BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN015I15

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01927.1|  unnamed protein product                              54.7    2e-06   Coffea canephora [robusta coffee]
ref|XP_010113384.1|  putative salt tolerance-like protein             53.9    4e-06   
ref|XP_007202703.1|  hypothetical protein PRUPE_ppa012724mg           52.4    1e-05   
ref|XP_008241795.1|  PREDICTED: salt tolerance protein-like           52.4    1e-05   Prunus mume [ume]
ref|XP_004512115.1|  PREDICTED: probable salt tolerance-like prot...  51.6    3e-05   Cicer arietinum [garbanzo]
ref|XP_004512113.1|  PREDICTED: probable salt tolerance-like prot...  51.6    3e-05   
ref|XP_002306138.1|  zinc finger family protein                       51.6    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011037208.1|  PREDICTED: B-box zinc finger protein 19-like...  51.2    4e-05   Populus euphratica
ref|XP_011037202.1|  PREDICTED: B-box zinc finger protein 19-like...  51.2    4e-05   Populus euphratica
ref|XP_004287831.1|  PREDICTED: B-box zinc finger protein 19-like     50.8    5e-05   Fragaria vesca subsp. vesca
ref|XP_008372761.1|  PREDICTED: salt tolerance protein-like           50.4    8e-05   
ref|XP_007046745.1|  B-box type zinc finger family protein            49.3    2e-04   
ref|XP_010271472.1|  PREDICTED: B-box zinc finger protein 19 isof...  48.9    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004146516.1|  PREDICTED: probable salt tolerance-like prot...  48.1    5e-04   Cucumis sativus [cucumbers]
ref|XP_010271471.1|  PREDICTED: B-box zinc finger protein 19 isof...  48.5    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008452057.1|  PREDICTED: probable salt tolerance-like prot...  48.1    6e-04   Cucumis melo [Oriental melon]
ref|XP_007042027.1|  B-box type zinc finger family protein            48.5    8e-04   
gb|ADL36674.1|  COL domain class transcription factor                 47.8    8e-04   Malus domestica [apple tree]
ref|XP_003517191.1|  PREDICTED: probable salt tolerance-like prot...  47.8    8e-04   Glycine max [soybeans]
gb|KHN36052.1|  Putative salt tolerance-like protein                  47.4    0.001   Glycine soja [wild soybean]



>emb|CDP01927.1| unnamed protein product [Coffea canephora]
Length=185

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 18/67 (27%)
 Frame = +2

Query  2    EEPPRLTSDPGQ-----------------QNHAAAAAVPVSDNTKDGHAKRENKMIDLNM  130
            EEP  LT D G+                 QNH   + +P+SD + DGHAK E +MIDLNM
Sbjct  112  EEPATLTLDQGENMREYGPSYKLVVGDKHQNHKVPS-IPISDGSTDGHAKVETQMIDLNM  170

Query  131  KPTRIHG  151
            KP R+HG
Sbjct  171  KPNRLHG  177



>ref|XP_010113384.1| putative salt tolerance-like protein [Morus notabilis]
 gb|EXC35391.1| putative salt tolerance-like protein [Morus notabilis]
Length=189

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    PPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH  148
            PP++ ++  QQNHA +    +  N  DGH+KR+ K+IDLNMKP ++H
Sbjct  132  PPKMVAEENQQNHAVSPVWILEANNADGHSKRDTKLIDLNMKPHKLH  178



>ref|XP_007202703.1| hypothetical protein PRUPE_ppa012724mg [Prunus persica]
 gb|EMJ03902.1| hypothetical protein PRUPE_ppa012724mg [Prunus persica]
Length=157

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    EPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH  148
            +PPR+T    QQNH A+  + +SD   DGH K + K+IDLNMKP R+H
Sbjct  103  QPPRMTIGENQQNHRASP-IRISDANADGHVKMDTKLIDLNMKPHRMH  149



