPSIQARLHEEIMQQVGDAR  380

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAI  504
             VD+KDTD MPYL A VKELLRKHPPT+F+LTHA  QP +KL GYD+P+D  ++ FLPAI
Sbjct  381  PVDDKDTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGSKLAGYDVPVDANLDIFLPAI  440

Query  505  SDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            S+DP LW  P +FDPDRFLSGGE AD+TG   ++M+PFG
Sbjct  441  SEDPKLWDRPTEFDPDRFLSGGETADMTGSGGIRMIPFG  479



>gb|AGT16500.1| hypothetical protein SHCRBa_022_D13_R_80 [Saccharum hybrid cultivar 
R570]
Length=542

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 162/214 (76%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALEN-----PGSDKSAATFSYLDTLFDLTVEGRKS  165
             ++R L VR++Q++T++PLI RRR  L +     P     AA FSYLD++ DL +EGR  
Sbjct  265  HQRRALAVRREQVDTLLPLISRRRAILRDMKSSSPPDPNVAAPFSYLDSVLDLHIEGRDG  324

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEK  342
            +PT+ ELVTL +E +NGGTDTTATAIEW +AR+++NP IQ++L+EEI   VGD R VD+K
Sbjct  325  APTDDELVTLCAELINGGTDTTATAIEWGLARIVDNPSIQARLHEEIMHQVGDARPVDDK  384

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAISDDPT  519
            DTD MPYL A VKELLRKHPPT+F+LTHA  QP +KL GYD+P+D  ++ FLP IS+DP 
Sbjct  385  DTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGSKLAGYDVPVDANLDIFLPTISEDPK  444

Query  520  LWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            LW  P +FDPDRF+SGGE  D+TG   ++M+PFG
Sbjct  445  LWDRPTEFDPDRFVSGGEMGDMTGSGGIRMIPFG  478



>gb|AGT16905.1| cytochrome P450 [Saccharum hybrid cultivar R570]
Length=543

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 162/214 (76%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALEN-----PGSDKSAATFSYLDTLFDLTVEGRKS  165
             ++R L VR++Q++T++PLI RRR  L +     P     AA FSYLD++ DL +EGR  
Sbjct  265  HQRRALAVRREQVDTLLPLISRRRAILRDMKSSSPPDPNVAAPFSYLDSVLDLHIEGRDG  324

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEK  342
            +PT+ ELVTL +E +NGGTDTTATAIEW +AR+++NP IQ++L+EEI   VGD R VD+K
Sbjct  325  TPTDDELVTLCAELINGGTDTTATAIEWGMARIVDNPSIQARLHEEIMQQVGDARPVDDK  384

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAISDDPT  519
            DTD MPYL A VKELLRKHPPT+F+LTHA  QP +KL GYD+P+D  ++ FLP IS+DP 
Sbjct  385  DTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGSKLAGYDVPVDANLDIFLPTISEDPK  444

Query  520  LWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            LW  P +FDPDRF+SGGE  D+TG   ++M+PFG
Sbjct  445  LWDRPTEFDPDRFVSGGEMGDMTGSGGIRMIPFG  478



>ref|XP_003581190.2| PREDICTED: cytochrome P450 77A4-like [Brachypodium distachyon]
Length=523

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 159/208 (76%), Gaps = 6/208 (3%)
 Frame = +1

Query  16   LEVRKQQIETIVPLIERRRRALEN----PGSDKSAATFSYLDTLFDLTVEGRKSSPTNAE  183
            L+VR++Q++T++PLI RRR  L +    P     AA FSYLD+L DL +EGR    ++ E
Sbjct  251  LDVRREQVDTLLPLINRRRAILRDRDTRPADPDVAAPFSYLDSLLDLRIEGRDGVASDDE  310

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTDKMP  360
            LVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+EEI   VGD R VDEKDTD MP
Sbjct  311  LVTLCAELINGGTDTTATAIEWAMARIVDNPSIQARLHEEIMQQVGDTRPVDEKDTDGMP  370

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            YL A VKELLRKHPPT+F+LTHA  +P +KL GYD+P D  ++ FLP IS+DP LW  P 
Sbjct  371  YLQAFVKELLRKHPPTYFSLTHAAVKPGSKLAGYDVPADANLDIFLPGISEDPKLWDRPA  430

Query  538  KFDPDRFLSGGEDADITGVTAVKMMPFG  621
            +FDPDRFLSGGE AD+TG   ++M+PFG
Sbjct  431  EFDPDRFLSGGETADMTGSAGIRMIPFG  458



>emb|CAH66495.1| H0321H01.4 [Oryza sativa Indica Group]
 emb|CAH66519.1| OSIGBa0142C11.7 [Oryza sativa Indica Group]
Length=528

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 162/213 (76%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE-----NPGSDKSAATFSYLDTLFDLTVEGRKS  165
            Q ++ + +R++QI+T++PLI RRR  +      +P     AA +SYLD+L DL VEGR +
Sbjct  250  QHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYSYLDSLLDLRVEGRDA  309

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEK  342
             PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+ EI   VGD R VD++
Sbjct  310  VPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHGEIMQRVGDARPVDDR  369

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAISDDPT  519
            DTD MPYL A VKELLRKHPPT+FAL+HA  +P +KL GYD+P+D  ++ FLP IS+DP 
Sbjct  370  DTDGMPYLQAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVDANLDIFLPTISEDPK  429

Query  520  LWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  618
            LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  430  LWERPTEFDPDRFLAGGETADITGSAGVRMIPF  462



>ref|NP_001052719.1| Os04g0407900 [Oryza sativa Japonica Group]
 dbj|BAF14633.1| Os04g0407900, partial [Oryza sativa Japonica Group]
Length=467

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 162/213 (76%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE-----NPGSDKSAATFSYLDTLFDLTVEGRKS  165
            Q ++ + +R++QI+T++PLI RRR  +      +P     AA +SYLD+L DL VEGR +
Sbjct  189  QHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYSYLDSLLDLRVEGRDA  248

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEK  342
             PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+ EI   VGD R VD++
Sbjct  249  VPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHGEIMQRVGDARPVDDR  308

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAISDDPT  519
            DT+ MPYL A VKELLRKHPPT+FAL+HA  +P +KL GYD+P+D  ++ FLP IS+DP 
Sbjct  309  DTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVDANLDIFLPTISEDPK  368

Query  520  LWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  618
            LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  369  LWERPTEFDPDRFLAGGETADITGSAGVRMIPF  401



>ref|XP_006652247.1| PREDICTED: cytochrome P450 77A4-like [Oryza brachyantha]
Length=442

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 162/214 (76%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALEN-----PGSDKSAATFSYLDTLFDLTVEGRKS  165
            Q ++ + +R++QI+T++PLI RRR  + +     P     AA +SYLD+L DL VEGR +
Sbjct  164  QHRQAVALRREQIDTVLPLINRRRAIVRDMKAGSPPDPSVAAPYSYLDSLLDLRVEGRDA  223

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEK  342
             PT+ ELVTL +E +NGGTDTTAT IEWA+AR+++NP IQ++L++EI   VGD R V++K
Sbjct  224  VPTDEELVTLCAEMINGGTDTTATGIEWAMARVMDNPSIQARLHDEIMQHVGDARPVEDK  283

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAISDDPT  519
            DT+ MPYL A VKELLRKHPPT+FAL+HA  +P +K+ GYDIP+D  ++ FLP IS+DP 
Sbjct  284  DTEGMPYLQAFVKELLRKHPPTYFALSHAAIEPGSKIAGYDIPVDANLDIFLPTISEDPK  343

Query  520  LWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            LW  P +FDPDRFL+GGE ADITG   V+M+PF 
Sbjct  344  LWDRPTEFDPDRFLTGGETADITGSAGVRMIPFS  377



>emb|CAE04891.3| OSJNBa0042I15.13 [Oryza sativa Japonica Group]
Length=520

 Score =   256 bits (655),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 162/213 (76%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE-----NPGSDKSAATFSYLDTLFDLTVEGRKS  165
            Q ++ + +R++QI+T++PLI RRR  +      +P     AA +SYLD+L DL VEGR +
Sbjct  242  QHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYSYLDSLLDLRVEGRDA  301

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEK  342
             PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L+ EI   VGD R VD++
Sbjct  302  VPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHGEIMQRVGDARPVDDR  361

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAISDDPT  519
            DT+ MPYL A VKELLRKHPPT+FAL+HA  +P +KL GYD+P+D  ++ FLP IS+DP 
Sbjct  362  DTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVDANLDIFLPTISEDPK  421

Query  520  LWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  618
            LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  422  LWERPTEFDPDRFLAGGETADITGSAGVRMIPF  454



>gb|ABC68410.1| cytochrome P450 monooxygenase CYP77A3v2 [Glycine max]
Length=219

 Score =   244 bits (624),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +1

Query  175  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDK  354
            +AELV+L SEFLNGGTDTTATA+EW IA+LI NP +Q KLYEEIK  VG++KVDEKD +K
Sbjct  1    DAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPHVQKKLYEEIKRTVGEKKVDEKDVEK  60

Query  355  MPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDP  534
            MPYL+AVVKELLRKHPPT F LTHAVT+PT LGGYDIP+D  VE + PAI+ DP  WS+P
Sbjct  61   MPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDASVEVYTPAIAGDPKNWSNP  120

Query  535  EKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            EKFDP+RF+SGGE+ADITGVT VKMMPFG
Sbjct  121  EKFDPERFISGGEEADITGVTGVKMMPFG  149



>ref|NP_001132177.1| uncharacterized protein LOC100193602 [Zea mays]
 gb|ACF80918.1| unknown [Zea mays]
Length=545

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 161/219 (74%), Gaps = 12/219 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKS---------AATFSYLDTLFDLTVE  153
             ++R L VR++QI+T++PLI RRR  L +    +S         AA FSYLD++ DL +E
Sbjct  262  HQRRALAVRREQIDTLLPLINRRRAMLRDMQQRQSSSPPPDPSVAAPFSYLDSVLDLRIE  321

Query  154  GRK-SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-R  327
            GR   + T+ ELVTL +E LNGGTDTTATAIEW +AR++++P IQ++L+EE+   VGD R
Sbjct  322  GRDDGALTDDELVTLCAELLNGGTDTTATAIEWGMARIVDSPSIQARLHEEVMQQVGDAR  381

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAI  504
             VD+KDTD MPYL   VKELLRKHPPT+F+LTHA  QP  KL GYD+P+D  ++ FLP I
Sbjct  382  PVDDKDTDAMPYLQTFVKELLRKHPPTYFSLTHAAVQPGCKLAGYDVPVDANLDIFLPTI  441

Query  505  SDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            S+DP LW  P +FDPDRF+SGGE AD+TG   ++M+PFG
Sbjct  442  SEDPKLWDRPTEFDPDRFVSGGETADMTGSAGIRMIPFG  480



>tpg|DAA37962.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=612

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 162/219 (74%), Gaps = 12/219 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKS---------AATFSYLDTLFDLTVE  153
             ++R L VR++QI+T++PLI RRR  L +    +S         AA FSYLD++ DL +E
Sbjct  329  HQRRALAVRREQIDTLLPLINRRRAMLRDMQQRQSSSPPPDPSVAAPFSYLDSVLDLRIE  388

Query  154  GRK-SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-R  327
            GR   + T+ ELVTL +E LNGGTDTTATAIEW +AR++++P IQ++L+EE+   VGD R
Sbjct  389  GRDDGALTDDELVTLCAELLNGGTDTTATAIEWGMARIVDSPSIQARLHEEVMQQVGDAR  448

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIPMDCGVEFFLPAI  504
             VD+KDTD MPYL A VKELLRKHPPT+F+LTHA  QP  KL GYD+P+D  ++ FLP I
Sbjct  449  PVDDKDTDAMPYLQAFVKELLRKHPPTYFSLTHAAVQPGCKLAGYDVPVDANLDIFLPTI  508

Query  505  SDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            S+DP LW  P +FDPDRF+SGGE AD+TG   ++M+PFG
Sbjct  509  SEDPKLWDRPTEFDPDRFVSGGETADMTGSAGIRMIPFG  547



>gb|EAZ30650.1| hypothetical protein OsJ_14702 [Oryza sativa Japonica Group]
Length=521

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  115  FSYLDTLFDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKL  294
            +SYLD+L DL VEGR + PT+ ELVTL +E +NGGTDTTATAIEWA+AR+++NP IQ++L
Sbjct  286  YSYLDSLLDLRVEGRDAVPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARL  345

Query  295  YEEIKSVVGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQP-TKLGGYDIP  468
            + EI   VGD R VD++DT+ MPYL A VKELLRKHPPT+FAL+HA  +P +KL GYD+P
Sbjct  346  HGEIMQRVGDARPVDDRDTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVP  405

Query  469  MDCGVEFFLPAISDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPF  618
            +D  ++ FLP IS+DP LW  P +FDPDRFL+GGE ADITG   V+M+PF
Sbjct  406  VDANLDIFLPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVRMIPF  455



>gb|ABR16500.1| unknown [Picea sitchensis]
Length=327

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 142/210 (68%), Gaps = 3/210 (1%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAA---TFSYLDTLFDLTVEGRKSSP  171
            Q KR+ E+R+ Q+++I+PL+  RR  L+     ++ +     +Y+D+L +L +   +  P
Sbjct  49   QWKRIKELRRIQMDSILPLVNTRRAVLKAGAHTQAGSPDGAHAYIDSLMNLELPEGRGKP  108

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTD  351
            T+ ELVTL SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD +
Sbjct  109  TDEELVTLCSELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIE  168

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
             +PYLNAVVKE LR+HPP  F L+HAVTQ  +L GYDIP    VEF+   +S DP +W D
Sbjct  169  NLPYLNAVVKETLRRHPPGHFVLSHAVTQDCQLRGYDIPYKANVEFYTAWMSFDPKIWPD  228

Query  532  PEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            P  F+P RFL  G + DITG   VKMMPFG
Sbjct  229  PMTFNPRRFLDPGNEVDITGNKQVKMMPFG  258



>ref|XP_006851629.1| hypothetical protein AMTR_s00040p00200250 [Amborella trichopoda]
 gb|ERN13159.1| hypothetical protein AMTR_s00040p00200250 [Amborella trichopoda]
Length=496

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 148/204 (73%), Gaps = 9/204 (4%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLV  198
             VRK+Q+ET++PLI  R++ ++N  S + A    Y+D+LFDL +   +  P+   LVTL 
Sbjct  236  HVRKEQLETLLPLIRSRKKTIQNAMSAEPA----YIDSLFDLDMG--QGPPSEDMLVTLC  289

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            +EFLNGGTDTTATA+EWA+A L+ +  IQ+++  EI  V  D +V+++D +KM YL A V
Sbjct  290  AEFLNGGTDTTATAVEWAMAHLVADSEIQTRVRAEIDRVSPDHRVNDEDVEKMEYLQAFV  349

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
            KE LRKHPPT+F LTHAVT+ + LGGYDIP    V+F+ P+ISDDP LW DPE+F P+RF
Sbjct  350  KETLRKHPPTYFLLTHAVTEKSTLGGYDIPEGVNVDFYTPSISDDPKLWGDPERFRPERF  409

Query  559  L---SGGEDADITGVTAVKMMPFG  621
            +    G +DAD+TGV  VKMMPFG
Sbjct  410  VDKMDGDDDADLTGVKGVKMMPFG  433



>ref|XP_009803416.1| PREDICTED: cytochrome P450 77A3 [Nicotiana sylvestris]
Length=510

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 149/216 (69%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q K+  ++R+ Q+E +VPL+  R+  +E+ G+ KS+++        +Y+D+LF L + GR
Sbjct  234  QVKQAKKLRQTQLEYLVPLVRDRKAFVESNGNPKSSSSEMVSPIGAAYVDSLFSLEIPGR  293

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-VD  336
            K     AE++TLVSE +  GTDT+ATA+EWA+  L+ +  IQ KLY+EI   VG    + 
Sbjct  294  KLG--EAEIITLVSETIGAGTDTSATALEWALLHLVMDQEIQEKLYKEIVDCVGKHGDIS  351

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +KMPYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP D  VEF+   +++DP
Sbjct  352  ESDVEKMPYLGAIVKETFRRHPPSHFVLSHSVTNDTQLGGYNIPSDAYVEFYTAWVTEDP  411

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            +LW DP +F P+RFL+G G D DITG+  VKM+PFG
Sbjct  412  SLWKDPGEFRPERFLTGDGVDVDITGMRGVKMLPFG  447



>ref|XP_007204450.1| hypothetical protein PRUPE_ppa026370mg [Prunus persica]
 gb|EMJ05649.1| hypothetical protein PRUPE_ppa026370mg [Prunus persica]
Length=516

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 138/212 (65%), Gaps = 5/212 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE-NPGSDKSAAT---FSYLDTLFDLTVEGRKSS  168
            Q +   E+R++Q+E +VPLI  R+  ++ N  SD +  +    +Y+D+LF+L V GR   
Sbjct  238  QVREAKELRRRQMECLVPLIRNRKTFVQANQSSDGNMVSPKGAAYIDSLFELEVPGRAQR  297

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDT  348
                ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ KLY EI   VG  +V E D 
Sbjct  298  LGEEELVTLCSEVINAGTDTSATTLEWALLHLVMNQEIQQKLYNEIVDCVGKEEVTESDV  357

Query  349  DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
            +KM YL+AVVKE  R+HPP+ F L+HA  + T LGGY +P D  VEF+   +++DP LW 
Sbjct  358  EKMSYLSAVVKETFRRHPPSHFVLSHAAVKETVLGGYTVPADASVEFYTAWVTEDPNLWE  417

Query  529  DPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            DP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  418  DPGEFRPERFLEGDGVDVDVTGTKGVKMVPFG  449



>ref|XP_009612631.1| PREDICTED: cytochrome P450 77A1 [Nicotiana tomentosiformis]
Length=510

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 149/216 (69%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q K+  ++R+ Q+E +VPL+  R+  +E+ G+ KS+++        +Y+D+LF L + GR
Sbjct  234  QVKQAKKLRQTQLEYLVPLVRDRKAFVESNGNPKSSSSEMVSPVGAAYVDSLFSLELPGR  293

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-VD  336
            K     AE++TLVSE +  GTDT+ATA+EWA+  L+ +  IQ KLY+EI   VG    + 
Sbjct  294  KLG--EAEIITLVSETIGAGTDTSATALEWALLHLVMDQEIQEKLYKEIVDCVGKHGDIS  351

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +KMPYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP D  VEF+   +++DP
Sbjct  352  ESDVEKMPYLGAIVKETFRRHPPSHFVLSHSVTNDTQLGGYNIPSDAYVEFYTAWVTEDP  411

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            +LW DP +F P+RFL+G G D DITG+  VKM+PFG
Sbjct  412  SLWKDPGEFRPERFLTGDGVDVDITGMRGVKMLPFG  447



>ref|XP_008439972.1| PREDICTED: cytochrome P450 77A1 [Cucumis melo]
Length=513

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 142/218 (65%), Gaps = 12/218 (6%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------SAATFSYLDTLFDLTVE  153
            Q K+  E+R++Q+E ++PLI +RR  +E  G +          S    +YLD+LF+L   
Sbjct  234  QLKQAKELRRKQLECLIPLIRKRRMFVERNGDESVREELPEMVSPIGAAYLDSLFELETP  293

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRK  330
            GR       ELVTL SE +N GTDT+ATA+EWA+  L+++  +Q +LY EI +VVG D +
Sbjct  294  GR-GRLGEEELVTLCSEVINAGTDTSATALEWALLHLVQDQDVQERLYNEIINVVGKDGR  352

Query  331  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
            + E D +KMPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY IP D  VEF+   +SD
Sbjct  353  ITEGDIEKMPYLGAVVKETFRRHPPSHFLLSHAATKETELGGYTIPADASVEFYTAHLSD  412

Query  511  DPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            DP  W +P  F PDRFL G G   D+TG  AVKM+PFG
Sbjct  413  DPNTWEEPGSFRPDRFLEGDGVGVDVTGTKAVKMVPFG  450



>ref|XP_007153928.1| hypothetical protein PHAVU_003G076900g [Phaseolus vulgaris]
 gb|ESW25922.1| hypothetical protein PHAVU_003G076900g [Phaseolus vulgaris]
Length=510

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 141/212 (67%), Gaps = 6/212 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT---FSYLDTLFDLTVEGRKSSP  171
            Q K   E+RK+Q+E + PLI  R+  +E   S    A+    +Y+D+LF+L V GR    
Sbjct  238  QVKEARELRKRQVELLAPLIRSRKAYVEGSFSGSEMASPVGAAYVDSLFELEVPGR-GRL  296

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKDT  348
               ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +LY+EI   VG   V  E D 
Sbjct  297  GEEELVTLVSEIISAGTDTSATAVEWALFHLVTDQEIQERLYKEIVECVGKEGVVKESDV  356

Query  349  DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
            ++MPYL+AVVKE  R+HPP+ F L+HA T+ TKLGGY +P +  VEF+   +S+DP +W 
Sbjct  357  ERMPYLSAVVKETFRRHPPSHFVLSHAATEDTKLGGYTVPKNASVEFYTAWLSEDPNMWE  416

Query  529  DPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            DP +F P+RFLSG G D D+TG   V+MMPFG
Sbjct  417  DPNEFRPERFLSGDGVDVDVTGTKGVRMMPFG  448



>ref|XP_006858061.1| hypothetical protein AMTR_s00062p00048540 [Amborella trichopoda]
 gb|ERN19528.1| hypothetical protein AMTR_s00062p00048540 [Amborella trichopoda]
Length=518

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 139/212 (66%), Gaps = 7/212 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT---FSYLDTLFDLTVEGRKSSP  171
            Q K   E+RK Q+E +VPLIERR+ A  N G D    +    +Y+D+LFDL VEGR    
Sbjct  249  QLKFARELRKTQMECLVPLIERRQ-AFLNGGEDSDMVSPKGAAYIDSLFDLEVEGR-GKL  306

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDT  348
             + ELV+LVSE +N GTDT+AT IEWA   L+ +  +Q KLY EI  VVG D  + E   
Sbjct  307  GHEELVSLVSEIINAGTDTSATTIEWATLHLVLDQKLQEKLYREIIEVVGKDGAITESGV  366

Query  349  DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
            +KM YL A+VKE  R+HPP+ F L+HA  + T L GY +P D  VEF+   +S+DP +W 
Sbjct  367  EKMVYLGAIVKETFRRHPPSHFVLSHAAIKDTTLAGYRVPSDASVEFYTAWLSEDPNMWE  426

Query  529  DPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            DP++F P+RFL G G+D DITG   VKMMPFG
Sbjct  427  DPKEFRPERFLVGDGKDVDITGSRHVKMMPFG  458



>ref|XP_003528678.1| PREDICTED: cytochrome P450 77A1-like [Glycine max]
Length=504

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 140/210 (67%), Gaps = 4/210 (2%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSD-KSAATFSYLDTLFDLTVEGRKSSPTN  177
            Q K   E+R++Q+E + PLI  R+  +E   SD  S    +Y+D+LF L V GR      
Sbjct  234  QVKEAEELRRRQVELLAPLIRSRKAYVEGNNSDMASPVGAAYVDSLFGLEVPGR-GRLGE  292

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTDK  354
             ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +LY EI   VG D  V E   +K
Sbjct  293  EELVTLVSEIISAGTDTSATALEWALLHLVMDQEIQERLYREIVGCVGKDGVVTESHVEK  352

Query  355  MPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDP  534
            MPYL+AVVKE  R+HPP+ F L+HA T+ TKLGGY +P +  VEF+   +++DP++W DP
Sbjct  353  MPYLSAVVKETFRRHPPSHFVLSHAATEETKLGGYTVPKEASVEFYTAWLTEDPSMWEDP  412

Query  535  EKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             +F P+RF+SG G D D+TG   V+MMPFG
Sbjct  413  NEFRPERFMSGDGVDVDVTGTKGVRMMPFG  442



>ref|XP_004134754.1| PREDICTED: cytochrome P450 77A1-like [Cucumis sativus]
 gb|KGN49124.1| hypothetical protein Csa_6G514850 [Cucumis sativus]
Length=513

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 141/218 (65%), Gaps = 12/218 (6%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------SAATFSYLDTLFDLTVE  153
            Q K+  E+R++Q+E ++PLI +RR  +E  G +          S    +YLD+LF+L   
Sbjct  234  QLKQAKELRRKQLECLIPLIRKRRMFMERNGDESVRKELPEMVSPMGAAYLDSLFELETP  293

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRK  330
            GR       ELVTL SE +N GTDT+ATA+EWA+  L+++  +Q +LY EI +VVG D  
Sbjct  294  GR-GRLGEEELVTLCSEVINAGTDTSATALEWALLHLVQDQDVQERLYNEIINVVGKDGL  352

Query  331  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
            + E D +KMPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY IP D  VEF+   +++
Sbjct  353  ITEGDIEKMPYLGAVVKETFRRHPPSHFLLSHAATKETELGGYTIPADASVEFYTAHLTE  412

Query  511  DPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            DP  W +P  F PDRFL G G   D+TG  AVKM+PFG
Sbjct  413  DPNTWEEPGSFRPDRFLEGDGVGVDVTGTKAVKMVPFG  450



>ref|XP_004155597.1| PREDICTED: cytochrome P450 77A1-like [Cucumis sativus]
Length=513

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 141/218 (65%), Gaps = 12/218 (6%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------SAATFSYLDTLFDLTVE  153
            Q K+  E+R++Q+E ++PLI +RR  +E  G +          S    +YLD+LF+L   
Sbjct  234  QLKQAKELRRKQLECLIPLIRKRRMFMERNGDESVRKELPEMVSPMGAAYLDSLFELETP  293

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRK  330
            GR       ELVTL SE +N GTDT+ATA+EWA+  L+++  +Q +LY EI +VVG D  
Sbjct  294  GR-GRLGEEELVTLCSEVINAGTDTSATALEWALLHLVQDQDVQERLYNEIINVVGKDGL  352

Query  331  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
            + E D +KMPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY IP D  VEF+   +++
Sbjct  353  ITEGDIEKMPYLGAVVKETFRRHPPSHFLLSHAATKETELGGYTIPADASVEFYTAHLTE  412

Query  511  DPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            DP  W +P  F PDRFL G G   D+TG  AVKM+PFG
Sbjct  413  DPNTWEEPGSFRPDRFLEGDGVGVDVTGTKAVKMVPFG  450



>ref|XP_010102452.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXB93488.1| Cytochrome P450 77A3 [Morus notabilis]
Length=506

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 140/218 (64%), Gaps = 12/218 (6%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDK---------SAATFSYLDTLFDLTVE  153
            Q +   EVRK+Q+E + PL+  R+  LEN G +K         S A  +Y+D+LF+L V 
Sbjct  230  QLREAREVRKRQLECLAPLLRDRKAFLENGGGNKADQNNYKMVSPAGAAYIDSLFELDVP  289

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV  333
             R     + ELVTL SE +NGGTDTTATA+EWA+  L++N  IQ  +Y+EI   VG+  V
Sbjct  290  NRGRLGED-ELVTLCSEAINGGTDTTATAVEWAMFNLVKNQKIQETIYKEIVETVGENGV  348

Query  334  -DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
              E D +KM YL AVVKE  R+HPPT F L+H+  + T+LGGY IP D  VEF+   +++
Sbjct  349  VTENDVEKMTYLGAVVKETFRRHPPTHFMLSHSAVEETELGGYTIPADASVEFYTAWVAE  408

Query  511  DPTLWSDPEKFDPDRFLS-GGEDADITGVTAVKMMPFG  621
            DP LW DP +F P+RFL   G D D+TG  AV M+PFG
Sbjct  409  DPGLWKDPGEFRPERFLERNGADVDVTGTRAVTMVPFG  446



>ref|XP_004305483.2| PREDICTED: cytochrome P450 77A4 [Fragaria vesca subsp. vesca]
Length=511

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 138/213 (65%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----SAATFSYLDTLFDLTVEGRKSS  168
            Q K  +++RK+Q+E +VPLI  R+  L+  G       S +  +Y+D+LF+L V GR   
Sbjct  236  QVKEAVKLRKKQLECLVPLIRNRKAFLDGGGVVNEEMVSPSGAAYIDSLFELDVPGR-GK  294

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKD  345
                ELVTLVSE +N GTDT+AT  EWA+  L+ N  IQ KLY+EI   VG D  V E D
Sbjct  295  LGEEELVTLVSEIVNAGTDTSATTTEWALLHLVMNQEIQDKLYKEIVDCVGKDGAVTESD  354

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KM YL AVVKE  R+HPP+ F L+HA  + T+LGGY IP D  VEF+   +++DP +W
Sbjct  355  VEKMTYLTAVVKETFRRHPPSHFLLSHAAVKETQLGGYTIPADASVEFYTAWVTEDPGMW  414

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             DP +F P+RFL G G D DITG   VKM+PFG
Sbjct  415  KDPGEFRPERFLDGDGVDVDITGTKGVKMVPFG  447



>ref|XP_006348097.1| PREDICTED: cytochrome P450 77A3-like [Solanum tuberosum]
Length=508

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 148/216 (69%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q K+  ++R+ Q+E ++PL+  R+  +++ G  KS+ +        +Y+D+LF L   GR
Sbjct  234  QVKQAKKLRQTQLEYLIPLVRDRKAFVDSNGDPKSSESEMVSPIGAAYVDSLFSLEPPGR  293

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVD  336
            K     AE++TLVSE +  GTDT+ATA+EWA+ +L+ N  IQ KLY+EI   VG +  + 
Sbjct  294  KLG--EAEIITLVSETIGAGTDTSATALEWALLQLVMNQEIQEKLYKEIVDCVGKNGSIS  351

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +K+PYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP D  VEF+   +++DP
Sbjct  352  ESDVEKLPYLGAIVKETFRRHPPSHFILSHSVTNDTQLGGYNIPSDAYVEFYTAWLTEDP  411

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            +LW DP +F P+RFL+G G D D+TG+  VKM+PFG
Sbjct  412  SLWKDPGEFRPERFLTGDGVDVDLTGMRGVKMLPFG  447



>ref|XP_010276015.1| PREDICTED: cytochrome P450 77A3 [Nelumbo nucifera]
Length=512

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 139/220 (63%), Gaps = 14/220 (6%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT--------FSYLDTLFDLT  147
            Q K   ++R++Q+E +VPL+  RR  +E   NP  D +            +Y+D+LF L 
Sbjct  234  QLKEAKKLRRKQVECLVPLVRSRRAFVECEGNPTGDAAGWNEDIVSPIGAAYIDSLFKLE  293

Query  148  VEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-D  324
              GR       ELVTL SE +N GTDT+ATA+EWA+  L+ +  IQ KLYEEI   VG D
Sbjct  294  PSGR-GKLGEEELVTLCSEVMNAGTDTSATAVEWALLHLVMDQDIQQKLYEEIVDSVGKD  352

Query  325  RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAI  504
             K+ E+D +KM YL A+VKE  R+HPP+ F L+HA T  T+LGGY IP D  VEF+   +
Sbjct  353  GKITEEDVEKMRYLGAIVKETFRRHPPSHFVLSHAATHETELGGYTIPADANVEFYTAWV  412

Query  505  SDDPTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            ++DP++W +P  F P+RFL G G D D+TG   VKMMPFG
Sbjct  413  TEDPSVWKEPGAFRPERFLDGDGVDVDVTGSRGVKMMPFG  452



>emb|CDP04373.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 141/211 (67%), Gaps = 11/211 (5%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSA--------ATFSYLDTLFDLTVEGRKSSPT  174
            E+R++Q++++VPLI  RR  +E+ GS  S+           +Y+D+LF L   GR     
Sbjct  240  ELRRRQLDSLVPLIRDRRAFVESGGSKNSSPRSEMVSDIGAAYVDSLFQLAPPGR-GKLG  298

Query  175  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKDTD  351
              E+VTL SE ++ GTDT+AT +EWA+ RL+ N  IQ KLY+EI  +VG + ++ EKD +
Sbjct  299  EEEIVTLCSETISAGTDTSATTVEWAMHRLVTNQEIQEKLYKEIVDLVGKNGEITEKDVE  358

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
             MPYL A+VKE  R+HPP+ F L+HA T+ T+LGGY IP D  VEF+   I+ DP+LW D
Sbjct  359  NMPYLVAIVKETFRRHPPSHFVLSHASTKETELGGYTIPADASVEFYTEWITKDPSLWED  418

Query  532  PEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            P +F P+RFL G G D DITGV   KM+PFG
Sbjct  419  PNEFRPERFLIGDGVDVDITGVKGAKMLPFG  449



>ref|XP_010316601.1| PREDICTED: cytochrome P450 77A1 [Solanum lycopersicum]
Length=508

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q K+  ++R+ Q+E + PL+  R+  +++ G   S+ +        +Y+D+LF L   GR
Sbjct  234  QVKQAKKLRQTQLEYLTPLVRDRKAFVDSNGDPNSSESEMVSPIGAAYVDSLFSLEPPGR  293

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVD  336
            K     AE++TLVSE +  GTDT+ATA+EWA+  L+ N  IQ KLYEEI   VG +  + 
Sbjct  294  KLG--EAEIITLVSETIGAGTDTSATALEWALLHLVMNQEIQEKLYEEIVDCVGKNGSIS  351

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +K+PYL A+VKE  R+HPP+ F L+H+VT  T+LGGY+IP D  VEF+   +++DP
Sbjct  352  ESDVEKLPYLGAIVKETFRRHPPSHFVLSHSVTNDTQLGGYNIPSDAYVEFYTAWLTEDP  411

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            +LW DP +F P+RFL+G G D D+TG+  VKM+PFG
Sbjct  412  SLWKDPTEFRPERFLTGDGVDVDLTGMRGVKMLPFG  447



>gb|EPS68900.1| hypothetical protein M569_05868, partial [Genlisea aurea]
Length=504

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 142/208 (68%), Gaps = 8/208 (4%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAAT---FSYLDTLFDLTVEGRKSSPTNAELV  189
            E+R++Q++ +VPL+ +R+  ++  G+ +  A+    +Y+D+LF L V GR       E+V
Sbjct  237  ELRRRQLDCLVPLLRKRKDFVDGVGAREEMASPLGAAYIDSLFGLQVPGR-GKLGEEEMV  295

Query  190  TLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG---DRKVDEKDTDKMP  360
            +L SE +NGGTDT+A  +EWA+  L++N  IQ KL+ EI SV G   D  + E + ++MP
Sbjct  296  SLCSEAINGGTDTSAATLEWALFHLVQNQDIQEKLFGEIVSVAGKNNDGVITETEVERMP  355

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AVVKE LRKHPP +F L+HA TQ  +LGGY IP D  VEF+   IS+DP +W +P +
Sbjct  356  YLEAVVKETLRKHPPIYFLLSHAATQEMELGGYTIPADVNVEFYTGGISEDPEMWDNPTE  415

Query  541  FDPDRFLSG-GEDADITGVTAVKMMPFG  621
            F P+RFL+G G + DITG+  V+M+PFG
Sbjct  416  FRPERFLTGDGVEVDITGMRGVRMLPFG  443



>ref|XP_010525140.1| PREDICTED: cytochrome P450 89A2-like [Tarenaya hassleriana]
 gb|ABD96947.1| hypothetical protein [Cleome spinosa]
Length=505

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 138/217 (64%), Gaps = 11/217 (5%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALE---NPG---SDKSAATFSYLDTLFDLTVEG  156
            RKR   VL++R+ Q   ++PLI  RR+ +E    PG   SD      SY+DTL DL +  
Sbjct  227  RKRWEEVLQLRRDQEALLLPLIRARRKIVEENARPGISDSDNKDYVVSYVDTLLDLELPD  286

Query  157  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDR--K  330
             K      E+VTL SEFLNGGTD+TATA++W +A L++ P +Q +L+EEIKSV G+   +
Sbjct  287  EKRKLDEGEMVTLCSEFLNGGTDSTATALQWIMANLVKYPEVQKRLHEEIKSVTGETGGE  346

Query  331  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
            V E D  KMPYL AVV E LR+HPP   AL H VT  T LGGY +P +  + F +  +  
Sbjct  347  VKEDDLQKMPYLKAVVLEGLRRHPPGHLALPHRVTDETDLGGYSVPKNGTINFMIADMGR  406

Query  511  DPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            DP +W DP  F P+RF++GG+  DITG   +KM+PFG
Sbjct  407  DPEVWEDPMAFKPERFVNGGDPIDITGSRGIKMIPFG  443



>ref|XP_002265911.1| PREDICTED: cytochrome P450 77A1 [Vitis vinifera]
 emb|CBI23188.3| unnamed protein product [Vitis vinifera]
Length=508

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 138/216 (64%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q +   E+RK+Q+E +VPL+  RR  +E+ G+   +++        +Y+D+LF L     
Sbjct  234  QLREAKELRKKQMECMVPLVRSRRAFVESKGAPGRSSSEMVSPIGAAYIDSLFGLE-PAE  292

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-D  336
            +      ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ KLY+EI   VG   V  
Sbjct  293  RGRLGEEELVTLCSEIINAGTDTSATTVEWALLHLVMNQDIQQKLYKEIIDCVGKNGVVT  352

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +KMPYL A+VKE  R+HPP+ F L+HA T+ T+LGGY IP D  VEF+   +++DP
Sbjct  353  EGDVEKMPYLGAIVKETFRRHPPSHFVLSHAATKDTELGGYTIPADVNVEFYTAWVTEDP  412

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             LW DP +F P+RFL G G + D+TG   VKM+PFG
Sbjct  413  DLWQDPAEFRPERFLQGDGVNVDVTGTRGVKMVPFG  448



>emb|CAN68641.1| hypothetical protein VITISV_030808 [Vitis vinifera]
Length=484

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 138/216 (64%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q +   E+RK+Q+E +VPL+  RR  +E+ G+   +++        +Y+D+LF L     
Sbjct  210  QLREAKELRKKQMECMVPLVRSRRAFVESKGAPGRSSSEMVSPIGAAYIDSLFGLE-PAE  268

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-D  336
            +      ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ KLY+EI   VG   V  
Sbjct  269  RGRLGEEELVTLCSEIINAGTDTSATTVEWALLHLVMNQDIQQKLYKEIIDCVGKNGVVT  328

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +KMPYL A+VKE  R+HPP+ F L+HA T+ T+LGGY IP D  VEF+   +++DP
Sbjct  329  EGDVEKMPYLGAIVKETFRRHPPSHFVLSHAATKDTELGGYTIPADVNVEFYTAWVTEDP  388

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             LW DP +F P+RFL G G + D+TG   VKM+PFG
Sbjct  389  DLWQDPAEFRPERFLQGDGVNVDVTGTRGVKMVPFG  424



>ref|XP_011037689.1| PREDICTED: cytochrome P450 77A4-like [Populus euphratica]
Length=505

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 135/208 (65%), Gaps = 9/208 (4%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSD-----KSAATFSYLDTLFDLTVEGRKSSPTNAE  183
            E+R++Q++ +VPLI R RRA    G D      S    +Y+D+LFD+    R       E
Sbjct  240  ELRRKQMDCLVPLI-RNRRAFVEKGEDPDLEMASPVGAAYIDSLFDMKPVNRGPL-GEQE  297

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKDTDKMP  360
             VTL SE ++ GTDT+AT IEWA+  L++N  IQ KLY+E+   VG+  V  E+DT+KMP
Sbjct  298  FVTLCSEVISAGTDTSATTIEWALLNLVQNQEIQEKLYQEVIGCVGEHGVVTEEDTEKMP  357

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A+VKE  R+HPP+ F L+HA T  T+L GY IP D  VEF+   +++DP LW DP +
Sbjct  358  YLGAIVKETFRRHPPSHFVLSHAATNETQLAGYTIPADVNVEFYTAWLTEDPDLWKDPGE  417

Query  541  FDPDRFLSG-GEDADITGVTAVKMMPFG  621
            F P+RFL G G D D+TG   VKMMPFG
Sbjct  418  FRPERFLEGDGVDVDMTGTRGVKMMPFG  445



>ref|XP_004156750.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
 gb|KGN63389.1| hypothetical protein Csa_2G435520 [Cucumis sativus]
Length=512

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 143/222 (64%), Gaps = 16/222 (7%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGS-----DKSAATFSYLDTLFDLTV-EG  156
            RKR    LE+R++Q + ++PLIE RR A++N  S     DK    FSY+DTL DL + E 
Sbjct  231  RKRWEAFLEIRRKQDKVVIPLIESRRTAIQNRASSAKNEDKEGFVFSYVDTLLDLKLPEE  290

Query  157  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---R  327
                 T+ E+VTL SEFL+GGTDTTATA++W +A L++NP IQ+KL  E+K V+GD    
Sbjct  291  DNRKLTDEEMVTLCSEFLSGGTDTTATALQWIMANLVKNPEIQNKLLSEMKGVMGDGSRE  350

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            +V E+D +K+PYL A++ E LR+HPP  F L HAV + T L  Y IP +  V F +  I 
Sbjct  351  EVKEEDLEKLPYLKAMILEGLRRHPPGHFLLPHAVKEDTILENYVIPKNGIVNFMVAEIG  410

Query  508  DDPTLWSDPEKFDPDRFLSGGE----DADITGVTAVKMMPFG  621
             DP +W DP  F P+RF+ G E    + DITG   +KMMPFG
Sbjct  411  WDPKVWEDPMAFKPERFMKGNEGEGVEFDITGSKEIKMMPFG  452



>ref|XP_011086180.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=511

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 142/216 (66%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q K   E+R++Q+E +VPLI  R+  +E+ G+ K+  +        +Y+D+LF L   G 
Sbjct  234  QVKAAKELRRKQLECLVPLIRNRKAFVESGGNPKATTSEMASPLGAAYIDSLFGLEPPG-  292

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-D  336
            K      E+VTL SE +N GTDT+ATA+EWA+  L+++  IQ KLY+EI  +VG   V  
Sbjct  293  KGKLGEEEMVTLCSEAINAGTDTSATALEWALLHLVQDQEIQEKLYKEIVGIVGKNGVIA  352

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +KMPYL A+VKE  R+HPP+ F L+HA T+  +LGGY IP D  VE +   +++DP
Sbjct  353  ESDVEKMPYLGAIVKETFRRHPPSHFLLSHAATKEIELGGYTIPADVNVEIYTAWLTEDP  412

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             +W +P +F P+RFL+G G + DITG+  VKM+PFG
Sbjct  413  EMWENPSEFRPERFLTGDGVEVDITGMRGVKMLPFG  448



>ref|XP_004235319.1| PREDICTED: cytochrome P450 89A2-like [Solanum lycopersicum]
Length=517