>ref|XP_008241795.1| PREDICTED: salt tolerance protein-like [Prunus mume]
Length=184

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  5    EPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH  148
            +PPR+T    QQNH A+  + +SD   DGH K + K+IDLNMKP R+H
Sbjct  130  QPPRMTIGENQQNHRASP-IRISDANADGHVKMDTKLIDLNMKPHRMH  176



>ref|XP_004512115.1| PREDICTED: probable salt tolerance-like protein At1g78600-like 
isoform X3 [Cicer arietinum]
Length=184

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query  11   PRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH  148
            P+L     QQNH     VP S    DGHAK ENKMIDLNMKP RIH
Sbjct  132  PKLKMGEKQQNHRMPP-VPTSGADADGHAKTENKMIDLNMKPNRIH  176



>ref|XP_004512113.1| PREDICTED: probable salt tolerance-like protein At1g78600-like 
isoform X1 [Cicer arietinum]
 ref|XP_004512114.1| PREDICTED: probable salt tolerance-like protein At1g78600-like 
isoform X2 [Cicer arietinum]
Length=189

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query  11   PRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH  148
            P+L     QQNH     VP S    DGHAK ENKMIDLNMKP RIH
Sbjct  132  PKLKMGEKQQNHRMPP-VPTSGADADGHAKTENKMIDLNMKPNRIH  176



>ref|XP_002306138.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE86649.1| zinc finger family protein [Populus trichocarpa]
Length=203

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  5    EPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            +PP+LT+   QQNH A+  VP+ +N  D   K +NK+IDLN +P R+HG
Sbjct  130  QPPKLTARENQQNHRASP-VPMVENNTDSDGKMDNKLIDLNARPQRVHG  177



>ref|XP_011037208.1| PREDICTED: B-box zinc finger protein 19-like isoform X2 [Populus 
euphratica]
Length=197

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  5    EPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            +PP+LT+   QQNH A+  VP  +N  D   K +NK+IDLN +P R+HG
Sbjct  130  QPPKLTARENQQNHRASP-VPTVENNTDSDGKMDNKLIDLNARPQRVHG  177



>ref|XP_011037202.1| PREDICTED: B-box zinc finger protein 19-like isoform X1 [Populus 
euphratica]
 ref|XP_011037203.1| PREDICTED: B-box zinc finger protein 19-like isoform X1 [Populus 
euphratica]
 ref|XP_011037204.1| PREDICTED: B-box zinc finger protein 19-like isoform X1 [Populus 
euphratica]
 ref|XP_011037205.1| PREDICTED: B-box zinc finger protein 19-like isoform X1 [Populus 
euphratica]
 ref|XP_011037206.1| PREDICTED: B-box zinc finger protein 19-like isoform X1 [Populus 
euphratica]
 ref|XP_011037207.1| PREDICTED: B-box zinc finger protein 19-like isoform X1 [Populus 
euphratica]
Length=203

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  5    EPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            +PP+LT+   QQNH A+  VP  +N  D   K +NK+IDLN +P R+HG
Sbjct  130  QPPKLTARENQQNHRASP-VPTVENNTDSDGKMDNKLIDLNARPQRVHG  177



>ref|XP_004287831.1| PREDICTED: B-box zinc finger protein 19-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  5    EPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            + PR+T     QNH A+  V ++D   DGH K +NK+IDLNMKP R+HG
Sbjct  132  QQPRMTIGDNHQNHRASP-VRLADANDDGHVKMDNKLIDLNMKPNRMHG  179



>ref|XP_008372761.1| PREDICTED: salt tolerance protein-like [Malus domestica]
Length=185

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +2

Query  8    PPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            PPR+T     QNH  +  +  SD   DGH K +NK+IDLNMKP R+HG
Sbjct  132  PPRMTIGENPQNHRVSP-IRASDANADGHVKMDNKLIDLNMKPHRMHG  178



>ref|XP_007046745.1| B-box type zinc finger family protein [Theobroma cacao]
 gb|EOX90902.1| B-box type zinc finger family protein [Theobroma cacao]
Length=185