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 135/216 (63%), Gaps = 11/216 (5%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAEL  186
            K ++E+R++Q   I+PLIE R RA E           +Y+DTL +L     K +  + E+
Sbjct  238  KELIELRQEQESIIIPLIEARSRAREQRTEHGDEFVVAYVDTLLNLEFPEEKRNLNHGEI  297

Query  187  VTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK--------VDEK  342
            VTL SEFL+ GTDTT+TA++W +A L++NP IQ KLY+EI +VVG+++        V E+
Sbjct  298  VTLCSEFLSAGTDTTSTALQWIMANLVKNPSIQEKLYQEIATVVGEKQSKLTDEEVVKEE  357

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KMPYL AV+ E LR+HPP  F L H VT+  +L GY IP D  + F +  +  DP +
Sbjct  358  DLQKMPYLKAVILEGLRRHPPGHFVLPHTVTEEVELNGYVIPKDVTINFMVAEMGLDPKV  417

Query  523  WSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  621
            W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  418  WEDPLEFRPERFLVEGSDNEGFDITGSREIKMMPFG  453



>ref|XP_006468005.1| PREDICTED: cytochrome P450 77A3-like [Citrus sinensis]
Length=508

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 141/215 (66%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT---FSYLDTLFDLTVEGRK  162
            Q +   E+RK+Q+E +VPLI  R+  +E   NP S+    +    +Y+D+LF L   GR+
Sbjct  235  QMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGRE  294

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDE  339
                  E+VTL SE ++ GTDT+AT  EWA+  L+ N  IQ KLY+EI + VG D  V E
Sbjct  295  QL-GEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKE  353

Query  340  KDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPT  519
            +D +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY IP    VEF+   +++DP 
Sbjct  354  EDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFYTAWLTEDPD  413

Query  520  LWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            +WSDP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  414  MWSDPGEFRPERFLEGDGVDVDVTGTRGVKMVPFG  448



>gb|KDO75503.1| hypothetical protein CISIN_1g036686mg [Citrus sinensis]
Length=508

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 141/215 (66%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT---FSYLDTLFDLTVEGRK  162
            Q +   E+RK+Q+E +VPLI  R+  +E   NP S+    +    +Y+D+LF L   GR+
Sbjct  235  QMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGRE  294

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDE  339
                  E+VTL SE ++ GTDT+AT  EWA+  L+ N  IQ KLY+EI + VG D  V E
Sbjct  295  QL-GEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKE  353

Query  340  KDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPT  519
            +D +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY IP    VEF+   +++DP 
Sbjct  354  EDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFYTAWLTEDPD  413

Query  520  LWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            +WSDP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  414  MWSDPGEFRPERFLEGDGVDVDVTGTRGVKMVPFG  448



>ref|XP_006449061.1| hypothetical protein CICLE_v10014970mg [Citrus clementina]
 gb|ESR62301.1| hypothetical protein CICLE_v10014970mg [Citrus clementina]
Length=508

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 141/215 (66%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDKSAAT---FSYLDTLFDLTVEGRK  162
            Q +   E+RK+Q+E +VPLI  R+  +E   NP S+    +    +Y+D+LF L   GR+
Sbjct  235  QMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGRE  294

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDE  339
                  E+VTL SE ++ GTDT+AT  EWA+  L+ N  IQ KLY+EI + VG D  V E
Sbjct  295  QL-GEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKE  353

Query  340  KDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPT  519
            +D +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY IP    VEF+   +++DP 
Sbjct  354  EDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFYTAWLTEDPD  413

Query  520  LWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            +WSDP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  414  MWSDPGEFRPERFLEGDGVDVDVTGTRGVKMVPFG  448



>ref|XP_006657255.1| PREDICTED: cytochrome P450 77A3-like [Oryza brachyantha]
Length=529

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 142/225 (63%), Gaps = 19/225 (8%)
 Frame = +1

Query  4    RKRVLE---VRKQQIETIVPLIERRRRALENPGSDK-------------SAATFSYLDTL  135
            RK++ E   +R++Q+  + PL+  RR  L++ G+               SA   +Y+D+L
Sbjct  232  RKQLTEARNLRRRQLGCLAPLVRARREFLKDGGAKNADGNTVVGGVEMMSAPGEAYVDSL  291

Query  136  FDLTVEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSV  315
            FDL   GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +P +Q KLY E+ S 
Sbjct  292  FDLEPPGRGKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLDPAVQEKLYGEVVSK  351

Query  316  VGD-RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFF  492
            VG   ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+
Sbjct  352  VGTTARITEADVETMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFY  411

Query  493  LPAISDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
               ++++P  W DPE + P+RFL GGE  D DITG  A++MMPFG
Sbjct  412  TAWVTENPETWPDPETWRPERFLEGGEGFDTDITGTRALRMMPFG  456



>ref|XP_002305592.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE86103.1| cytochrome P450 family protein [Populus trichocarpa]
Length=505

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 135/208 (65%), Gaps = 9/208 (4%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRAL----ENPGSD-KSAATFSYLDTLFDLTVEGRKSSPTNAE  183
            E+R++Q+E +VPLI R RRA     ENP  +  S    +Y+D+LF +    R       E
Sbjct  240  ELRRKQMECLVPLI-RNRRAFVEKGENPDLEMASPVGAAYIDSLFAMKPVNRGPL-GEQE  297

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKDTDKMP  360
             VTL SE ++ GTDT+AT IEWA+  L++N  IQ KLY+EI   VG   V  E+DT+KMP
Sbjct  298  FVTLCSEVISAGTDTSATTIEWALLNLVQNQEIQEKLYQEIIGCVGKHGVVKEEDTEKMP  357

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL A+VKE  R+HPP+ F L+HA T  T+L GY IP D  VEF+   +++DP LW DP +
Sbjct  358  YLGAIVKETFRRHPPSHFVLSHAATNETQLAGYTIPADVNVEFYTAWLTEDPDLWKDPGE  417

Query  541  FDPDRFLSG-GEDADITGVTAVKMMPFG  621
            F P+RFL G G D D+TG   VKMMPFG
Sbjct  418  FRPERFLEGDGVDVDMTGTRGVKMMPFG  445



>ref|XP_010442231.1| PREDICTED: cytochrome P450 89A2-like [Camelina sativa]
Length=513

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 140/219 (64%), Gaps = 13/219 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSAA------TFSYLDTLFDLTVEG  156
            RKR     +++++Q + ++PLI  RR+ +E      S          SY+DTL D+ +  
Sbjct  232  RKRWEEFFQMKREQQDVLLPLIRARRKIVEERKKRSSEEDNNKEYVQSYVDTLLDVELPD  291

Query  157  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---R  327
             K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEIKSVVG+   +
Sbjct  292  EKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPNIQKRLYEEIKSVVGEDQAK  351

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            +V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I 
Sbjct  352  EVEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIG  411

Query  508  DDPTLWSDPEKFDPDRFLSGGEDA-DITGVTAVKMMPFG  621
             DP +W +P  F+P+RF+   E++ DITG   +KMMPFG
Sbjct  412  RDPKVWEEPMAFNPERFIGAQEESVDITGSRGIKMMPFG  450



>ref|XP_002437457.1| hypothetical protein SORBIDRAFT_10g027430 [Sorghum bicolor]
 gb|EER88824.1| hypothetical protein SORBIDRAFT_10g027430 [Sorghum bicolor]
Length=521

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 139/214 (65%), Gaps = 14/214 (7%)
 Frame = +1

Query  22   VRKQQIETIVPLIERRRRAL-ENPGSDKSAATF----------SYLDTLFDLTVEGRKSS  168
            +R++Q++ + PL+  RR  L +  GS ++AA            +Y+D+LFDL   GR   
Sbjct  240  LRRRQLDCLAPLVRARRDFLRDGAGSQEAAAKGGVEMMSGPGEAYVDSLFDLEPPGRGKR  299

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKD  345
                ELVTL SE ++ GTDT+ATA+EWA+  LI +P  Q +LY+E+ + VG   ++ E D
Sbjct  300  LGEEELVTLCSEVMSAGTDTSATALEWAMLHLILDPAAQERLYDEVVAKVGKTARITEAD  359

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+   ++++P  W
Sbjct  360  VEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVTENPATW  419

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
             DPE + P+RFL GGE  D DITG  A++MMPFG
Sbjct  420  PDPETWRPERFLEGGEGFDTDITGTRALRMMPFG  453



>ref|XP_003610402.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92599.1| cytochrome P450 family 87 protein [Medicago truncatula]
Length=508

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 138/212 (65%), Gaps = 8/212 (4%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDK-----SAATFSYLDTLFDLTVEGRKSSP  171
            K   ++RK+Q+E I PLI +R+  +E+ G        SA   +Y+D+LF L V  R    
Sbjct  236  KEAKKLRKKQLELIAPLIRKRKVYVESDGKCGDPEMVSAIGAAYVDSLFGLEVPSR-GIL  294

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-VDEKDT  348
             + ELVTLVSE ++ GTDT+ATAIEWA+  L+ +  IQ +LY EI   VG    V + D 
Sbjct  295  GDEELVTLVSEIISAGTDTSATAIEWALLHLVMDQEIQERLYREIVDCVGKCGIVMDSDV  354

Query  349  DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
            +KMPYL A+VKE  R+HPP+ F L+HA T+ TKLGGY IP D  VEF+   +S++P  W 
Sbjct  355  EKMPYLCAIVKETFRRHPPSHFVLSHAATEETKLGGYTIPADASVEFYTAWLSENPNTWK  414

Query  529  DPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            DP+ F P+RFL+G G D DITG   +KMMPFG
Sbjct  415  DPDVFRPERFLNGDGVDVDITGTKEMKMMPFG  446



>ref|XP_010482059.1| PREDICTED: cytochrome P450 89A2-like [Camelina sativa]
Length=513

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 139/219 (63%), Gaps = 13/219 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSAA------TFSYLDTLFDLTVEG  156
            RKR     +++++Q + ++PLI  RR+ +E      S          SY+DTL D+ +  
Sbjct  232  RKRWEEFFQMKREQQDVLLPLIRARRKIVEERKKRSSEEDNNKEYVQSYVDTLLDVELPD  291

Query  157  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---R  327
             K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEIKSVVG+   +
Sbjct  292  EKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPNIQKRLYEEIKSVVGEDQAK  351

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            +V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I 
Sbjct  352  EVEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIG  411

Query  508  DDPTLWSDPEKFDPDRFLSGGEDA-DITGVTAVKMMPFG  621
             DP +W +P  F P+RF+   E++ DITG   +KMMPFG
Sbjct  412  RDPKVWEEPMAFKPERFIGAQEESVDITGSRGIKMMPFG  450



>ref|XP_004966222.1| PREDICTED: cytochrome P450 77A3-like [Setaria italica]
Length=513

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 141/221 (64%), Gaps = 16/221 (7%)
 Frame = +1

Query  4    RKRVLE---VRKQQIETIVPLIERRRRALENPGSDK---------SAATFSYLDTLFDLT  147
            RK++ E   +R++Q+  +VPL+  RR  L + G+ K         S    +Y+D+LFDL 
Sbjct  231  RKQLTEARNLRRRQLACLVPLVRARREFLRD-GNKKAVDGGVEMMSGPGEAYVDSLFDLE  289

Query  148  VEGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-  324
              GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +P  Q +LY+E+   VG  
Sbjct  290  PPGRGKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLDPAAQERLYDEVVGKVGKT  349

Query  325  RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAI  504
             ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+   +
Sbjct  350  ARITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWV  409

Query  505  SDDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            +++P  W DPE + P+RFL GGE  D DITG  A++MMPFG
Sbjct  410  TENPATWPDPEAWRPERFLEGGEGFDTDITGTRALRMMPFG  450



>ref|XP_010553430.1| PREDICTED: cytochrome P450 77A3 [Tarenaya hassleriana]
Length=504

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 143/214 (67%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRR---RALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q K+  E+RK+Q++ +VPLI +RR   +  ENP ++  S    +Y+D+LFDL    R+  
Sbjct  232  QVKQAKELRKRQLDCLVPLIRKRRLFVKKRENPNAEMVSPIGAAYVDSLFDLKCGERELG  291

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E VTL SE ++ GTDT+AT +EWA+  L+ +  +Q KLY+EI SVVG   V +E D
Sbjct  292  --DEEYVTLCSEIVSAGTDTSATTVEWALLHLVTDETVQQKLYDEIDSVVGKNSVVEEDD  349

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KMPYL AVVKE LR+HPP  F L+HA  + T+LGGY+IP    +EF+   ++++P +W
Sbjct  350  VEKMPYLEAVVKETLRRHPPGHFLLSHATVKDTELGGYEIPAGAYLEFYTAWVTENPEIW  409

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
             DP  F P+RFL+GGE  ++D TG   V M+PFG
Sbjct  410  PDPGNFRPERFLTGGEGFNSDWTGTRGVTMLPFG  443



>ref|XP_004148114.1| PREDICTED: cytochrome P450 89A9-like [Cucumis sativus]
Length=493

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 138/218 (63%), Gaps = 12/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRAL---ENPGSDKSAATFSYLDTLFDLTVEGRKS  165
            RKR    L++R+ Q E I+P IE RR+     EN   +K     SY+DTL +L +   K 
Sbjct  215  RKRWEEFLQLRRNQEEVIIPFIEARRKIQQNKENRDENKEEIVVSYVDTLLELELPDEKR  274

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVD  336
              T+ E+VT+ SEF+NGG+DTT+TA++W +A L++ P IQ+KL  E+K V+GD    +V 
Sbjct  275  KLTDTEMVTIASEFINGGSDTTSTALQWIMANLVKYPEIQNKLLVEMKGVMGDGSEEEVK  334

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E+D  K+PYL AV+ E LR+HPP  F L HAV + TKLG Y IP +    + +  +  DP
Sbjct  335  EEDLGKLPYLKAVILEGLRRHPPAHFLLPHAVKEETKLGNYVIPKNGTTNYMVAEMGRDP  394

Query  517  TLWSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  621
             +W DP  F P+RF+ GGE+    DITG   +KMMPFG
Sbjct  395  KVWEDPMAFKPERFMKGGEEGIEFDITGSKEIKMMPFG  432



>ref|XP_003549954.2| PREDICTED: cytochrome P450 77A2-like [Glycine max]
Length=523

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 140/216 (65%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE-------NPGSDKSAATFSYLDTLFDLTVEGR  159
            Q K   E+R++Q+E + PLI  R+  +E       N     S    +Y+D+LF+L V GR
Sbjct  247  QVKEAKELRRRQVELLAPLIRSRKAFVEGNLLELGNHYDMASPVGAAYVDSLFNLEVPGR  306

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVD  336
                   ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +LY+EI   VG D  V 
Sbjct  307  -GRLGEEELVTLVSEIISAGTDTSATAVEWALLHLVMDQDIQERLYKEIVECVGKDGVVT  365

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E   +KMPYL+AVVKE  R+HPP+ F L+HA T+ T+LGGY +P +  VEF+   ++++P
Sbjct  366  ESHVEKMPYLSAVVKETFRRHPPSHFVLSHAATEETELGGYTVPKEASVEFYTAWLTENP  425

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             +W DP +F P+RF+SG G + D+TG   V+MMPFG
Sbjct  426  DMWEDPNEFRPERFMSGDGVEVDVTGTKGVRMMPFG  461



>ref|XP_004171811.1| PREDICTED: cytochrome P450 89A9-like [Cucumis sativus]
 gb|KGN63391.1| hypothetical protein Csa_2G435540 [Cucumis sativus]
Length=510

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 138/218 (63%), Gaps = 12/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRAL---ENPGSDKSAATFSYLDTLFDLTVEGRKS  165
            RKR    L++R+ Q E I+P IE RR+     EN   +K     SY+DTL +L +   K 
Sbjct  232  RKRWEEFLQLRRNQEEVIIPFIEARRKIQQNKENRDENKEEIVVSYVDTLLELELPDEKR  291

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVD  336
              T+ E+VT+ SEF+NGG+DTT+TA++W +A L++ P IQ+KL  E+K V+GD    +V 
Sbjct  292  KLTDTEMVTIASEFINGGSDTTSTALQWIMANLVKYPEIQNKLLVEMKGVMGDGSEEEVK  351

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E+D  K+PYL AV+ E LR+HPP  F L HAV + TKLG Y IP +    + +  +  DP
Sbjct  352  EEDLGKLPYLKAVILEGLRRHPPAHFLLPHAVKEETKLGNYVIPKNGTTNYMVAEMGRDP  411

Query  517  TLWSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  621
             +W DP  F P+RF+ GGE+    DITG   +KMMPFG
Sbjct  412  KVWEDPMAFKPERFMKGGEEGIEFDITGSKEIKMMPFG  449



>ref|XP_006347571.1| PREDICTED: cytochrome P450 89A2-like [Solanum tuberosum]
Length=513

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 134/216 (62%), Gaps = 11/216 (5%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAEL  186
            K ++E+R++Q   I+PLIE R R  E           +Y+DTL +L +   K +  + E+
Sbjct  234  KELIELRQEQESIIIPLIEARSRTKEQKIEHGDEFVVAYVDTLLNLELPEEKRNLNHGEI  293

Query  187  VTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK--------VDEK  342
            VTL SEFL+ GTDTT+TA++W +A L++NP IQ KLY+EI  VVG+++        V E+
Sbjct  294  VTLCSEFLSAGTDTTSTALQWVMANLVKNPSIQEKLYQEIARVVGEKQSKLADEEVVKEE  353

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  K+PYL AV+ E LR+HPP  F L H VT+  +L GY IP D  + F +  +  DP +
Sbjct  354  DLQKIPYLKAVILEGLRRHPPGHFVLPHTVTEEVELNGYVIPKDVTINFMVAEMGLDPKV  413

Query  523  WSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  621
            W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  414  WEDPLEFRPERFLVEGSDNEGFDITGSREIKMMPFG  449



>gb|KDP20776.1| hypothetical protein JCGZ_21247 [Jatropha curcas]
Length=506

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 136/213 (64%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSD-KSAATFSYLDTLFDLTVEGRKSS  168
            Q K   E+R++Q+E + PLI  RR  +E   NP  +  S    +Y+D+LF+L    R   
Sbjct  234  QMKEAKELRRKQMECLFPLIRNRRAFIEKGGNPNEEMASPVGAAYIDSLFELKPANR-GQ  292

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKD  345
                E VTL SE ++ GTDT+AT IEWA+  L++N  IQ KLY+EI   VG D  V E+D
Sbjct  293  LGEEEFVTLCSEVISAGTDTSATTIEWALLHLVQNQEIQEKLYKEIVECVGKDGVVKEED  352

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KM YL AVVKE LR+HPP+ F L+HA T+ T+LGGY IP    VE +   +++DP +W
Sbjct  353  VEKMRYLGAVVKETLRRHPPSHFLLSHAATKETELGGYTIPAGVNVELYTAWVTEDPEMW  412

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             DP +F P+RFL G G D D+TG   +KM+PFG
Sbjct  413  EDPREFRPERFLKGDGVDVDLTGTRGLKMVPFG  445



>gb|EEE66224.1| hypothetical protein OsJ_22376 [Oryza sativa Japonica Group]
Length=535

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 134/217 (62%), Gaps = 16/217 (7%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDK-------------SAATFSYLDTLFDLTVEGR  159
            E+R++Q+  + PL+  RR  +   G                SA   +Y+D+LFDL   GR
Sbjct  240  ELRRRQLGCLAPLVRARREFIRGGGERNADGNTVVGGVEMVSAPGEAYVDSLFDLEPPGR  299

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVD  336
                   ELVTL SE ++ GTDT+ATA+EWA+  L+ + G+Q KLY E+ S VG   ++ 
Sbjct  300  GKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLDAGVQDKLYGEVVSKVGTTARIT  359

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+   ++++P
Sbjct  360  EADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVTENP  419

Query  517  TLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
              W DPE + P+RFL GGE  D DIT   A++MMPFG
Sbjct  420  ATWPDPEAWRPERFLEGGEGFDTDITATRALRMMPFG  456



>ref|NP_001058373.1| Os06g0680700 [Oryza sativa Japonica Group]
 dbj|BAD45490.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAD45883.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF20287.1| Os06g0680700 [Oryza sativa Japonica Group]
 gb|EEC81184.1| hypothetical protein OsI_24186 [Oryza sativa Indica Group]
Length=535

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 134/217 (62%), Gaps = 16/217 (7%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDK-------------SAATFSYLDTLFDLTVEGR  159
            E+R++Q+  + PL+  RR  +   G                SA   +Y+D+LFDL   GR
Sbjct  240  ELRRRQLGCLAPLVRARREFIRGGGERNADGNTVVGGVEMVSAPGEAYVDSLFDLEPPGR  299

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVD  336
                   ELVTL SE ++ GTDT+ATA+EWA+  L+ + G+Q KLY E+ S VG   ++ 
Sbjct  300  GKRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLDAGVQDKLYGEVVSKVGTTARIT  359

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+   ++++P
Sbjct  360  EADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVTENP  419

Query  517  TLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
              W DPE + P+RFL GGE  D DIT   A++MMPFG
Sbjct  420  ATWPDPEAWRPERFLEGGEGFDTDITATRALRMMPFG  456



>ref|NP_001141481.1| uncharacterized protein LOC100273592 precursor [Zea mays]
 gb|ACN34097.1| unknown [Zea mays]
 gb|AFW69072.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 142/220 (65%), Gaps = 15/220 (7%)
 Frame = +1

Query  4    RKRVLE---VRKQQIETIVPLIERRRRALENPGSDKSAATF--------SYLDTLFDLTV  150
            RK++ E   +R++Q+  +VPL+  RR  L + G+  +A           +Y+D+LFDL  
Sbjct  231  RKQLTEARGLRRRQLNCLVPLVRARRDFLRD-GTAAAADGVEMMSGPGEAYVDSLFDLEP  289

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-R  327
             GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +P  Q +LY+E+ + VG   
Sbjct  290  PGRGKRLGEEELVTLCSEVMSAGTDTSATALEWAMMHLVLDPAAQERLYDEVVAKVGKTA  349

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+   ++
Sbjct  350  RITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVT  409

Query  508  DDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            ++P  W DP+ + P+RFL GGE  D DITG  A++MMPFG
Sbjct  410  ENPATWPDPDAWRPERFLEGGEGFDTDITGTRALRMMPFG  449



>gb|ACF86457.1| unknown [Zea mays]
Length=519

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 142/220 (65%), Gaps = 15/220 (7%)
 Frame = +1

Query  4    RKRVLE---VRKQQIETIVPLIERRRRALENPGSDKSAATF--------SYLDTLFDLTV  150
            RK++ E   +R++Q+  +VPL+  RR  L + G+  +A           +Y+D+LFDL  
Sbjct  231  RKQLTEARGLRRRQLNCLVPLVRARRDFLRD-GTAAAADGVEMMSGPGEAYVDSLFDLEP  289

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-R  327
             GR       ELVTL SE ++ GTDT+ATA+EWA+  L+ +P  Q +LY+E+ + VG   
Sbjct  290  PGRGKRLGEEELVTLCSEVMSAGTDTSATALEWAMMHLVLDPAAQERLYDEVVAKVGKTA  349

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            ++ E D + MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+   ++
Sbjct  350  RITEADVEAMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVT  409

Query  508  DDPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            ++P  W DP+ + P+RFL GGE  D DITG  A++MMPFG
Sbjct  410  ENPATWPDPDAWRPERFLEGGEGFDTDITGTRALRMMPFG  449



>ref|XP_009622536.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana tomentosiformis]
Length=517

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 136/216 (63%), Gaps = 14/216 (6%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRR-RALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAE  183
            K ++E+R++Q +  +PLIE R  RA E    ++  A   Y+DTL +L + G   S    E
Sbjct  241  KELIELRQEQEKIFIPLIEARSIRAKEQKPEEEVVA---YVDTLLNLELPGENRSLNYGE  297

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-------VDEK  342
            +V+L SEFLN GTDTT+TA++W +A L++NP IQ KLY+EI SVVG+++       V E 
Sbjct  298  MVSLCSEFLNAGTDTTSTALQWVMANLVKNPSIQGKLYQEIASVVGEKQSKLTEEVVKED  357

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KMPYL AV+ E LR+HPP  F L H VT+  +L GY +P +  + F +  +  DP +
Sbjct  358  DLHKMPYLRAVILEGLRRHPPGHFVLPHTVTEEVELNGYVVPKNATINFMVADMGLDPKV  417

Query  523  WSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  621
            W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  418  WEDPLEFKPERFLMEGSDKEGFDITGSREIKMMPFG  453



>ref|XP_002518512.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43899.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 138/214 (64%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRAL----ENPGSDK-SAATFSYLDTLFDLTVEGRKS  165
            Q K   E+RK+Q+E +VPLI R RRA     ENP S+  S    +Y+D+LF+L     + 
Sbjct  234  QMKVAKELRKKQMECLVPLI-RNRRAFVEKGENPNSEMVSPVGAAYIDSLFELK-PAERG  291

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEK  342
                 E VTL SE ++ GTDT+AT IEWA+  L+ N  IQ  LY+EI   VG D  V E+
Sbjct  292  PLGEQEFVTLCSEVVSAGTDTSATTIEWALLHLVLNQEIQENLYKEIVDFVGKDGLVKEE  351

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
              +KMPYL A+VKE  R+HPP+ F L+HA T+ T+LGGY IP    VE +   +++DP +
Sbjct  352  HVEKMPYLGAIVKETFRRHPPSHFLLSHAATKETQLGGYTIPAGVNVELYTAWVTEDPDV  411

Query  523  WSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            W DP++F P+RFL+G G D D+TG   VKM+PFG
Sbjct  412  WKDPDEFRPERFLNGDGVDVDVTGTRGVKMVPFG  445



>ref|NP_176674.1| cytochrome P450, family 87, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
 gb|AAD38268.1|AC006193_24 Putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEE34307.1| cytochrome P450, family 87, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
Length=511

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 139/219 (63%), Gaps = 16/219 (7%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLI--------ERRRRALENPGSDKSAATFSYLDTLFDLTV  150
            RKR     +++ +Q + ++PLI        ER++R+ E    +K     SY+DTL D+ +
Sbjct  233  RKRWEEFFQMQSEQQDVLLPLIRARRKIVDERKKRSSEEEKDNKEYVQ-SYVDTLLDVEL  291

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--  324
               K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEIKS+VG+  
Sbjct  292  PDEKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPEIQRRLYEEIKSIVGEEA  351

Query  325  RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAI  504
            ++V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I
Sbjct  352  KEVEEQDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEI  411

Query  505  SDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
              DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  412  GRDPKVWEEPMAFKPERFME--EAVDITGSRGIKMMPFG  448



>ref|XP_010476093.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=511

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S    +Y+D+LF L +  R   
Sbjct  236  QVREARELRKTQLECLVPLIRNRRKFVEAKESPNEEMVSPIGAAYVDSLFGLNLVERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLY+E+  VVG   V +E D
Sbjct  296  LRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQQKLYDEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VEF+   ++++P +W
Sbjct  356  VSKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEFYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF PDRFL+GG+  DAD TG   V M+PFG
Sbjct  416  SDPAKFRPDRFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_010458565.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=510

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S    +Y+D+LF L +  R   
Sbjct  236  QVREARELRKTQLECLVPLIRNRRKFVEAKESPNEEMVSPIGAAYVDSLFGLNLVERSGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLY+E+  VVG   V +E D
Sbjct  296  LRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQEKLYDEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VEF+   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEFYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF PDRFL+GG+  DAD TG   V M+PFG
Sbjct  416  SDPAKFRPDRFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_006417335.1| hypothetical protein EUTSA_v10007399mg [Eutrema salsugineum]
 gb|ESQ35688.1| hypothetical protein EUTSA_v10007399mg [Eutrema salsugineum]
Length=510

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 136/214 (64%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI  RR  ++   S      S    +Y+D+LF L    R   
Sbjct  236  QVREARELRKTQLECLVPLIRNRRAFVDAKASPNEEMVSPIGAAYVDSLFGLKPIERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYEE+  VVG   V +E D
Sbjct  296  LGDEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDQNIQEKLYEEVVQVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              K+PYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VEF+   ++++P +W
Sbjct  356  VAKIPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEFYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF P+RFL+GG+  +AD TG   V M+PFG
Sbjct  416  SDPGKFRPERFLTGGDGVNADWTGTRGVTMLPFG  449



>ref|XP_009128469.1| PREDICTED: cytochrome P450 89A2-like [Brassica rapa]
Length=507

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLV  198
            ++R++Q + ++PLI  RR+ +E    +      SY+DTL DL +   K      E+V+L 
Sbjct  242  QMRREQGDVLLPLIRARRKIVEERMKNNKDYVQSYVDTLLDLELPEEKRKLNEEEIVSLC  301

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKD---TDKMPYLN  369
            SEFLNGGTDTTATA++W +A L++ P IQ +LYEEIKSVV   +  E +     KMPYL 
Sbjct  302  SEFLNGGTDTTATALQWIMANLVKKPEIQERLYEEIKSVVAGEEGKEIEEEEAHKMPYLK  361

Query  370  AVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDP  549
            AVV E LR+HPP  F L H+VT+ T LGGY +P    V F +  I  DP +W DP +F P
Sbjct  362  AVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKRGTVNFMVAEIGRDPAVWDDPMEFKP  421

Query  550  DRFLSGGEDADITGVTAVKMMPFG  621
            +RF+   E  DITG   +KMMPFG
Sbjct  422  ERFIGEEEPVDITGSRGIKMMPFG  445



>ref|XP_010493054.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=511

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S    +Y+D+LF L +  R   
Sbjct  236  QVREARELRKTQLECLVPLIRNRRKFVEAKESPNEEMVSPIGAAYVDSLFGLNLVERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLY+E+  VVG   V +E D
Sbjct  296  LRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQEKLYDEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VEF+   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEFYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF PDRFL+GG+  DAD TG   V M+PFG
Sbjct  416  SDPAKFRPDRFLTGGDGVDADWTGTRGVTMLPFG  449



>gb|EYU33905.1| hypothetical protein MIMGU_mgv1a004759mg [Erythranthe guttata]
Length=511

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 137/216 (63%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT-------FSYLDTLFDLTVEGR  159
            Q K   E+R++Q++ +VPL+  RR  +E+ G   S A         +Y+D+LF L   GR
Sbjct  234  QVKEARELRRRQLDCLVPLLRDRRAFVESGGDASSTAAEMASPFGAAYIDSLFGLEPPGR  293

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVD  336
                   E++TL SE +N GTDT+AT +EWA+  L+ N  IQ KLY E+   VG D  V 
Sbjct  294  -GKLGEEEIITLCSETINAGTDTSATTLEWALLHLVLNQEIQEKLYNEVVDCVGKDGPVT  352

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +KM YL AVVKE  R+HPP+ F L+HA T+  +LGGY IP D  VEF+   ++++P
Sbjct  353  ESDVEKMTYLGAVVKETFRRHPPSHFLLSHAATEEIELGGYKIPADVNVEFYTAWLTENP  412

Query  517  TLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             +W +P +F P+RFL+G G + DITG+  VKM+PFG
Sbjct  413  EMWENPSEFRPERFLTGDGVEVDITGMRGVKMLPFG  448



>ref|XP_008242488.1| PREDICTED: cytochrome P450 77A3 [Prunus mume]
Length=517

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 135/213 (63%), Gaps = 6/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE-NPGSDKSAAT---FSYLDTLFDLTVEGRKSS  168
            Q +   E+R++Q+E +VPLI  R+  ++ N  SD +  +    +Y+D+LF+L V GR   
Sbjct  238  QVREAKELRRRQLECLVPLIRNRKTFVQANQSSDGNMVSPKGAAYIDSLFELEVPGRAQR  297

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-VDEKD  345
                ELVTL SE +N GTDT+AT +EWA+  L+ N  IQ KL          ++ V E D
Sbjct  298  LGEEELVTLCSEVINAGTDTSATTLEWALLHLVMNQEIQQKLXXXXXXXXXXKEEVTESD  357

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KM YL+AVVKE  R+HPP+ F L+HA  + T+LGGY +P D  VEF+   +++DP LW
Sbjct  358  VEKMSYLSAVVKETFRRHPPSHFVLSHAAVKETELGGYTVPADASVEFYTAWVTEDPDLW  417

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             DP +F P+RFL G G D D+TG   VKM+PFG
Sbjct  418  EDPGEFRPERFLEGDGVDVDVTGTKGVKMVPFG  450



>gb|KFK24754.1| hypothetical protein AALP_AA8G020600 [Arabis alpina]
Length=316

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 15/213 (7%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSAATF----SYLDTLFDLTVEGRK  162
            RKR     ++R++Q E ++PLI  R+R +E               SY+DTL DL +   K
Sbjct  51   RKRWEEFFQIRREQHEVLLPLILARKRMVEERKKKMEEEEEEYVQSYVDTLLDLELPEEK  110

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEK  342
                  E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEE+K        +E 
Sbjct  111  RKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQERLYEEVKGA------EEI  164

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            + +KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I  DP +
Sbjct  165  EVEKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIGRDPEV  224

Query  523  WSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            W +P  F P+RF+  GE+ DITG   +KMMPFG
Sbjct  225  WKEPMAFKPERFM--GEEVDITGSRGIKMMPFG  255



>ref|XP_010227164.1| PREDICTED: cytochrome P450 77A1 [Brachypodium distachyon]
Length=522

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 134/212 (63%), Gaps = 12/212 (6%)
 Frame = +1

Query  22   VRKQQIETIVPLIERRRRALENPGSD---------KSAATFSYLDTLFDLTVEGRKSSPT  174
            +RK+Q+  + PL+  RR  L+N G            S +  +Y+D+LFDL   GR     
Sbjct  240  LRKRQLGCLAPLVRARREFLQNGGKTGEIIGGVEMMSPSGEAYVDSLFDLEPPGRGKRLG  299

Query  175  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKDTD  351
              ELVTL SE ++ GTDT+ATA+EWA+  LI +P  Q ++Y+E+ +  G   ++ E D +
Sbjct  300  EEELVTLCSEVMSAGTDTSATALEWAMMHLILDPKAQERVYDEVVAKAGKTARITEADVE  359

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
             MPYL AVVKE  R+HPP+ F L+HA T+ T+LGGY +P    VEF+   I+++P  W D
Sbjct  360  DMPYLQAVVKETFRRHPPSHFVLSHAATRDTELGGYRVPATASVEFYTAWITENPATWPD  419

Query  532  PEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            P+ + P+RFL GGE  D DITG  A++MMPFG
Sbjct  420  PDAWRPERFLEGGEGHDTDITGTRALRMMPFG  451



>ref|XP_004171686.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
Length=512

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 138/221 (62%), Gaps = 15/221 (7%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSA---ATFSYLDTLFDLTVEGRKS  165
            RKR    L+ +K + E ++PLIE RR+A EN G ++        SY+DTL DL     K 
Sbjct  231  RKRWETFLKFKKNRDEVLIPLIEARRKAKENRGGEEKQDEEFVVSYVDTLLDLDHPEEKR  290

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVD  336
              T  E+V + SEFLN GTDTT+TA++W +A L++NP IQ+KLY EIK V+GD    +V 
Sbjct  291  KLTEEEIVAIASEFLNAGTDTTSTALQWIMANLVKNPEIQNKLYAEIKGVMGDGSREEVM  350

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E++  K+PYL AVV E LR+HPP  F L HAV + T+L  Y IP +  V F +  +  DP
Sbjct  351  EEELGKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTELENYVIPKNGSVNFMVAEMGWDP  410

Query  517  TLWSDPEKFDPDRFLSGGE------DADITGVTAVKMMPFG  621
             +W DP +F P+RF+ GG       + DITG   +KMMPFG
Sbjct  411  KVWEDPMEFKPERFMKGGAGEEGVVEFDITGSKEIKMMPFG  451



>ref|XP_010528671.1| PREDICTED: cytochrome P450 89A2-like [Tarenaya hassleriana]
Length=509

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 134/217 (62%), Gaps = 11/217 (5%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPG------SDKSAATFSYLDTLFDLTVEG  156
            RKR    L++R+ Q   ++PLI  RR+ ++         SD      SY+DTL DL +  
Sbjct  231  RKRWEDFLQLRRDQEAVLLPLIRARRKIVDENAKSGISDSDNKDYVLSYVDTLLDLELPD  290

Query  157  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG--DRK  330
             K      E+V+L SEFLN GTDTTATA++W +A L++ P IQ++L+EEIK V G  + +
Sbjct  291  EKRKLDEGEMVSLCSEFLNAGTDTTATALQWIMANLVKYPEIQNRLHEEIKGVTGGTEGE  350

Query  331  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
            + E+D  KMPYL AVV E LR+HPP    L H+VT  T LGGY +P +  + F +  +  
Sbjct  351  IKEEDLQKMPYLKAVVLEGLRRHPPGHLVLPHSVTDDTDLGGYSVPKNGTINFMVADMGW  410

Query  511  DPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            DP +W DP  F P+RF++G +  DITG   +KMMPFG
Sbjct  411  DPEVWEDPMAFKPERFVNGEDSVDITGSRGIKMMPFG  447



>gb|KJB46081.1| hypothetical protein B456_007G347700 [Gossypium raimondii]
Length=513

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 139/218 (64%), Gaps = 14/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRA----LENPGSDKSAATFSYLDTLFDLTVEGRK  162
            RKR   + ++RK+  + ++PLI  R++     L N GSD      +Y+DTL DL +   K
Sbjct  236  RKRWDQLFQLRKELDDALIPLIRERKKVKDERLSNKGSDDY--ELAYVDTLLDLELPEEK  293

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVD  336
                 AE+VTL SEF+N GTDTT+TA++W +A L++ P IQ +L+ EIK VVGD   +++
Sbjct  294  RKLDEAEMVTLASEFINAGTDTTSTALQWIMANLVKYPYIQDRLFLEIKGVVGDYVEEIE  353

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E+D  KMPYL AV+ E LR+HPP  F + H VT+ T LGGY IP +  + F +  +  DP
Sbjct  354  EEDLQKMPYLKAVILEGLRRHPPAHFVVPHCVTEDTVLGGYLIPKNGMINFMVADMGWDP  413

Query  517  TLWSDPEKFDPDRFLS---GGEDADITGVTAVKMMPFG  621
             +W DP  F P+RF++   GGE  DITG   +KMMPFG
Sbjct  414  KVWEDPMAFKPERFINNAGGGEVFDITGSREIKMMPFG  451



>gb|KGN63395.1| hypothetical protein Csa_2G437050 [Cucumis sativus]
Length=460

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 137/221 (62%), Gaps = 15/221 (7%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSA---ATFSYLDTLFDLTVEGRKS  165
            RKR    L+ +K + E ++PLIE RR+A EN G ++        SY+DTL DL     K 
Sbjct  179  RKRWETFLKFKKNRDEVLIPLIEARRKAKENRGGEEKQDEEFVVSYVDTLLDLDHPEEKR  238

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVD  336
              T  E+V + SEFLN GTDTT+TA++W +A L++NP IQ+KLY EIK V+GD    +V 
Sbjct  239  KLTEEEIVAIASEFLNAGTDTTSTALQWIMANLVKNPEIQNKLYAEIKGVMGDGSREEVM  298

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E++  K+PYL AVV E LR+HPP  F L HAV + T+L  Y IP +  V F +  +  DP
Sbjct  299  EEELGKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTELENYVIPKNGSVNFMVAEMGWDP  358

Query  517  TLWSDPEKFDPDRFLSGGE------DADITGVTAVKMMPFG  621
             +W DP +F P+RF+ GG       + DITG    KMMPFG
Sbjct  359  KVWEDPMEFKPERFMKGGAGEEGVVEFDITGSKERKMMPFG  399



>ref|XP_010665549.1| PREDICTED: cytochrome P450 77A4 [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 134/217 (62%), Gaps = 10/217 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF-------SYLDTLFDLTVEGR  159
            Q +R  E+RK+Q+E + PL+  R+  +E+ G   S+          +Y+D+L  L   GR
Sbjct  235  QLRRAKELRKRQMEILGPLVRARKAFVESGGRADSSPLHMASPVGAAYVDSLMGLDPPGR  294

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-D  336
                   ELVTL SE +N GTDT+ATAIEWA+  L+ +  +Q KLYEEI  VVG   + +
Sbjct  295  PGGLGEEELVTLCSEVINAGTDTSATAIEWALLHLVVDQRVQQKLYEEIVDVVGKNGIIN  354

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E D +KM YL A++KE LR+HPP+ F L+HA T  T LGGY IP D  +E +   ++ DP
Sbjct  355  EDDLEKMVYLKAIIKETLRRHPPSHFLLSHAATDDTVLGGYTIPKDINLEIYTAWLTQDP  414

Query  517  TLWSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  621
            TLW DPE F P+RFL G  G + D TG   V M+PFG
Sbjct  415  TLWPDPEAFRPERFLPGEEGYEVDWTGNRGVNMLPFG  451



>ref|XP_006307273.1| hypothetical protein CARUB_v10008888mg [Capsella rubella]
 gb|EOA40171.1| hypothetical protein CARUB_v10008888mg [Capsella rubella]
Length=510

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q++ +VPLI  RR+   A E+P  +  S    +Y+D+LF L +  R   
Sbjct  236  QVREARELRKTQLDCLVPLIRNRRKFVLAKESPNEEMVSPIGAAYVDSLFGLNLVERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYEE+  VVG   V +E D
Sbjct  296  LRDEEIVTLCSEIVSAGTDTSATTLEWALCHLVSDQNIQEKLYEEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VEF+   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEFYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF P+RFL+GG+  DAD TG   V M+PFG
Sbjct  416  SDPGKFRPERFLTGGDGVDADWTGTRGVTMLPFG  449



>emb|CDY56131.1| BnaA02g20200D [Brassica napus]
Length=491

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 125/201 (62%), Gaps = 13/201 (6%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTLV  198
            ++R++Q + ++PLI  RR+ +E    +      SY+DTL DL +   K      E+V+L 
Sbjct  242  QMRREQGDVLLPLIRARRKIVEERMKNSKDYVQSYVDTLLDLELPEEKRKLNEEEIVSLC  301

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            SEFLNGGTDTTATA++W +A L++NP IQ +LYEEIKSV             MPYL AVV
Sbjct  302  SEFLNGGTDTTATALQWIMANLVKNPEIQERLYEEIKSV-------------MPYLKAVV  348

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
             E LR+HPP  F L H+VT+ T LGGY +P    V F +  I  DP +W DP +F P+RF
Sbjct  349  LEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKRGTVNFMVAEIGRDPAVWDDPMEFKPERF  408