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +2

Query  5    EPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            +P + T    QQNH  ++ V + D   DGH K + KMIDLNMKP RIHG
Sbjct  130  QPAKPTVGESQQNHKVSS-VQLVDANADGHVKMDTKMIDLNMKPHRIHG  177



>ref|XP_010271472.1| PREDICTED: B-box zinc finger protein 19 isoform X2 [Nelumbo nucifera]
Length=187

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +2

Query  11   PRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            P+LT+   QQNH  +  V V D   D H K++ KMIDLN +P R+HG
Sbjct  132  PKLTARESQQNHRVST-VQVLDANNDNHGKKDTKMIDLNARPQRVHG  177



>ref|XP_004146516.1| PREDICTED: probable salt tolerance-like protein At1g78600-like 
[Cucumis sativus]
 ref|XP_004160959.1| PREDICTED: probable salt tolerance-like protein At1g78600-like 
[Cucumis sativus]
 gb|KGN53325.1| hypothetical protein Csa_4G047370 [Cucumis sativus]
Length=186

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +2

Query  8    PPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            P ++T +  QQNH   +  PV +   DGHA+ + KMIDLNMKP R+HG
Sbjct  133  PHKVTVEDNQQNHHRLS--PVREANDDGHAETDTKMIDLNMKPHRVHG  178



>ref|XP_010271471.1| PREDICTED: B-box zinc finger protein 19 isoform X1 [Nelumbo nucifera]
Length=212

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +2

Query  11   PRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            P+LT+   QQNH  +  V V D   D H K++ KMIDLN +P R+HG
Sbjct  132  PKLTARESQQNHRVST-VQVLDANNDNHGKKDTKMIDLNARPQRVHG  177



>ref|XP_008452057.1| PREDICTED: probable salt tolerance-like protein At1g78600 [Cucumis 
melo]
Length=186

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +2

Query  8    PPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            P ++T +  QQNH   +  PV +   DGHA+ + KMIDLNMKP R+HG
Sbjct  133  PHKVTVEDTQQNHHRLS--PVREANDDGHAETDTKMIDLNMKPHRVHG  178



>ref|XP_007042027.1| B-box type zinc finger family protein [Theobroma cacao]
 gb|EOX97858.1| B-box type zinc finger family protein [Theobroma cacao]
Length=261

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    EEPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            ++ P+L +   QQNH  +  VPV D   DG  K  NK+IDLN KP R+HG
Sbjct  178  QQQPKLAARENQQNHRVSP-VPVLDGNSDGDGKVGNKLIDLNAKPQRVHG  226



>gb|ADL36674.1| COL domain class transcription factor [Malus domestica]
Length=185

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +2

Query  8    PPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG  151
            PPR+T     QNH  +  +  SD   D H K +NK+IDLNMKP R+HG
Sbjct  132  PPRMTIGENLQNHRVSP-IRASDANADEHVKMDNKLIDLNMKPHRMHG  178



>ref|XP_003517191.1| PREDICTED: probable salt tolerance-like protein At1g78600-like 
isoform 2 [Glycine max]
Length=184

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 28/46 (61%), Gaps = 1/46 (2%)
 Frame = +2

Query  11   PRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH  148
            P+L     QQNH     VP      DGHAK E+KMIDLNMKP RIH
Sbjct  132  PKLKMGEKQQNHKMPM-VPTPGPDADGHAKMESKMIDLNMKPNRIH  176



>gb|KHN36052.1| Putative salt tolerance-like protein [Glycine soja]
Length=189

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 28/46 (61%), Gaps = 1/46 (2%)
 Frame = +2

Query  11   PRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH  148
            P+L     QQNH     VP      DGHAK E+KMIDLNMKP RIH
Sbjct  132  PKLKMGEKQQNHKMPM-VPTPGPDADGHAKMESKMIDLNMKPNRIH  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400