Query  559  LSGGEDADITGVTAVKMMPFG  621
            +   E  DITG   +KMMPFG
Sbjct  409  IGEEEPVDITGSRGIKMMPFG  429



>gb|KJB68589.1| hypothetical protein B456_010G252700 [Gossypium raimondii]
Length=506

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 136/213 (64%), Gaps = 6/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q K+   +RK+Q+E +VPLI+ RR  +E   NP  +  S    +Y+D+LF L  +  +  
Sbjct  234  QMKKAKALRKKQLECLVPLIKARRAFVEKGENPNQEMVSPLGAAYIDSLFGLEPDKTRDP  293

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKD  345
                E VTL SE ++ GTDT+AT +EWA+  L+ N  IQ KLY EI   VG +  + E+D
Sbjct  294  LGEEEYVTLCSEVISAGTDTSATTVEWAMLHLVMNQDIQDKLYHEIVECVGKNGDIKEED  353

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KM YL +VVKE  R+HPP+ F L+HA  + T+LGGY IP    VEF+   I++DP +W
Sbjct  354  VEKMAYLESVVKETFRRHPPSHFLLSHAAIKDTELGGYTIPEGVHVEFYTAWITEDPDIW  413

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            SDP +F PDRFL G G   D+TG  +VKM+PFG
Sbjct  414  SDPGEFRPDRFLRGDGVGVDVTGTRSVKMLPFG  446



>ref|XP_004508228.1| PREDICTED: uncharacterized protein LOC101501316 [Cicer arietinum]
Length=1078

 Score =   193 bits (490),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 136/212 (64%), Gaps = 8/212 (4%)
 Frame = +1

Query  7     KRVLEVRKQQIETIVPLIERRRRALENPGSDK-----SAATFSYLDTLFDLTVEGRKSSP  171
             K   ++RK Q+E + PLI +R+  +E+ G        S    +Y+D+LF L V GR    
Sbjct  806   KEARKLRKIQVELLAPLIRKRKAYVESDGKCGDPEMVSPVGAAYVDSLFALEVPGR-GKL  864

Query  172   TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVD-EKDT  348
                ELVTLVSE ++ GTDT+ATA+EWA+  L+ +  IQ +LY EI   VG   V  E D 
Sbjct  865   GEEELVTLVSEIMSAGTDTSATAVEWALLHLVMDQEIQERLYREIVDCVGKCGVILESDV  924

Query  349   DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
             +KM YL A+VKE  R+HPP+ F L+HA T+ T+LGGY +P D  VEF+   +++DP +W 
Sbjct  925   EKMHYLGAIVKETFRRHPPSHFVLSHAATEETELGGYTVPADASVEFYTAWLTEDPNMWE  984

Query  529   DPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             DP +F P+RFL+G G D D+TG   VKMMPFG
Sbjct  985   DPNEFRPERFLNGDGVDVDVTGTKEVKMMPFG  1016



>ref|XP_007026022.1| Cytochrome P450, family 77, subfamily B, polypeptide 1 [Theobroma 
cacao]
 gb|EOY28644.1| Cytochrome P450, family 77, subfamily B, polypeptide 1 [Theobroma 
cacao]
Length=505

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 138/213 (65%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q K    +RK+Q+E +VPLI+ RR  +E   NP  +  S    +Y+D+LF L    R   
Sbjct  234  QMKEAKALRKRQLECLVPLIKNRRAFVEKGENPNQEMVSPIGAAYIDSLFGLEPATR-GP  292

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKD  345
                E VTL SE ++ GTDT+AT +EWA+  L+    IQ KLY+EI +VVG +  + E+D
Sbjct  293  LGEEEYVTLCSEVISAGTDTSATTVEWAMLHLVTKQEIQDKLYQEIVAVVGKNGDIQEED  352

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KMPYL+AVVKE LR+HPP  F L+HA  + T+LGGY IP    VEF+   I+++P +W
Sbjct  353  VEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYTIPEGVFVEFYTAWITENPDIW  412

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            SDP +F P+RFL G G   D+TG  AVKM+PFG
Sbjct  413  SDPGEFQPERFLHGDGVGVDVTGTRAVKMVPFG  445



>gb|KJB46083.1| hypothetical protein B456_007G347900 [Gossypium raimondii]
Length=512

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 137/211 (65%), Gaps = 7/211 (3%)
 Frame = +1

Query  10   RVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTLFDLTVEGRKSSPTNAE  183
            ++ ++RK   ++ +PLI  R++A +   S+K +A +  +Y+DTL DL +   K     AE
Sbjct  240  QLFKLRKDLEDSYIPLIRARKKAKDERLSNKGSADYVLAYVDTLLDLELPEEKRKLDEAE  299

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEKDTDKM  357
            +VTL SEF+N GTDTT+TA++W +A L++ P IQ +L  EIK VVGD   ++ E+D  KM
Sbjct  300  MVTLASEFINAGTDTTSTALQWVMANLVKYPHIQDRLLVEIKGVVGDSVEEIKEEDLQKM  359

Query  358  PYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPE  537
            PYL AV+ E LR+HPP  F + H VT+ T LGGY IP +  + F +  +  DP +W DP 
Sbjct  360  PYLRAVILEGLRRHPPAHFVVPHCVTEDTVLGGYLIPKNSTINFMVADMGWDPKVWEDPM  419

Query  538  KFDPDRFLS---GGEDADITGVTAVKMMPFG  621
             F P+RF++   GGE  DITG   +KMMPFG
Sbjct  420  AFKPERFINNAGGGEVFDITGSREIKMMPFG  450



>gb|KJB18538.1| hypothetical protein B456_003G058600 [Gossypium raimondii]
Length=512

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 131/212 (62%), Gaps = 6/212 (3%)
 Frame = +1

Query  4    RKRVLEV---RKQQIETIVPLIERRRRALENPGSDKSA--ATFSYLDTLFDLTVEGRKSS  168
            RKR  E    RK Q + ++PLI  R++A E   SDK +     +Y+DTL DL +   K  
Sbjct  236  RKRWQEFFQRRKDQEDVLIPLIRARKKAKEEKLSDKKSDDYVLAYVDTLLDLELPEEKRK  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RKVDEKD  345
             T  E+ +L SEFLN GTDTT+TA++W +A L++ P IQ KL+ EIK VVGD  ++ E D
Sbjct  296  LTEGEIFSLASEFLNAGTDTTSTALQWVMANLVKYPHIQDKLFLEIKGVVGDGEEIKEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL AV+ E LR+HPP  F L H VT+ T LG Y +P +  + F +  +  DP +W
Sbjct  356  LQKMPYLKAVILEGLRRHPPGHFVLPHCVTEDTVLGDYLVPKNGTINFMVAEMGWDPKVW  415

Query  526  SDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
             DP  F P+RF+   +  DITG   +KMMPFG
Sbjct  416  EDPMAFKPERFMRNEQVFDITGSREIKMMPFG  447



>ref|NP_172626.1| cytochrome P450, family 77, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAD30263.1|AC007296_24 Strong similarity to gb|U61231 cytochrome P450 from Arabidopsis 
thaliana and is a member of the PF|00067 Cytochrome P450 
family. ESTs gb|Z30775 and gb|Z30776 come from this gene [Arabidopsis 
thaliana]
 gb|AAM61354.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAF01194.1| cytochrome P450 like protein [Arabidopsis thaliana]
 gb|AEE28758.1| cytochrome P450, family 77, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
Length=510

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 139/214 (65%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI  RR+   A ENP  +  S    +Y+D+LF L +  R   
Sbjct  236  QVREARELRKTQLECLVPLIRNRRKFVDAKENPNEEMVSPIGAAYVDSLFRLNLIERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYEE+  VVG   V +E D
Sbjct  296  LGDEEIVTLCSEIVSAGTDTSATTLEWALFHLVTDQNIQEKLYEEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VE +   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEIYTAWVTENPDIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF P+RFL+GG+  DAD TG   V M+PFG
Sbjct  416  SDPGKFRPERFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_010553818.1| PREDICTED: cytochrome P450 89A2-like [Tarenaya hassleriana]
Length=516

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 11/213 (5%)
 Frame = +1

Query  16   LEVRKQQIETIVPLIERRRRALE---NPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAEL  186
            L++R++Q   ++PLI  RR+ ++     G        SY+DTL DL +   K      E+
Sbjct  235  LQLRREQEAVLLPLICARRKIVDEKTKSGLSHKDYVLSYVDTLLDLELPDEKRKLNENEM  294

Query  187  VTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEK--------  342
            ++L SEFLN GTDTTATA++W +A L++ P IQ++LYEEIK VV   + +          
Sbjct  295  ISLCSEFLNAGTDTTATALQWIMANLVKYPEIQNRLYEEIKGVVSRNRGESGEEGEISEE  354

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KMPYL AVV E LR+HPP    L H+VT  T L GY +P +C + F +  +  DP +
Sbjct  355  DVQKMPYLKAVVLEGLRRHPPGHTVLPHSVTDETVLAGYSVPKNCTINFMVAEMGWDPQV  414

Query  523  WSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            W DP  F+P+RF++G E  DITG   +KMMPFG
Sbjct  415  WDDPMAFNPERFINGEEAVDITGSRGIKMMPFG  447



>gb|KJB69319.1| hypothetical protein B456_011G016000 [Gossypium raimondii]
Length=506

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 136/213 (64%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q K    +RK+Q+E +VPLI+ RR  +E   NP  +  S    +Y+D+LF L    R   
Sbjct  234  QMKEAKALRKKQLECLVPLIKNRRAFVEKGENPNQEMVSPIGAAYVDSLFGLEPPTR-GP  292

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKD  345
              + E VTL SE ++ GTDT+AT +EWA+  L+ N  IQ KLY+EI   VG D ++ E+D
Sbjct  293  LGDEEYVTLCSEAISAGTDTSATTVEWAMLHLVMNQEIQEKLYQEIIDCVGKDGEIKEED  352

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KMPYL A+VKE  R+HPP  F L+HA T+ T+L GY IP    VE +   I++DP +W
Sbjct  353  VEKMPYLEAIVKETFRRHPPGHFLLSHAATKDTELAGYTIPAGVYVEIYTAWITEDPDIW  412

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            SDP +F P+RFL G G   D+TG  AVKM+PFG
Sbjct  413  SDPSEFRPERFLHGDGVGVDVTGTRAVKMLPFG  445



>ref|XP_002518513.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43900.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 131/214 (61%), Gaps = 8/214 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q KR  E+RK+Q+E + PLI  RR  +E   NPGS   SA   +Y+D+LF L   GR   
Sbjct  233  QMKRAKELRKRQMECLSPLIRNRRAYVEKGENPGSSMVSAVGAAYVDSLFGLEAPGR-GR  291

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDT  348
                ELVTL SE    G DT+ + ++W    L+ N  IQ KLYEEI   VG      +DT
Sbjct  292  LGEEELVTLCSELFVAGIDTSTSVLQWVFLELVLNQDIQEKLYEEIVDGVGKNGAITEDT  351

Query  349  -DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KMPYLNAVVKE LR H P  F L HA T+ T+LGGY IP +  VEF++  +++DP +W
Sbjct  352  VEKMPYLNAVVKETLRVHSPAHFTLAHAATEETELGGYKIPTNVNVEFYIEWMTEDPQMW  411

Query  526  SDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  621
             DP  F P+RFL G G D D+TG    VKM+PFG
Sbjct  412  KDPGVFRPERFLEGDGVDVDLTGTKGTVKMLPFG  445



>ref|XP_002970486.1| hypothetical protein SELMODRAFT_22493, partial [Selaginella moellendorffii]
 gb|EFJ28616.1| hypothetical protein SELMODRAFT_22493, partial [Selaginella moellendorffii]
Length=477

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 136/204 (67%), Gaps = 7/204 (3%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLT-VEGRKSSPTNAELVTL  195
            E+  ++ E ++PLI+R +        D++    SYL +LF L   E  +   T+ +L+ L
Sbjct  217  ELVGERRELLLPLIQRAKLLAAEDKLDQN----SYLSSLFSLQRQEDHQLKLTDEDLIVL  272

Query  196  VSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAV  375
             SEFLN G DTTA  +EW++A +I++P +Q KL EEI S VGD+ V EKD DK+ YL AV
Sbjct  273  CSEFLNAGADTTANTLEWSLANVIKHPAVQKKLLEEIHSSVGDKPVTEKDIDKLVYLKAV  332

Query  376  VKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDR  555
            VKE LRKHPP +  L HAVT+P KLGGYDIP+   + F + AI++DP LW++P+++ P+R
Sbjct  333  VKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLFNIYAINNDPELWTNPDEYKPER  392

Query  556  FLSG-GEDADITGVT-AVKMMPFG  621
            FL G G  AD T  + A+ ++PFG
Sbjct  393  FLEGPGASADFTASSGALNLIPFG  416



>ref|NP_178922.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAM15091.1| putative cytochrome p450 [Arabidopsis thaliana]
 gb|AAM15354.1| putative cytochrome p450 [Arabidopsis thaliana]
 gb|AEC06192.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=512

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 136/218 (62%), Gaps = 12/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALE---NPGS----DKSAATFSYLDTLFDLTVE  153
            RKR     ++R++Q + ++PLI  RR+ +E   N  S    D      SY+DTL +L + 
Sbjct  232  RKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSEEEEDNKVYVQSYVDTLLELELP  291

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV  333
              K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEEIKSVVG+   
Sbjct  292  DEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQKRLYEEIKSVVGEEAK  351

Query  334  DEK--DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            + +  D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I 
Sbjct  352  EVEEEDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIG  411

Query  508  DDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
             DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  412  RDPMVWEEPMAFKPERFMGEEEAVDITGSRGIKMMPFG  449



>ref|XP_009782165.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana sylvestris]
Length=517

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 137/216 (63%), Gaps = 14/216 (6%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIE-RRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAE  183
            K ++E+R++Q +  +PLIE R  RA E    ++  A   Y+DTL +L +     +    E
Sbjct  241  KELIELRQEQEKIFIPLIEARSSRAKEQKPDEEVVA---YVDTLLNLELPEENRNLNYGE  297

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-------VDEK  342
            +V+L SEFL+ GTDTT+TA++W +A L++NP IQ KLY+EI SVVG+++       V+E+
Sbjct  298  MVSLCSEFLSAGTDTTSTALQWVMANLVKNPSIQEKLYQEIASVVGEKQSKLTEEVVNEE  357

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KMPYL AV+ E LR+HPP  F L H VT+  +L GY +P +  + F +  +  DP +
Sbjct  358  DLHKMPYLKAVILEGLRRHPPGHFVLPHTVTEEAELNGYVVPKNATINFMVADMGLDPKV  417

Query  523  WSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  621
            W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  418  WEDPLEFKPERFLMEGSDKEGFDITGSREIKMMPFG  453



>ref|XP_002970487.1| hypothetical protein SELMODRAFT_93385 [Selaginella moellendorffii]
 gb|EFJ28617.1| hypothetical protein SELMODRAFT_93385 [Selaginella moellendorffii]
Length=503

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 136/204 (67%), Gaps = 7/204 (3%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLT-VEGRKSSPTNAELVTL  195
            E+  ++ E ++PLI+R +        D++    SYL +LF L   E  +   T+ +L+ L
Sbjct  241  ELVGERRELLLPLIQRAKLLAAEDKLDQN----SYLSSLFSLQRQEDHQLKLTDEDLIVL  296

Query  196  VSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAV  375
             SEFLN G DTTA  +EW++A +I++P +Q KL EEI S VGD+ V EKD DK+ YL AV
Sbjct  297  CSEFLNAGADTTANTLEWSLANVIKHPAVQKKLLEEIHSSVGDKPVTEKDIDKLVYLKAV  356

Query  376  VKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDR  555
            VKE LRKHPP +  L HAVT+P KLGGYDIP+   + F + AI++DP LW++P+++ P+R
Sbjct  357  VKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLFNIYAINNDPELWTNPDEYKPER  416

Query  556  FLSG-GEDADITGVT-AVKMMPFG  621
            FL G G  AD T  + A+ ++PFG
Sbjct  417  FLEGPGASADFTASSGALNLIPFG  440



>ref|XP_004148095.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
 gb|KGN63388.1| hypothetical protein Csa_2G435510 [Cucumis sativus]
Length=515

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 138/220 (63%), Gaps = 14/220 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPG-SDKSAATFSYLDTLFDLTVEGRKSSP  171
            RKR     ++RK Q + +  LI+ RR+A EN   +++     SY+DTL +L +   K   
Sbjct  231  RKRWEAFFQLRKNQEKVLTRLIDARRKANENRAQNEEEEIVVSYVDTLLELELPDEKRKL  290

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVDEK  342
             + ELVTL SEFLN GTDTT+TA++W +A L++ P IQ+KL+ E+K V+G+    +V E+
Sbjct  291  NDDELVTLCSEFLNAGTDTTSTALQWIMANLVKYPEIQNKLFVEMKGVMGNGSREEVKEE  350

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
               K+PYL AVV E LRKHPP  F L HAV + T+LG Y IP +  V F +  +  DP +
Sbjct  351  VLGKLPYLKAVVLEGLRKHPPAHFVLPHAVKEDTELGNYVIPKNASVNFMVAEMGRDPKV  410

Query  523  WSDPEKFDPDRFLSGGEDA-------DITGVTAVKMMPFG  621
            W DP  F+P+RF+ GG++        DITG   +KMMPFG
Sbjct  411  WEDPTAFNPERFMKGGKEKEEQVAEFDITGSKEIKMMPFG  450



>ref|XP_002524040.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38408.1| cytochrome P450, putative [Ricinus communis]
Length=516

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 133/216 (62%), Gaps = 10/216 (5%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTLFDLTVEGRKSS  168
            RKR    L+++K + E ++PLI  R++  E   S      F  SY+DTLFDL +   K  
Sbjct  233  RKRWSEFLQLQKDREEVLIPLIRARKKVNEEIKSKNCNNEFVLSYVDTLFDLQLPDEKRK  292

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV--GDRKVDEK  342
                E+V L +EFLN GTDTT+TA++W +A L++ P IQ KL+ EIKSVV  G+ +V E 
Sbjct  293  LREKEMVALCNEFLNAGTDTTSTALQWVMANLVKYPYIQEKLFMEIKSVVADGEEEVKED  352

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KM YL AV+ E LR+HPPT F L HAVT+   LG Y +P +  + F +  +  DP +
Sbjct  353  DLQKMSYLKAVILEGLRRHPPTHFVLPHAVTEDVVLGKYLVPKNANINFMVAEMGWDPEV  412

Query  523  WSDPEKFDPDRFL---SGGEDADITGVTAVKMMPFG  621
            W +P  F P+RF+   S GE  DITG   +KMMPFG
Sbjct  413  WEEPMAFKPERFMGSDSNGEVFDITGSREIKMMPFG  448



>ref|XP_010941087.1| PREDICTED: cytochrome P450 89A2-like [Elaeis guineensis]
Length=516

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 140/214 (65%), Gaps = 11/214 (5%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENP--GSDKSAATFSYLDTLFDLTVE---GRKSSP  171
            K  L++R+ QIE  VPLI+ R+    +P   +++    +SY+D+L D+ +    GRK   
Sbjct  237  KTALQMRQAQIELFVPLIKARKEYKNHPQHKNEEERYVYSYVDSLLDMEIPEEGGRKL--  294

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG--DRKVDEKD  345
            T  E+V+L SEFL  GTDTT+TA++W +A L+++ GIQ+KL EEI+ VVG  ++++ E+D
Sbjct  295  TEEEMVSLCSEFLTAGTDTTSTALQWIMANLVKHQGIQAKLLEEIERVVGKDEKEIKEED  354

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              +MPYL AV+ E LR+HPP  F + H VT+   L GY IP +  + F +  +S D  +W
Sbjct  355  LQRMPYLKAVILEGLRRHPPAHFVVPHKVTEDVTLDGYLIPRNASINFMVAEMSWDGKVW  414

Query  526  SDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  621
             +P +F P+RFL+G  GE  DITG   +KMMPFG
Sbjct  415  EEPMEFKPERFLAGGSGEGVDITGSREIKMMPFG  448



>gb|KJB67165.1| hypothetical protein B456_010G178900 [Gossypium raimondii]
Length=505

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 134/213 (63%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q K    +RK+Q+E + PLI+ RR  +E   NP  +  S    +Y+D+LF L    R   
Sbjct  234  QMKEAKALRKRQLECLAPLIKNRRAFVEKGENPNQEMVSPIGAAYIDSLFGLEPPTR-GP  292

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKD  345
                E VTL SE ++ GTDT+ T +EWA+  L+ N  IQ KLY+EI   VG D  + E+D
Sbjct  293  LGEEEYVTLCSEVISAGTDTSTTTVEWAMLNLVMNQDIQEKLYQEIVDCVGKDGDIKEED  352

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KMPYL AVVKE LR+HPP  F L+HA  + T+LGGY IP    VEF+   I+++P +W
Sbjct  353  IEKMPYLEAVVKETLRRHPPGHFLLSHAAIKDTELGGYTIPAGVHVEFYTAWITENPDIW  412

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            SDP +F P+RFL G G   D+TG  AVKM+PFG
Sbjct  413  SDPGEFRPERFLQGDGVGVDVTGTRAVKMVPFG  445



>ref|XP_002978564.1| hypothetical protein SELMODRAFT_108700 [Selaginella moellendorffii]
 gb|EFJ20550.1| hypothetical protein SELMODRAFT_108700 [Selaginella moellendorffii]
Length=502

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 135/204 (66%), Gaps = 7/204 (3%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLT-VEGRKSSPTNAELVTL  195
            E+  ++ E ++PLI+R +        D++    SYL +LF L   E  +   T+ +L+ L
Sbjct  240  ELVGERRELLLPLIQRAKLLAAEDKLDQN----SYLSSLFSLQRQEDHQLKLTDEDLIVL  295

Query  196  VSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAV  375
             SEFLN G DTTA  +EW++A +I++P +Q KL EEI S VGD+ V EKD DK+ YL AV
Sbjct  296  CSEFLNAGADTTANTLEWSLANVIKHPAVQKKLLEEIHSSVGDKPVTEKDIDKLVYLKAV  355

Query  376  VKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDR  555
            VKE LRKHPP +  L HAVT+P KLGGYDIP+   + F + AI++DP LW++P+++ P+R
Sbjct  356  VKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLFNIYAINNDPELWTNPDEYKPER  415

Query  556  FLSG-GEDADITGVTAV-KMMPFG  621
            FL G G  AD T  + V  ++PFG
Sbjct  416  FLEGPGASADFTASSGVLNLIPFG  439



>gb|ADP89483.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea mariana]
Length=210

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQEALYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPNIWPDPMTFNPRRF  120

Query  559  LSGGEDADITGVTAVKMMPFG  621
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|XP_006347570.1| PREDICTED: cytochrome P450 89A2-like [Solanum tuberosum]
Length=520

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 130/218 (60%), Gaps = 13/218 (6%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAEL  186
            K ++E+R++Q   I+PLIE R R  E           +Y+DTL +L +     +    E+
Sbjct  239  KELVELRREQESIIIPLIEARNRNKEQKKEQSDEFVVAYVDTLLNLELPEENRNLNLGEM  298

Query  187  VTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK---------VDE  339
            VTL  EFL+ GTDTT+TA++W +A L++NP IQ KLY EI SVVG+++         V E
Sbjct  299  VTLCREFLSAGTDTTSTALQWIMANLVKNPSIQEKLYREIASVVGEKQSKLSTDEEVVKE  358

Query  340  KDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPT  519
            +D  KMPYL AV+ E LR+HPP+     H VT+  +L GY +P +  + F +  +  DP 
Sbjct  359  EDFQKMPYLKAVILEGLRRHPPSHVLFPHTVTEEVELNGYTVPKNGTINFMVADMGLDPN  418

Query  520  LWSDPEKFDPDRFLSGGEDA----DITGVTAVKMMPFG  621
            +W DP +F P+RFL  G D     DITG   +KMMPFG
Sbjct  419  VWEDPMEFRPERFLVEGSDKGVDFDITGSKEIKMMPFG  456



>ref|XP_004148112.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
Length=519

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 141/228 (62%), Gaps = 22/228 (10%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSA---ATFSYLDTLFDLTVEGRKS  165
            RKR    L+ +K + E ++PLIE RR+A EN G ++        SY+DTL DL     K 
Sbjct  231  RKRWETFLKFKKNRDEVLIPLIEARRKAKENRGGEEKQDEEFVVSYVDTLLDLDHPEEKR  290

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVD  336
              T  E+V + SEFLN GTDTT+TA++W +A L++NP IQ+KLY EIK V+GD    +V 
Sbjct  291  KLTEEEIVAIASEFLNAGTDTTSTALQWIMANLVKNPEIQNKLYAEIKGVMGDGSREEVM  350

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLP------  498
            E++  K+PYL AVV E LR+HPP  F L HAV + T+L  Y IP +  V F +       
Sbjct  351  EEELGKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTELENYVIPKNGSVNFMVAEMGKIR  410

Query  499  --AISDDPTLWSDPEKFDPDRFLS--GGEDA---DITGVTAVKMMPFG  621
               I  DPT+W +P  F P+RF++  GGE+A   D+TG   +KMMPFG
Sbjct  411  WTEIGRDPTVWEEPMAFKPERFMNGDGGEEAAGFDVTGSKEIKMMPFG  458



>gb|ADP89481.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea mariana]
 gb|ADP89485.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea omorika]
 gb|ADP89486.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea omorika]
Length=210

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPKIWPDPMTFNPRRF  120

Query  559  LSGGEDADITGVTAVKMMPFG  621
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|XP_006302157.1| hypothetical protein CARUB_v10020166mg [Capsella rubella]
 gb|EOA35055.1| hypothetical protein CARUB_v10020166mg [Capsella rubella]
Length=509

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 137/219 (63%), Gaps = 16/219 (7%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLI--------ERRRRALENPGSDKSAATFSYLDTLFDLTV  150
            RKR     ++RK+Q E ++PLI        ER++R+LE    DK     SY+DTL D+ +
Sbjct  231  RKRWEEFFQMRKEQHEVLLPLIRARRKIVEERKKRSLE---EDKKEYVQSYVDTLLDVEL  287

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK  330
               K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +L+EEI SVVG+  
Sbjct  288  PDEKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPDIQKRLHEEITSVVGEEA  347

Query  331  VDEK--DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAI  504
             + +  D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I
Sbjct  348  KEVEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEI  407

Query  505  SDDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
              DP +W +P +F P+RF+   E  DITG   +KMMPFG
Sbjct  408  GRDPKVWEEPMEFKPERFIGEEESVDITGSRGIKMMPFG  446



>gb|ADP89490.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea glauca]
 gb|ADP89491.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea glauca]
 gb|ADP89492.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea glauca]
Length=210

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPKIWPDPMTFNPRRF  120

Query  559  LSGGEDADITGVTAVKMMPFG  621
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>gb|ADP89478.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea abies]
 gb|ADP89479.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea abies]
 gb|ADP89480.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea abies]
Length=210

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W DP  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPKIWPDPMTFNPRRF  120

Query  559  LSGGEDADITGVTAVKMMPFG  621
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|XP_009118184.1| PREDICTED: cytochrome P450 77A3 [Brassica rapa]
Length=510

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI+ RR    A E+P  +  S    +Y+D+LF L    R   
Sbjct  236  QVREARELRKTQLECLVPLIKNRRAFVDAKESPNEEMVSPIGAAYVDSLFSLKPVERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYEE+  VVG R V +E D
Sbjct  296  LRDEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDQNIQEKLYEEVVGVVGKRGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VEF+   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEFYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF P+RFL+GG+  +AD TG   V M+PFG
Sbjct  416  SDPGKFRPERFLAGGDGVNADWTGTRGVTMLPFG  449



>ref|XP_010931808.1| PREDICTED: cytochrome P450 77A3 [Elaeis guineensis]
Length=518

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 138/215 (64%), Gaps = 16/215 (7%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDK---------SAATFSYLDTLFDLTVEGRKSSP  171
            ++RK+Q++ ++PL+ R RRA    G +K         S    +Y+D+LF L   GR    
Sbjct  242  KLRKRQMDCLLPLV-RARRAFVKSGGEKDVNSPWEMVSPVGDAYIDSLFGLDPAGR-GRL  299

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG---DRKVDEK  342
               ELVTL SE ++ GTDT+ATA+EWA+  L+ + G Q +LY+EI   VG   +RK+ E 
Sbjct  300  GEGELVTLCSEVMSAGTDTSATALEWALLHLVLDQGAQERLYKEIVGNVGTEKERKITES  359

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D + M YL AVVKE LR+HPP+ F L+HA T+ T+LGGY IP +  VEF+   +++DP++
Sbjct  360  DVEGMGYLQAVVKETLRRHPPSHFVLSHAATRETELGGYRIPAEASVEFYTAWVAEDPSV  419

Query  523  WSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            W   E++ P+RF  GGE  + D+TG   V+MMPFG
Sbjct  420  WDKAEEWRPERFEEGGEGWETDVTGTRGVRMMPFG  454



>ref|XP_002886780.1| CYP89A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63039.1| CYP89A5 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 133/218 (61%), Gaps = 12/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALE-------NPGSDKSAATFSYLDTLFDLTVE  153
            RKR     ++R++Q + ++PLI  RR+ +E           D      SY+DTL DL + 
Sbjct  233  RKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSKEAEDNKEYVQSYVDTLLDLELP  292

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV  333
              K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEEIKSVVG+   
Sbjct  293  DEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQRRLYEEIKSVVGEEAK  352

Query  334  DEK--DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            + +  D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I 
Sbjct  353  EVEEEDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIG  412

Query  508  DDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
             DP +W +P  F P+RF+   E  DITG   + MMPFG
Sbjct  413  RDPKVWEEPMAFKPERFMGEEEPVDITGSRGITMMPFG  450



>ref|XP_002889880.1| CYP77B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66139.1| CYP77B1 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 139/214 (65%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI  RR+   A ++P  +  S    +Y+D+LF L +  R   
Sbjct  236  QVREARELRKTQLECLVPLIRNRRKFVDAKDSPNEEMVSPIGAAYVDSLFGLNLIERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYEE+  VVG   V +E D
Sbjct  296  LGDEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDQSIQEKLYEEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VE +   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEIYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP KF P+RFL+GG+  DAD TG   V M+PFG
Sbjct  416  SDPGKFRPERFLTGGDGVDADWTGTRGVTMLPFG  449



>ref|XP_007029515.1| Cytochrome P450, family 87, subfamily A, polypeptide 6, putative 
[Theobroma cacao]
 gb|EOY10017.1| Cytochrome P450, family 87, subfamily A, polypeptide 6, putative 
[Theobroma cacao]
Length=511

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 137/209 (66%), Gaps = 6/209 (3%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAEL  186
            K +L +RK Q ET+VPLI R RRAL++    + +    Y+DTLFDL +  +K      E+
Sbjct  241  KELLTLRKDQEETLVPLI-RARRALKDKNICQESF-LPYVDTLFDLNLPEQKRKLEEKEI  298

Query  187  VTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTD--KMP  360
            VTL SEF  GGTDTTAT+++W +A L++   IQ KL+EEIK V+GD +V+ K+ D  KMP
Sbjct  299  VTLCSEFFTGGTDTTATSLQWIMANLVKYQHIQDKLFEEIKGVIGDGEVEIKEDDLRKMP  358

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AV+ E LR+HPP+ F + H+VT+   L G+ +P D  V   +  +  DP +W +P +
Sbjct  359  YLRAVILEGLRRHPPSLFLVPHSVTKDVLLHGFLVPKDSVVTLTVGEMGRDPKVWENPME  418

Query  541  FDPDRFLSG--GEDADITGVTAVKMMPFG  621
            F P+RFL+G  GE  D TG   +KMMPFG
Sbjct  419  FKPERFLNGDDGEAFDFTGRKEIKMMPFG  447



>gb|KJB46082.1| hypothetical protein B456_007G347800 [Gossypium raimondii]
Length=509

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 136/213 (64%), Gaps = 8/213 (4%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSA--ATFSYLDTLFDLTVEGRKSS  168
            RKR   + ++RK++ + ++PL+  R++  +   S+K +     +Y+DTL DL +   K  
Sbjct  236  RKRWDQLFQLRKEREDVLIPLLRARKKGKDERLSNKESDDYVLAYVDTLLDLELPEEKRK  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEK  342
               AE+VTL SEF+N GTDTT+TA++W +A L++ P IQ +L +EIK VVGD    + E+
Sbjct  296  LDEAEMVTLASEFINAGTDTTSTALQWVMANLVKYPHIQERLLDEIKQVVGDGVEDIKEE  355

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KMP+L AV+ E LR+HPP  F + H VT+ T LGGY IP +  + F +  +  DP +
Sbjct  356  DLQKMPHLKAVILEGLRRHPPAHFVVPHCVTEDTILGGYLIPKNSNINFMVADMGWDPKV  415

Query  523  WSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            W DP  F P+RF+ G E  DITG   +KMMPFG
Sbjct  416  WEDPMAFKPERFI-GEEVFDITGSREIKMMPFG  447



>ref|XP_007029747.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
 gb|EOY10249.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
Length=513

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 134/213 (63%), Gaps = 8/213 (4%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSA--ATFSYLDTLFDLTVEGRKSSPTNA  180
            +++ ++RK Q + ++PLI  R++A E   + K +     +Y+DTL DL +   K      
Sbjct  239  EQLYQLRKDQEDLLIPLIRARKKAKEENLNKKESDDYVLAYVDTLLDLELPEDKRKLEEG  298

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEKDTDK  354
            E+VTL SEFLN GTDTT+TA++W +A L++ P +Q KL  EIK VVGD   ++ E D  K
Sbjct  299  EIVTLASEFLNAGTDTTSTALQWIMANLVKYPYVQDKLLLEIKGVVGDGAEEIQEDDLQK  358

Query  355  MPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDP  534
            MPYL AV+ E LR+HPP  F L H VT+ T LGG+ +P +  V F +  ++ DP +W DP
Sbjct  359  MPYLKAVILEGLRRHPPGHFVLPHCVTEDTVLGGFLVPKNGTVNFMVADMAWDPKVWEDP  418

Query  535  EKFDPDRFL----SGGEDADITGVTAVKMMPFG  621
              F P+RFL    S GE  DITG   +KMMPFG
Sbjct  419  MAFKPERFLRSDDSSGEVFDITGSREIKMMPFG  451



>ref|XP_011005628.1| PREDICTED: cytochrome P450 89A2-like [Populus euphratica]
Length=512

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 132/216 (61%), Gaps = 11/216 (5%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALE----NPGSDKS----AATFSYLDTLFDLTVEGRK  162
            + +  +RK Q + ++PLI  R++A E        DK         SY+DT+  L +   K
Sbjct  235  RELFRLRKCQEDVLIPLIRARKKAKEESVNKSKEDKKDYEDEYVLSYVDTILALELPEEK  294

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV--GDRKVD  336
                  E+V+L SEFLNGGTDTT+TA++W +A L++ P IQ KL+ EIK VV  G+  + 
Sbjct  295  RKLNEEEMVSLCSEFLNGGTDTTSTALQWIMANLVKYPQIQEKLFMEIKGVVQDGEENIK  354

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E++  KMPYL A++ E LR+HPPT F L HAVT+   LG Y +P D  + F +  +  +P
Sbjct  355  EEELQKMPYLKAIILEGLRRHPPTHFVLPHAVTEDVVLGKYVVPKDGTINFMVAEMGWNP  414

Query  517  TLWSDPEKFDPDRFL-SGGEDADITGVTAVKMMPFG  621
             +W DP  F P+RFL SGGE  DITG   +KMMPFG
Sbjct  415  KVWEDPMVFKPERFLNSGGETFDITGSREIKMMPFG  450



>ref|XP_002306325.1| hypothetical protein POPTR_0005s08140g [Populus trichocarpa]
 gb|EEE93321.1| hypothetical protein POPTR_0005s08140g [Populus trichocarpa]
Length=507

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 131/220 (60%), Gaps = 14/220 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLI--------ERRRRALENPGSDKSAATFSYLDTLFDLTV  150
            RKR   +  +RK Q + ++PLI        ER RR  E+    +     SY+DTL  L +
Sbjct  226  RKRWNELFRLRKLQEDVLIPLIRARKKAKEERIRRGKEDKKGHEDEYVLSYVDTLLSLEL  285

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV--GD  324
               K      E+V+L SEFLNGGTDTT+TA++W +A L++ P IQ KL+ EIK VV  G+
Sbjct  286  PEEKRKLEEGEMVSLCSEFLNGGTDTTSTALQWIMANLVKYPQIQEKLFMEIKGVVRDGE  345

Query  325  RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAI  504
              + E +  KMPYL A++ E LR+HPP  F L HAVT+   L  Y IP D  + F +  +
Sbjct  346  ENIKEDELQKMPYLKAIILEGLRRHPPGHFVLPHAVTEDVVLDKYVIPKDGTINFMVAEM  405

Query  505  SDDPTLWSDPEKFDPDRFLS-GGEDADITGVTAVKMMPFG  621
              DP +W DP  F P+RFL+ GGE  DITG   +KMMPFG
Sbjct  406  GWDPKVWEDPMAFKPERFLNGGGETFDITGSREIKMMPFG  445



>gb|ADP89484.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea omorika]
Length=210

 Score =   175 bits (443),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
            KE LR+HPP  F L+HAVTQ  KL GYDIP    VEF+   +S DP +W +P  F+P RF
Sbjct  61   KETLRRHPPGHFVLSHAVTQDCKLRGYDIPYKANVEFYTAWMSFDPKIWPNPMTFNPRRF  120

Query  559  LSGGEDADITGVTAVKMMPFG  621
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|NP_176675.1| cytochrome P450, family 89, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 gb|AAD38269.1|AC006193_25 Putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAK59583.1| putative cytochrome p450 protein [Arabidopsis thaliana]
 gb|AAK93709.1| putative cytochrome p450 protein [Arabidopsis thaliana]
 gb|AEE34308.1| cytochrome P450, family 89, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=510

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALE---NPGS----DKSAATFSYLDTLFDLTVE  153
            RKR     ++R++Q + ++PLI  RR+ +E   N  S    D      SY+DTL +L + 
Sbjct  232  RKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSEEEEDNKEYVQSYVDTLLELELP  291

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS--VVGDR  327
              K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEEIKS       
Sbjct  292  DEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPDIQKRLYEEIKSVVGEEAN  351

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            +V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P +  + F +  I 
Sbjct  352  EVEEEDAQKMPYLEAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKNGTINFMVAEIG  411

Query  508  DDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
             DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  412  RDPKVWEEPMAFKPERFME--EAVDITGSRGIKMMPFG  447



>gb|AAK96572.1| At1g64950/F13O11_25 [Arabidopsis thaliana]
Length=510

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALE---NPGS----DKSAATFSYLDTLFDLTVE  153
            RKR     ++R++Q + ++PLI  RR+ +E   N  S    D      SY+DTL +L + 
Sbjct  232  RKRWEEFFQMRREQHDVLLPLIRARRKIVEERKNRSSEEEEDNKEYVQSYVDTLLELELP  291

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS--VVGDR  327
              K      E+V+L SEFLNGGTDTTATA++W +A L++NP IQ +LYEEIKS       
Sbjct  292  DEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPDIQKRLYEEIKSVVGEEAN  351

Query  328  KVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAIS  507
            +V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P +  + F +  I 
Sbjct  352  EVEEEDAQKMPYLEAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKNGTINFMVAEIG  411

Query  508  DDPTLWSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
             DP +W +P  F P+RF+   E  DITG   +KMMPFG
Sbjct  412  RDPKVWEEPMAFKPERFME--EAVDITGSRGIKMMPFG  447



>ref|XP_006419167.1| hypothetical protein EUTSA_v10002491mg [Eutrema salsugineum]
 gb|ESQ37603.1| hypothetical protein EUTSA_v10002491mg [Eutrema salsugineum]
Length=510

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 130/210 (62%), Gaps = 9/210 (4%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATF-------SYLDTLFDLTVEGRKSSPTN  177
            ++RK+Q + ++PLI  RR+ +E                  SY+DTL DL +   K     
Sbjct  239  KMRKEQRDVLLPLIRARRKIVEERKKRSEEEEEGNKDYVQSYVDTLLDLELPEEKRKLNE  298

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDT--D  351
             E+V+L SEFLNGGTDTTATA++W +A L+++P IQ KLY EIKSVVG+   + ++    
Sbjct  299  DEIVSLCSEFLNGGTDTTATALQWIMANLVKSPEIQEKLYSEIKSVVGEEAKEIEEEEAH  358

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
            KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I  DPT+W +
Sbjct  359  KMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIGRDPTVWEE  418

Query  532  PEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            P  F P+RF+   E  DITG   +KMMPFG
Sbjct  419  PMAFKPERFIGEEEPVDITGSRGIKMMPFG  448



>ref|XP_006662509.1| PREDICTED: cytochrome P450 89A2-like [Oryza brachyantha]
Length=460

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 130/212 (61%), Gaps = 7/212 (3%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTLFDLTV-EGRKSSPTN  177
            K+   +R++Q +  VPLI  RR   ++ G  +  +TF  SY DTL D+ + E    + T+
Sbjct  187  KKAHALRQRQKDLFVPLINSRREYKKHGGEPRKESTFEHSYADTLLDIKLPEDGNRALTD  246

Query  178  AELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEKDTD  351
             E+V L SEFLN GTDTT+TA++W +A L++NP IQSKLYEEIKS  GD  R+V E+D  
Sbjct  247  DEMVNLCSEFLNAGTDTTSTALQWIMAELVKNPSIQSKLYEEIKSKTGDGQREVSEEDVH  306

Query  352  KMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSD  531
             MPYL  VV E LRKHPP    L H   +  ++GGY IP    V F +  +  D   W  
Sbjct  307  GMPYLKVVVLEGLRKHPPGHMVLPHKAAEDMEIGGYLIPKGATVNFMVAEMGRDEKEWEK  366

Query  532  PEKFDPDRFLSG--GEDADITGVTAVKMMPFG  621
            P +F P+RFL G  GE  D+TG   ++MMPFG
Sbjct  367  PMEFIPERFLPGGDGEGVDVTGTREIRMMPFG  398



>gb|EAY79193.1| hypothetical protein OsI_34305 [Oryza sativa Indica Group]
Length=522

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 137/215 (64%), Gaps = 14/215 (7%)
 Frame = +1

Query  16   LEVRKQQIETIVPLIERRR---RALENPGSD---KSAATF--SYLDTLFDLTV---EGRK  162
            L +R+QQ E  VPLI+ RR     ++  GS    +   TF  SY+DTL D+++   +G +
Sbjct  246  LALRRQQKELFVPLIDARRARKNHIQQSGSPPVPEKETTFEHSYVDTLLDISLPDTDGDR  305

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEK  342
            +  T+ ELV L SEFLN GTDTTATA++W +A L++NP IQSKL++EIKS   D ++ E+
Sbjct  306  AL-TDDELVMLCSEFLNAGTDTTATALQWIMAELVKNPSIQSKLHDEIKSKTSDDEITEE  364

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            DT  MPYL AV+ E LRKHPPT F L H   +  ++GGY IP    V F +  +  D   
Sbjct  365  DTHDMPYLKAVILEGLRKHPPTHFVLPHKAAEDVEVGGYLIPKGATVNFMVAEMGRDERE  424

Query  523  WSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  621
            W  P +F P+RFL+G  GE  D+TG   V+MMPFG
Sbjct  425  WEKPMEFIPERFLAGGDGEGVDVTGSREVRMMPFG  459



>ref|XP_010101456.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXB88439.1| Cytochrome P450 77A3 [Morus notabilis]
Length=498

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 132/213 (62%), Gaps = 15/213 (7%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDK----SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+R++Q+E +VPLI  RR+ +E+ G       S    +Y+D+LFDL   GR   
Sbjct  234  QVRAAKELRRKQLECLVPLIRNRRKFIESGGKVDEEMVSPVGAAYIDSLFDLEAPGR-GR  292

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEKD  345
                ELVTL SE +N GTDT+ATA EWA+  L+ +  +Q KLY+EI   VG D  V E D
Sbjct  293  LGEEELVTLCSEIINAGTDTSATAAEWALFHLVTDHSVQEKLYKEIVVTVGKDGVVLESD  352

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KM YL AVVKE  R+HPP+ F         TKLGGY +P D  VEF+   +++DP +W
Sbjct  353  VEKMAYLGAVVKETFRRHPPSHFD--------TKLGGYTVPADASVEFYTAWLTEDPDMW  404

Query  526  SDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
             DP +F P+RFL G G D D+TG   V+M+PFG
Sbjct  405  KDPMEFRPERFLDGDGVDVDVTGTKGVRMVPFG  437



>ref|XP_011086181.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=511

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 138/217 (64%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALENPGSDKSAAT--------FSYLDTLFDLTVEG  156
            Q K   E+R++Q+E +VPLI R R+A    G   +A T         +Y+D+LF +    
Sbjct  235  QVKAAKELRRKQMECLVPLI-RNRKAFVESGGHPNATTSEMASPLGAAYVDSLFKIEPPS  293

Query  157  RKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKV  333
            R       E++TL +E +  GTDT+ATA+EWA+  L+++  +Q  LY+EI   VG +  +
Sbjct  294  R-GRLGEEEILTLCTEAIVAGTDTSATALEWALLHLVQDQEMQEILYKEIVECVGKNGAI  352

Query  334  DEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDD  513
             E D +KMPYL A+VKE  R+HPP++F L+HA T+ T+LGGY IP    VE +   +++D
Sbjct  353  TESDVEKMPYLGAIVKETFRRHPPSYFLLSHAATKETELGGYTIPAGVNVEIYTKWLTED  412

Query  514  PTLWSDPEKFDPDRFLSG-GEDADITGVTAVKMMPFG  621
            P +W +P +F P+RFL+G G D DITG+  VKM+PFG
Sbjct  413  PEMWQNPSEFRPERFLTGDGVDVDITGLRGVKMLPFG  449



>ref|XP_007029748.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
 gb|EOY10250.1| Cytochrome P450, family 87, subfamily A, polypeptide 6 [Theobroma 
cacao]
Length=513

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 133/217 (61%), Gaps = 11/217 (5%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGSDKSA--ATFSYLDTLFDLTVEGRKSS  168
            RKR     ++RK Q + ++PLI  R++A E   + K++     +Y+DTL DL +   K  
Sbjct  235  RKRWEQFYQLRKDQEDLLIPLIRARKKAKEENLTKKASDDYVLAYVDTLLDLELPEEKRK  294

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEK  342
                E+V+L SEFLNGGTDTT+TA++W +A L++ P +Q KL  EIK VVGD   ++ E 
Sbjct  295  LEEGEIVSLASEFLNGGTDTTSTALQWIMANLVKYPHVQDKLLLEIKGVVGDGAEEIKED  354

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KMPYL AVV E LR+HPP  F L H  T+ T LGG+ +P +  V F +  +  DP +
Sbjct  355  DLQKMPYLKAVVLEGLRRHPPGHFVLPHCATEDTVLGGFLVPKNGTVNFMVADMGWDPKV  414

Query  523  WSDPEKFDPDRFL----SGGEDADITGVTAVKMMPFG  621
            W DP  F P+RFL      GE  DITG   +KMMPFG
Sbjct  415  WEDPMAFKPERFLRSDDGSGEVFDITGSREIKMMPFG  451



>ref|XP_010445937.1| PREDICTED: cytochrome P450 89A2-like [Camelina sativa]
Length=692

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 137/218 (63%), Gaps = 12/218 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALE-----NPGSDKSAATFSYLDTLFDLTVEGR  159
            RKR     ++R++Q + ++PLI  RR+ +E     +   D      SY+DTL D+ +   
Sbjct  412  RKRWEEFFQMRREQHDVLLPLIRARRKIVEERKKRSSEGDNKEYVQSYVDTLLDVELPDE  471

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDE  339
            K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEIKSVVG+ +  E
Sbjct  472  KRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPNIQRRLYEEIKSVVGEEEAKE  531

Query  340  K---DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
                D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I  
Sbjct  532  VEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIGR  591

Query  511  DPTLWSDPEKFDPDRFLSGGEDA-DITGVTAVKMMPFG  621
            DP +W +P  F+P+RF+   E++ DITG   +KMMPFG
Sbjct  592  DPKVWEEPMAFNPERFIGAQEESVDITGSRGIKMMPFG  629



>ref|XP_002268331.1| PREDICTED: cytochrome P450 89A2 [Vitis vinifera]
 ref|XP_010662053.1| PREDICTED: cytochrome P450 89A2 [Vitis vinifera]
Length=516

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 133/217 (61%), Gaps = 12/217 (6%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDK--------SAATFSYLDTLFDLTVEGRK  162
            ++ L++RK Q   ++PLI  R R  E   S +        S+    Y+DTL DL +   K
Sbjct  235  EKFLQLRKHQENVLIPLIRARERLKEELQSKQQEDSDNEDSSRITVYVDTLLDLQLPDEK  294

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK--VD  336
                ++ELV+L SEFLN GT TT T+++W +A L++ P IQ+K++EEI  V G R+  V 
Sbjct  295  RKLNDSELVSLCSEFLNAGTHTTYTSLQWIMANLVKYPHIQAKVFEEISGVKGTREDEVK  354

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            ++D  KMPYL AV+ E LR+HPP  F L HAV Q   LGGY IP +  + F +  I+ +P
Sbjct  355  QEDLQKMPYLKAVILEGLRRHPPGHFGLPHAVDQDVNLGGYTIPQNANIFFMVAEIAWNP  414

Query  517  TLWSDPEKFDPDRFLSGG--EDADITGVTAVKMMPFG  621
             +W DP +F P+RFL+G   E  D+TG   +KMMPFG
Sbjct  415  EVWEDPLEFKPERFLTGDGVEAFDVTGSKEIKMMPFG  451



>ref|XP_011005629.1| PREDICTED: cytochrome P450 89A2-like [Populus euphratica]
Length=512

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 132/216 (61%), Gaps = 11/216 (5%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALE----NPGSDKS----AATFSYLDTLFDLTVEGRK  162
            + +  +RK Q + ++PLI  R++A E        DK         SY+DT+  L +   K
Sbjct  235  RELFRLRKCQEDVLIPLIRARKKAKEESVNKSKEDKKDYEDEYVLSYVDTILALELPEEK  294

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV--GDRKVD  336
                  E+V+L SEFLNGGTDTT+TA++W +A L++ P IQ KL+ EIK VV  G+  + 
Sbjct  295  RKLNEEEMVSLCSEFLNGGTDTTSTALQWIMANLVKYPQIQEKLFMEIKGVVQDGEENIK  354

Query  337  EKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDP  516
            E++  KMPYL A++ E LR+HPP  FAL HAVT+   LG Y +P D  + F +  +  +P
Sbjct  355  EEELQKMPYLKAIILEGLRRHPPGHFALPHAVTEDVVLGKYVVPKDGTINFMVAEMGWNP  414

Query  517  TLWSDPEKFDPDRFL-SGGEDADITGVTAVKMMPFG  621
             +W DP  F P+RFL SGGE  DITG   +KMMPFG
Sbjct  415  KVWEDPMVFKPERFLNSGGETFDITGSREIKMMPFG  450



>gb|EMS64564.1| Cytochrome P450 89A2 [Triticum urartu]
Length=454

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 124/207 (60%), Gaps = 7/207 (3%)
 Frame = +1

Query  22   VRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTLFDLTVEGRKSSP-TNAELVT  192
            +R++Q E +VPLI  RR    + G  +   TF  SY+DTL D+ +      P T+ ELV 
Sbjct  186  MRRRQKELLVPLINARREYKSSGGEPRKETTFEHSYVDTLLDIKLPEEGDRPLTDNELVI  245

Query  193  LVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEKDTDKMPYL  366
            L SEFLN GTDTT+T ++W +A L++NP IQ KLYEEIK+  GD   +V   D  KMPYL
Sbjct  246  LCSEFLNAGTDTTSTGLQWIMAELVKNPAIQEKLYEEIKATTGDDQEEVSGDDIHKMPYL  305

Query  367  NAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFD  546
             AVV E LRKHPP  F L H   +  ++G Y IP    V F +  +  D   W  P +F 
Sbjct  306  KAVVLEGLRKHPPGHFVLPHKAAEDMEIGDYLIPKGATVNFMVAEMGRDEREWEKPLEFS  365

Query  547  PDRFLSG--GEDADITGVTAVKMMPFG  621
            PDRFL G  GE  D+TG   +KMMPFG
Sbjct  366  PDRFLPGGAGEGVDVTGNREIKMMPFG  392



>ref|XP_008459160.1| PREDICTED: cytochrome P450 89A2-like [Cucumis melo]
Length=531

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 139/223 (62%), Gaps = 17/223 (8%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGS---DKSAATF--SYLDTLFDLTVEGR  159
            RKR    L+++  + E ++PLIE RR+A EN G    +K    F  SY+DTL DL     
Sbjct  248  RKRWETFLKLKNNRDEVLIPLIEARRKAKENRGGGEEEKQDEEFVVSYVDTLLDLEHPEE  307

Query  160  KSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RK  330
            K   T+ E+V + SEFLN GTDTT+TA++W +A L++NP IQ+KLY EIK V+GD    +
Sbjct  308  KRKLTDEEIVAIASEFLNAGTDTTSTALQWIMANLVKNPEIQNKLYAEIKGVMGDGSREE  367

Query  331  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
            V E++  K+PYL AVV E LR+HPP  F L HAV + T+L  Y IP +  V F +  +  
Sbjct  368  VKEEELGKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTELENYVIPKNGSVNFMVAEMGW  427

Query  511  DPTLWSDPEKFDPDRFLSGGEDA------DITGVTAVKMMPFG  621
            DP +W DP +F P+RF+ GG         DITG   +KMMPFG
Sbjct  428  DPKVWEDPMEFKPERFMKGGAGEEGGVEFDITGSKEIKMMPFG  470



>ref|XP_008797233.1| PREDICTED: cytochrome P450 89A2-like, partial [Phoenix dactylifera]
Length=510

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 133/213 (62%), Gaps = 12/213 (6%)
 Frame = +1

Query  13   VLEVRKQQIETIVPLIERRRRALENPGSDKSAA---TFSYLDTLFDLTVE---GRKSSPT  174
            VL++R++Q E  VPLI  R+   E     KS      +SY+D+L D+ +    GR+   T
Sbjct  238  VLQMRQRQEELFVPLIRARKEFKEQQQRQKSEEERFVYSYVDSLLDIELSEEGGRRL--T  295

Query  175  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEKDT  348
              E+V L SEFLN GTDTT+TA++W +A L+++  IQSKL EEI+  VG   +++ E+D 
Sbjct  296  EREIVALCSEFLNAGTDTTSTALQWIMANLVKHQDIQSKLREEIEGAVGSDAQEIKEEDL  355

Query  349  DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
             KMPYL AV+KE LR+HPP  F L H VT+   L GY IP    + F +  I  D  +W 
Sbjct  356  QKMPYLKAVIKEGLRRHPPGHFVLPHTVTEDVVLDGYLIPRGASINFMVAEIGWDGKVWE  415

Query  529  DPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  621
            +P +F P+RFL+G  GE  DITG   +KMMPFG
Sbjct  416  EPMEFKPERFLAGGSGEGVDITGSKEIKMMPFG  448



>ref|XP_009108016.1| PREDICTED: cytochrome P450 89A2-like [Brassica rapa]
 ref|XP_009108023.1| PREDICTED: cytochrome P450 89A2-like [Brassica rapa]
Length=495

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 129/204 (63%), Gaps = 6/204 (3%)
 Frame = +1

Query  16   LEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAELVTL  195
            L++R++Q + ++PLI  RR+ ++    D      SY+DTL DL +   K      E+++L
Sbjct  236  LQIRREQEDVLLPLIRARRKIVQEENKDYVQ---SYVDTLLDLELPDEKRKLNENEIISL  292

Query  196  VSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDT--DKMPYLN  369
             SEFLNGGTDTTAT ++W +A L++NP IQ +LY+EIK V G+   + ++    KMPYL 
Sbjct  293  CSEFLNGGTDTTATTLQWIMANLVKNPEIQERLYQEIKGVAGEEAKEIEEEEAHKMPYLK  352

Query  370  AVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDP  549
            AVV E LR+HPP    L H+VT+ T LGGY IP    V F +  I  DP +W +P  F P
Sbjct  353  AVVLEGLRRHPPGHMVLPHSVTEDTVLGGYKIPKKGTVNFMVAEIGRDPAVWDEPMAFKP  412

Query  550  DRFLSGGEDADITGVTAVKMMPFG  621
            +RF+ G E  DITG   +KMMPFG
Sbjct  413  ERFM-GEESVDITGSRGIKMMPFG  435



>ref|XP_008459270.1| PREDICTED: cytochrome P450 89A2-like, partial [Cucumis melo]
Length=481

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 138/225 (61%), Gaps = 21/225 (9%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGS-----DKSAATFSYLDTLFDLTV---  150
            RKR    L++RK Q   +  LIE RR+A +N  +     +K     SY+DTL DL +   
Sbjct  199  RKRWEAFLQIRKNQENVLNRLIEERRKANKNRATKAQNEEKEEFVVSYVDTLLDLELPNE  258

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--  324
            + RK S  N E+VTL SEFLN GTDTT+TA++W +A +++NP IQ+KL  E+K ++G+  
Sbjct  259  DNRKLS--NEEIVTLCSEFLNAGTDTTSTALQWIMANIVKNPKIQNKLLAEMKGILGNGS  316

Query  325  --RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLP  498
               +V E+D +K+PYL AVV E LR+HPP  F L HAV + T    Y IP +  V F + 
Sbjct  317  TEDEVKEEDLEKLPYLKAVVLEGLRRHPPGHFVLPHAVKEDTIFENYMIPKNGTVNFMVA  376

Query  499  AISDDPTLWSDPEKFDPDRFLSGGEDA----DITGVTAVKMMPFG  621
             +  DP +W DP  F P+RFL GGE      DITG   +KMMPFG
Sbjct  377  EMGLDPKVWEDPMVFKPERFLKGGEGEGVVFDITGSKEIKMMPFG  421



>gb|KDP20777.1| hypothetical protein JCGZ_21248 [Jatropha curcas]
Length=505

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 132/214 (62%), Gaps = 8/214 (4%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRALE---NPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q KR  E+RK Q+E +VPLI  RR  +E   NPGS   S    +Y+D+LF L   GR   
Sbjct  233  QMKRAKELRKTQMECLVPLIRNRRAYVEKGDNPGSLMVSPVGAAYVDSLFGLEAPGR-GR  291

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-VDEKD  345
                ELVTL SE    G DT+ + ++WA   L+ +  IQ KLY+EI   VG    + E +
Sbjct  292  LGEEELVTLCSELFVAGIDTSTSVLQWAFLELVLHQDIQEKLYKEIVDSVGKNGLITEDN  351

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             +KM YLNAVVKE LR H P  F L+HA T+ T+LGGY IP +  VEF++  +++DP LW
Sbjct  352  VEKMTYLNAVVKETLRVHSPAHFTLSHATTEETELGGYKIPTNVYVEFYIEWMTEDPNLW  411

Query  526  SDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  621
             DP+ F P+RFL G G D D+TG    VKM+PFG
Sbjct  412  KDPDVFRPERFLEGDGVDVDLTGTKGTVKMLPFG  445



>ref|XP_011015670.1| PREDICTED: cytochrome P450 89A2-like [Populus euphratica]
Length=512

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 131/220 (60%), Gaps = 14/220 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLI--------ERRRRALENPGSDKSAATFSYLDTLFDLTV  150
            RKR   +  +RK Q + ++PLI        ER RR  E+    +     SY+DTL  L +
Sbjct  231  RKRWNELFRLRKLQEDVLIPLIRARKKAKEERIRRGKEDKKGHEDEYVLSYVDTLLSLEL  290

Query  151  EGRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVV--GD  324
               K      E+V+L SEFLNGGTDTT+TA++W +A L++ P IQ KL+ EIK VV  G+
Sbjct  291  PEEKRKLEEGEMVSLCSEFLNGGTDTTSTALQWIMANLVKYPQIQEKLFMEIKGVVRDGE  350

Query  325  RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAI  504
              + E +  KMPYL A++ E LR+HPP  F L HAV++   L  Y IP D  + F +  +
Sbjct  351  ENIKEDELQKMPYLKAIILEGLRRHPPGHFVLPHAVSEDVVLDKYVIPKDGTINFMVAEM  410

Query  505  SDDPTLWSDPEKFDPDRFLS-GGEDADITGVTAVKMMPFG  621
              DP +W DP  F P+RFL+ GGE  DITG   +KMMPFG
Sbjct  411  GWDPKVWEDPMAFKPERFLNGGGETFDITGSREIKMMPFG  450



>gb|KHN42995.1| Cytochrome P450 89A2 [Glycine soja]
Length=364

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 128/207 (62%), Gaps = 5/207 (2%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAEL  186
            K  L  RK+Q +  VPLI  R++  +  G D      SY+DTL DL +   K   +  E+
Sbjct  100  KEFLRFRKEQKDVFVPLIRARKQKRDKKGCD--GFVVSYVDTLLDLELPEEKRKLSEEEM  157

Query  187  VTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD--RKVDEKDTDKMP  360
            V+L SEF+N GTDTT+TA++W  A L++ P +Q ++ EEI++V+G+  R+V E+D  K+P
Sbjct  158  VSLCSEFMNAGTDTTSTALQWITANLVKYPHVQERVVEEIRNVLGESVREVKEEDLQKLP  217

Query  361  YLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEK  540
            YL AV+ E LR+HPP  F L HAVT+      Y +P +  V F +  +  DP +W DP  
Sbjct  218  YLKAVILEGLRRHPPGHFVLPHAVTEDVVFNDYLVPKNGTVNFMVAEMGWDPKVWEDPMA  277

Query  541  FDPDRFLSGGEDADITGVTAVKMMPFG  621
            F P+RFL+  E  DITG   +KMMPFG
Sbjct  278  FKPERFLN-DEGFDITGSKEIKMMPFG  303



>gb|KFK33248.1| hypothetical protein AALP_AA6G350000 [Arabis alpina]
Length=496

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 136/213 (64%), Gaps = 15/213 (7%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENP----GSDKSAATFSYLDTLFDLTVEGRK  162
            RKR     ++R++Q E ++PLI  R++ ++      G ++     SY+DTL DL +   K
Sbjct  231  RKRWEEFFQIRREQHEVLLPLIRSRKKMVQERKKILGKEEEEYVQSYVDTLLDLELPEEK  290

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEK  342
                  E+V+L SEFL+ GTDTTATA++W +A L++NP IQ +L+EE+K   G+++++  
Sbjct  291  RKLNEEEIVSLCSEFLDAGTDTTATALQWIMANLVKNPDIQERLHEEVK---GEKEIE--  345

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
              +KMPYL AVV E LR+HPP  F L ++VT+ T LGGY +P    + F +  I  DP +
Sbjct  346  -VEKMPYLKAVVLEGLRRHPPGHFVLPNSVTEDTVLGGYKVPKKGTINFMVAEIGRDPEV  404

Query  523  WSDPEKFDPDRFLSGGEDADITGVTAVKMMPFG  621
            W +P  F P+RF+  GE+ DITG   +KMMPFG
Sbjct  405  WKEPMAFKPERFM--GEEVDITGSRGIKMMPFG  435



>ref|XP_008812264.1| PREDICTED: cytochrome P450 77A3-like [Phoenix dactylifera]
Length=516

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 136/214 (64%), Gaps = 14/214 (7%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATF--------SYLDTLFDLTVEGRKSSPT  174
            ++RK+Q++ ++PL   RR  +E+ G    + ++        +Y+D+LF L   GR     
Sbjct  242  KLRKRQMDCLLPLARARRAFVESGGEKDVSCSWEMVSPIGEAYVDSLFGLEPAGR-GRLG  300

Query  175  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK---VDEKD  345
              EL+TL SE ++ GTDT+ATA+EWA+  LI N   Q +LY+EI   VG  K   + E D
Sbjct  301  EEELMTLCSEVMSAGTDTSATALEWALLHLILNQAAQERLYKEILRKVGTEKGMKITEDD  360

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             + M YL A+VKE LR+HPP+ F L+HA T+ T+LGG+ IP D  VEF+   +++DP++W
Sbjct  361  VEGMGYLQAMVKETLRRHPPSHFVLSHAATRETQLGGFRIPTDANVEFYTAWMTEDPSVW  420

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
              PE++ P+RF  GGE  D D+TG   ++MMPFG
Sbjct  421  DKPEEWRPERFEEGGEGWDTDVTGTRGLRMMPFG  454



>ref|XP_002466942.1| hypothetical protein SORBIDRAFT_01g017160 [Sorghum bicolor]
 gb|EER93940.1| hypothetical protein SORBIDRAFT_01g017160 [Sorghum bicolor]
Length=521

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 126/208 (61%), Gaps = 7/208 (3%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATF--SYLDTLFDLTVEGRKSSP-TNAELV  189
            E+R++  E  VPLI  RR   +  G  K   TF  SYLDTL D+ +      P T+ E+ 
Sbjct  249  ELRRRVKELFVPLINARREYKKRGGEPKGETTFEHSYLDTLLDIKLHEDGDRPLTDDEIC  308

Query  190  TLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK--VDEKDTDKMPY  363
             L SEFL+ GTDTT+T ++W +A L++NP IQ KLY E+K+   + K  V E+D  KMPY
Sbjct  309  ILCSEFLDAGTDTTSTGLQWIMAELVKNPAIQEKLYNEVKAAADNDKEGVSEEDVHKMPY  368

Query  364  LNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKF  543
            L AV+ E LRKHPP  F L H   +  ++GGY IP    V F +  +S D   W +P +F
Sbjct  369  LKAVILEALRKHPPAHFVLPHKAAEDMEIGGYLIPKGTTVNFMVAEMSRDEQEWKNPMEF  428

Query  544  DPDRFLSG--GEDADITGVTAVKMMPFG  621
             P+RFL G  GE  D+TG  A++MMPFG
Sbjct  429  SPERFLPGGDGEGVDVTGTKAIRMMPFG  456



>ref|XP_010439394.1| PREDICTED: cytochrome P450 89A2-like [Camelina sativa]
Length=514

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 136/220 (62%), Gaps = 14/220 (6%)
 Frame = +1

Query  4    RKR---VLEVRKQQIETIVPLIERRRRALENPGS-------DKSAATFSYLDTLFDLTVE  153
            RKR     ++R++Q + ++PLI  RR+ +E           D      SY+DTL D+ + 
Sbjct  232  RKRWEEFFQMRREQHDVLLPLIRARRKIVEERKKRSPEEEEDNKEYVQSYVDTLLDVELP  291

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKS---VVGD  324
              K      E+V+L SEFLN GTDTTATA++W +A L++NP IQ +LYEEIKS       
Sbjct  292  DEKRKLNEDEIVSLCSEFLNAGTDTTATALQWIMANLVKNPNIQRRLYEEIKSVVGEEEA  351

Query  325  RKVDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAI  504
            ++V+E+D  KMPYL AVV E LR+HPP  F L H+VT+ T LGGY +P    + F +  I
Sbjct  352  KEVEEEDAQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEI  411

Query  505  SDDPTLWSDPEKFDPDRFLSGGEDA-DITGVTAVKMMPFG  621
              DP +W +P  F+P+RF+   E++ DITG   +KMMPFG
Sbjct  412  GRDPKVWEEPMAFNPERFIGAQEESVDITGSRGIKMMPFG  451



>dbj|BAK06611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 132/219 (60%), Gaps = 19/219 (9%)
 Frame = +1

Query  22   VRKQQIETIVPLIERRRRALENPGSDKSAATF----------------SYLDTLFDLTVE  153
            +R++Q+  ++PL+  RR  L   G+   AA                  +Y+D+LFDL   
Sbjct  240  LRRRQLNCLLPLVRARREFLRTGGNACKAAGEGNRVIGGVEMMSPPGEAYVDSLFDLEPP  299

Query  154  GRKSSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD-RK  330
            GR       ELVTL SE ++ GTDT+ATA+EW +  LI +P  Q ++Y+E+ +  G   +
Sbjct  300  GRGKRLGEEELVTLCSEVMSAGTDTSATALEWVMMHLILDPAAQERVYDEVVAKAGKTAR  359

Query  331  VDEKDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISD  510
            + E D + +PYL AVVKE  R+HPP+ F L+HA T+  +LGGY +P +  VEF+   +++
Sbjct  360  ITEADVESLPYLQAVVKETFRRHPPSHFVLSHAATRDAELGGYRVPANASVEFYTAWVTE  419

Query  511  DPTLWSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            +P  W DP  + P+RFL GGE  D DITG  A++MMPFG
Sbjct  420  NPETWPDPGAWRPERFLEGGEGHDTDITGTRALRMMPFG  458



>emb|CDY34640.1| BnaC08g41990D [Brassica napus]
Length=510

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 138/214 (64%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VP+I+ RR    A E+P  +  S    +Y+D+LF L    R   
Sbjct  236  QVREARELRKTQLECLVPMIKNRRAFVDAKESPNEEMVSPIGAAYVDSLFTLKPVERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
              + E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYEE+  VVG   V +E D
Sbjct  296  LRDEEIVTLCSEIVSAGTDTSATTLEWALHHLVTDQNIQEKLYEEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VEF+   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKNTELGGYDIPAGAYVEFYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP  F P+RFL+GG+  +AD TG   V M+PFG
Sbjct  416  SDPGMFRPERFLAGGDGVNADWTGTRGVTMLPFG  449



>ref|XP_011037690.1| PREDICTED: cytochrome P450 77A1-like [Populus euphratica]
Length=507

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 134/215 (62%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRRAL----ENPGSDK-SAATFSYLDTLFDLTVEGRKS  165
            Q K+  ++RK QIE +VPLI R RRA     ENP  +  S    +Y+D+LF L   GR  
Sbjct  235  QMKKAKDLRKAQIECLVPLI-RNRRAFVEKGENPKMEMLSPVGAAYVDSLFTLNAPGR-G  292

Query  166  SPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG-DRKVDEK  342
                 ELVT+ SE    G DT+ + ++W    L+ N  IQ KLY EI   VG DR ++E+
Sbjct  293  LLGEEELVTVCSELFVAGIDTSTSVLQWVFLELVLNQDIQEKLYREIVESVGKDRVINEE  352

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D +KM YLNAVVKE LR H P  F L+HA T+ T+LGGY IP +  VEF++  +++DP+L
Sbjct  353  DVEKMNYLNAVVKETLRVHSPAHFTLSHATTEETELGGYKIPSNVNVEFYIEWMTEDPSL  412

Query  523  WSDPEKFDPDRFLSG-GEDADITGVTA-VKMMPFG  621
            W DP  F P+RF+ G G + D+TG    VKM+PFG
Sbjct  413  WKDPGIFRPERFIDGDGVNVDMTGTKGRVKMLPFG  447



>ref|NP_001065051.1| Os10g0513900 [Oryza sativa Japonica Group]
 gb|AAG13522.1|AC068924_27 putative cytochrome P450 [Oryza sativa Japonica Group]
 gb|AAP54599.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26965.1| Os10g0513900 [Oryza sativa Japonica Group]
 gb|EAZ16671.1| hypothetical protein OsJ_32146 [Oryza sativa Japonica Group]
 dbj|BAG97357.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00592.1| unnamed protein product [Oryza sativa Japonica Group]
Length=520

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 133/215 (62%), Gaps = 14/215 (7%)
 Frame = +1

Query  16   LEVRKQQIETIVPLIERRR------RALENPGSDKSAATF--SYLDTLFDLTV---EGRK  162
            L +R+QQ E  VPLI+ RR      +    P   +   TF  SY+DTL D+++   +G  
Sbjct  246  LALRRQQKELFVPLIDARRARKNHIQQAGGPPVPEKETTFEHSYVDTLLDVSLPDTDG-D  304

Query  163  SSPTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEK  342
            S+ T  ELV L SEFLN GTDTTATA++W +A L++NP IQSKL++EIKS   D ++ E+
Sbjct  305  SALTEDELVMLCSEFLNAGTDTTATALQWIMAELVKNPSIQSKLHDEIKSKTSDDEITEE  364

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            DT  MPYL AV+ E LRKHPP  F L H   +  ++GGY IP    V F +  +  D   
Sbjct  365  DTHDMPYLKAVILEGLRKHPPAHFVLPHKAAEDVEVGGYLIPKGATVNFMVAEMGRDERE  424

Query  523  WSDPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  621
            W  P +F P+RFL+G  GE  D+TG   V+MMPFG
Sbjct  425  WEKPMEFIPERFLAGGDGEGVDVTGSREVRMMPFG  459



>ref|XP_009412014.1| PREDICTED: cytochrome P450 77A3-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 136/214 (64%), Gaps = 14/214 (7%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAATF--------SYLDTLFDLTVEGRKSSPT  174
            ++RK+Q++ +VPL+  RR  +E+ G    ++ +        +Y+D+L+ +   G K    
Sbjct  237  KLRKRQMDCLVPLVRARRAFVESGGKMDPSSAWEMVSPVGEAYIDSLYGMEPSG-KGRLG  295

Query  175  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG---DRKVDEKD  345
              ELVTL SE ++ GTDT+AT +EWA+  L+ +   Q +LYEEI   VG    RK+ E D
Sbjct  296  EDELVTLCSEVMSAGTDTSATMLEWAMLHLVLDQSAQERLYEEIVGKVGRDKGRKITESD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
             + M YL AVVKE +R+HPP+ F L+HA T+ T+LGGY IP D  VEF+   ++++P+ W
Sbjct  356  VEGMGYLQAVVKETMRRHPPSHFVLSHAATRETELGGYRIPADASVEFYTAWVTENPSTW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
             DP ++ P+RF  GGE  + D+TG   ++MMPFG
Sbjct  416  KDPGEWRPERFEEGGEGWETDVTGTRGIRMMPFG  449



>ref|XP_003574176.1| PREDICTED: cytochrome P450 89A2-like [Brachypodium distachyon]
Length=512

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 130/213 (61%), Gaps = 14/213 (7%)
 Frame = +1

Query  22   VRKQQIETIVPLIE-----RRRRALENPGSDKSAATF--SYLDTLFDLTV--EGRKSSPT  174
            +R++Q E  VPLI      R RRA E  G  ++  TF  SY+D L D+ +  EG ++  T
Sbjct  239  MRQRQKELFVPLINARREYRNRRAAEAEGEPRTVTTFEHSYVDALLDIKLPDEGDRAL-T  297

Query  175  NAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK--VDEKDT  348
            + E+V L SEFLN GTDTT+T ++W +A L++NP IQ KLYEEI++  GD K  V E+D 
Sbjct  298  DGEMVNLCSEFLNAGTDTTSTGLQWIMAELVKNPSIQQKLYEEIRATTGDDKEEVSEEDV  357

Query  349  DKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWS  528
             KMPYL AVV E LRKHPP  F L H   +  ++G Y IP    V F +  +  D   W 
Sbjct  358  HKMPYLKAVVLEGLRKHPPGHFVLPHRAAEDMEVGEYLIPKGATVNFMIAEMGRDEQEWE  417

Query  529  DPEKFDPDRFLSG--GEDADITGVTAVKMMPFG  621
             P +F P+RFL G  GE  D+TG   ++MMPFG
Sbjct  418  KPMEFSPERFLPGGAGEGVDVTGNREIRMMPFG  450



>ref|XP_008784547.1| PREDICTED: cytochrome P450 77A3-like [Phoenix dactylifera]
Length=515

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 138/215 (64%), Gaps = 16/215 (7%)
 Frame = +1

Query  19   EVRKQQIETIVPLIERRRRALENPGSDKSAAT---------FSYLDTLFDLTVEGRKSSP  171
            ++RK+Q++ ++PL+ R RRA    G +K A +          +Y+D+LF L   GR    
Sbjct  242  KLRKRQMDCLLPLV-RARRAFVKSGGEKDANSPWEMVSLVGEAYIDSLFALEPAGR-GRL  299

Query  172  TNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGD---RKVDEK  342
               ELVTL SE ++ GTDT+ATA+EWA+  L+ +   Q +L++EI   VG    +K+ E 
Sbjct  300  GEEELVTLCSEVMSAGTDTSATALEWALLHLVLDQAAQERLHKEIVGKVGSEKGKKITET  359

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D + M YL AVVKE LR+HPP+ F L+HA T+ T+L GY IP D  VEF+   +++DP++
Sbjct  360  DVEGMGYLQAVVKETLRRHPPSHFVLSHAATRETELAGYRIPADASVEFYTAWVTEDPSV  419

Query  523  WSDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            W +PE++ P+RF  GG+  + D+TG   V+MMPFG
Sbjct  420  WENPEEWRPERFEEGGDGRETDVTGTRGVRMMPFG  454



>gb|KFK31941.1| hypothetical protein AALP_AA6G179900 [Arabis alpina]
Length=510

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 137/214 (64%), Gaps = 7/214 (3%)
 Frame = +1

Query  1    QRKRVLEVRKQQIETIVPLIERRRR---ALENPGSDK-SAATFSYLDTLFDLTVEGRKSS  168
            Q +   E+RK Q+E +VPLI  RR+   A E+P  +  S    +Y+D+LF L    R   
Sbjct  236  QVREARELRKTQLECLVPLIRNRRKFVDANESPNEEMVSPIGAAYVDSLFSLNPVERGGE  295

Query  169  PTNAELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKV-DEKD  345
                E+VTL SE ++ GTDT+AT +EWA+  L+ +  IQ KLYEE+  VVG   V +E D
Sbjct  296  LGEEEIVTLCSEIVSAGTDTSATTLEWALLHLVTDHNIQEKLYEEVVGVVGKNGVVEEDD  355

Query  346  TDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLW  525
              KMPYL A+VKE LR+HPP  F L+HA  + T+LGGYDIP    VE +   ++++P +W
Sbjct  356  VAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELGGYDIPAGAYVEIYTAWVTENPEIW  415

Query  526  SDPEKFDPDRFLSGGE--DADITGVTAVKMMPFG  621
            SDP  F P+RFL+GG+  DAD TG   VKM+PFG
Sbjct  416  SDPGTFRPERFLTGGDGVDADWTGTRGVKMLPFG  449



>ref|NP_001057534.1| Os06g0328900 [Oryza sativa Japonica Group]
 dbj|BAF19448.1| Os06g0328900, partial [Oryza sativa Japonica Group]
Length=290

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 128/208 (62%), Gaps = 11/208 (5%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTV-EGRKSSPTNAE  183
             +++ +R++Q E   PLI  RR A    G D       Y+D+L  LT+ E      T+ E
Sbjct  17   NKLVSLRRRQEELFAPLIRARREA--GAGGD------CYVDSLVKLTIPEDGGRGLTDVE  68

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPY  363
            +V+L SEF++ GTDTTATA++W +A L++NP +Q KL EEI +   D +V E+D   MPY
Sbjct  69   IVSLCSEFMSAGTDTTATALQWILANLVKNPAMQDKLREEITAAAVDGEVREEDLQAMPY  128

Query  364  LNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKF  543
            L AVV E LR+HPP  F L H V + T L GY +P +  V F +  I  D  +W+ PE F
Sbjct  129  LKAVVLEGLRRHPPDHFLLPHTVEEETTLDGYRVPANTPVNFAVGEIGLDSEVWTSPEVF  188

Query  544  DPDRFLSG--GEDADITGVTAVKMMPFG  621
             P+RFL+G  GED D+TG   +KMMPFG
Sbjct  189  RPERFLAGGEGEDVDLTGSKEIKMMPFG  216



>gb|ADP89482.1| cytochrome P450 mono-oxygenase superfamily, partial [Picea mariana]
Length=210

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +1

Query  199  SEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRKVDEKDTDKMPYLNAVV  378
            SE L  GTDTT+TA+EWA+ R++ +  IQ  LY+EI  VVGDRKV+ KD + +PYLNAVV
Sbjct  1    SELLTAGTDTTSTALEWAMLRMVMHQDIQETLYQEICDVVGDRKVEGKDIENLPYLNAVV  60

Query  379  KELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTLWSDPEKFDPDRF  558
            KE LR HPP  F L+HAVTQ  K+ GYDIP    VEF+   +S DP +W DP  F P RF
Sbjct  61   KETLRPHPPGHFVLSHAVTQDCKVRGYDIPYKANVEFYTGWMSFDPNIWPDPMTFHPRRF  120

Query  559  LSGGEDADITGVTAVKMMPFG  621
            L  G + DITG   VKMMPFG
Sbjct  121  LDPGNEVDITGNKQVKMMPFG  141



>ref|XP_009603616.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana tomentosiformis]
Length=522

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 134/216 (62%), Gaps = 14/216 (6%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIE-RRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAE  183
            K ++E+R++Q +  +PLIE R  RA E    ++  A   Y+DTL +L +     +    E
Sbjct  246  KELIELRQEQEKIFIPLIEARSSRAKEQKPEEEVVA---YVDTLLNLELPEENRNLNYGE  302

Query  184  LVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK-------VDEK  342
            +V+L SEFL+ GTDTT+TA++W +A L++   IQ KLY+EI SVVG+++       V E+
Sbjct  303  MVSLCSEFLSAGTDTTSTALQWVMANLVKKTSIQEKLYQEIASVVGEKQSKLTEEVVKEE  362

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D  KMPYL AVV E LR+HPP  F L H VT+  +L GY +P +  + F +  +  DP +
Sbjct  363  DLHKMPYLKAVVLEGLRRHPPGHFVLPHTVTKEVELNGYVVPKNATINFMVADMGLDPKV  422

Query  523  WSDPEKFDPDRFLSGGEDA---DITGVTAVKMMPFG  621
            W DP +F P+RFL  G D    DITG   +KMMPFG
Sbjct  423  WEDPLEFKPERFLMEGSDKEGFDITGSREIKMMPFG  458



>gb|EAY79198.1| hypothetical protein OsI_34310 [Oryza sativa Indica Group]
Length=512

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 134/215 (62%), Gaps = 17/215 (8%)
 Frame = +1

Query  22   VRKQQIETIVPLIERRR--RALENPG---SDKSAATFSYLDTLFDLTV--EGRKSSPTNA  180
            +R++Q E  VPLIE RR  + L + G   + ++A   SY+DTL D+ +  EG ++  T+ 
Sbjct  238  LRRRQKELFVPLIEARREYKRLASQGLPPARETAFQHSYVDTLLDVKIPEEGNRAL-TDD  296

Query  181  ELVTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVG------DRKVDEK  342
            E+VTL SEFLN GTDTT+T ++W +A L++NP +Q KLY EI +  G      +R V +K
Sbjct  297  EIVTLCSEFLNAGTDTTSTGLQWIMAELVKNPAVQEKLYAEINATCGGDDELLERNVRDK  356

Query  343  DTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPTL  522
            D +KMPYLNAVVKE LRKHPP  F L H   +   +GGY IP    V F +  I  D   
Sbjct  357  D-NKMPYLNAVVKEGLRKHPPGHFVLPHKAAEDMDVGGYLIPKGATVNFMVAEIGRDERE  415

Query  523  WSDPEKFDPDRFLSGGEDA--DITGVTAVKMMPFG  621
            W +P +F P+RFL GG  A  D+ G   +KMMPFG
Sbjct  416  WENPMQFMPERFLDGGHGAGVDMHGTKGIKMMPFG  450



>ref|XP_004235317.1| PREDICTED: cytochrome P450 89A2-like [Solanum lycopersicum]
Length=508

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 134/218 (61%), Gaps = 13/218 (6%)
 Frame = +1

Query  7    KRVLEVRKQQIETIVPLIERRRRALENPGSDKSAATFSYLDTLFDLTVEGRKSSPTNAEL  186
            K+++EV+++Q   ++PLIE RRRA E           +Y+DTL +L +   K +    E+
Sbjct  230  KKLIEVQREQRNILIPLIEARRRAKEEKTEPADELVVAYVDTLLNLELPEEKRNLNVGEI  289

Query  187  VTLVSEFLNGGTDTTATAIEWAIARLIENPGIQSKLYEEIKSVVGDRK---------VDE  339
            V L SEFL+ GTDTT+TA++W ++ L+++P IQ KLY +I SV+G+++         V E
Sbjct  290  VALCSEFLSAGTDTTSTALQWIMSNLVKSPSIQEKLYRQIASVMGEKQSKLSTDEEVVKE  349

Query  340  KDTDKMPYLNAVVKELLRKHPPTFFALTHAVTQPTKLGGYDIPMDCGVEFFLPAISDDPT  519
            +D  K+PYL AV+ E +R++PP  F L H VT+  +L GY IP +  + F +  +  D  
Sbjct  350  EDLQKIPYLKAVILEGVRRNPPGHFVLPHTVTEEVELNGYVIPKNATINFMVGEMGLDQN  409

Query  520  LWSDPEKFDPDRFLSGGEDA----DITGVTAVKMMPFG  621
            +W DP +F P+RFL  G D     DITG   +KMMPFG
Sbjct  410  VWEDPMEFRPERFLVEGSDKVVDFDITGSKEIKMMPFG  447



Lambda      K        H        a         alpha
   0.316    0.135    0.393    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950