BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN015I11

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785953.1|  PREDICTED: sec-independent protein transloca...    149   1e-41   Nicotiana sylvestris
ref|XP_009610432.1|  PREDICTED: sec-independent protein transloca...    149   1e-41   Nicotiana tomentosiformis
ref|XP_009766133.1|  PREDICTED: sec-independent protein transloca...    148   3e-41   Nicotiana sylvestris
ref|XP_002531294.1|  conserved hypothetical protein                     140   2e-38   Ricinus communis
ref|XP_002279607.1|  PREDICTED: sec-independent protein transloca...    137   2e-37   Vitis vinifera
ref|XP_006347746.1|  PREDICTED: sec-independent protein transloca...    137   4e-37   Solanum tuberosum [potatoes]
ref|XP_004230095.1|  PREDICTED: sec-independent protein transloca...    137   5e-37   Solanum lycopersicum
gb|KDP23662.1|  hypothetical protein JCGZ_23495                         134   3e-36   Jatropha curcas
gb|ACJ85933.1|  unknown                                                 134   6e-36   Medicago truncatula
gb|KHG04000.1|  Sec-independent translocase protein TatA                133   1e-35   Gossypium arboreum [tree cotton]
gb|ABK93649.1|  unknown                                                 133   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011032407.1|  PREDICTED: sec-independent protein transloca...    132   2e-35   Populus euphratica
gb|KJB82529.1|  hypothetical protein B456_013G200900                    132   4e-35   Gossypium raimondii
ref|XP_007147171.1|  hypothetical protein PHAVU_006G101800g             132   4e-35   Phaseolus vulgaris [French bean]
ref|XP_010550921.1|  PREDICTED: sec-independent protein transloca...    130   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_011078757.1|  PREDICTED: sec-independent protein transloca...    130   2e-34   Sesamum indicum [beniseed]
ref|XP_004495801.1|  PREDICTED: sec-independent protein transloca...    130   2e-34   Cicer arietinum [garbanzo]
emb|CDP06816.1|  unnamed protein product                                130   2e-34   Coffea canephora [robusta coffee]
ref|XP_002319073.2|  thylakoid assembly family protein                  130   2e-34   Populus trichocarpa [western balsam poplar]
gb|ABK93003.1|  unknown                                                 127   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_008218264.1|  PREDICTED: sec-independent protein transloca...    127   1e-33   Prunus mume [ume]
gb|AFK47858.1|  unknown                                                 127   2e-33   Lotus japonicus
ref|XP_004494699.1|  PREDICTED: sec-independent protein transloca...    127   2e-33   Cicer arietinum [garbanzo]
ref|XP_007206084.1|  hypothetical protein PRUPE_ppa012899mg             127   3e-33   Prunus persica
gb|AFK44195.1|  unknown                                                 127   3e-33   Medicago truncatula
sp|Q9XH46.1|TATA_PEA  RecName: Full=Sec-independent protein trans...    126   4e-33   Pisum sativum [garden pea]
ref|XP_008345714.1|  PREDICTED: sec-independent protein transloca...    126   4e-33   
ref|XP_003521755.1|  PREDICTED: sec-independent protein transloca...    126   5e-33   Glycine max [soybeans]
ref|XP_008388678.1|  PREDICTED: sec-independent protein transloca...    126   6e-33   
gb|EYU33033.1|  hypothetical protein MIMGU_mgv1a021859mg                123   2e-32   Erythranthe guttata [common monkey flower]
ref|NP_001238018.1|  uncharacterized protein LOC100306385               124   3e-32   Glycine max [soybeans]
ref|XP_006432928.1|  hypothetical protein CICLE_v10002770mg             124   4e-32   Citrus clementina [clementine]
ref|XP_009364497.1|  PREDICTED: sec-independent protein transloca...    123   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_010246331.1|  PREDICTED: sec-independent protein transloca...    123   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_011078758.1|  PREDICTED: sec-independent protein transloca...    123   9e-32   Sesamum indicum [beniseed]
gb|KHN04931.1|  Sec-independent protein translocase protein TatA        121   4e-31   Glycine soja [wild soybean]
ref|XP_004171639.1|  PREDICTED: sec-independent protein transloca...    120   7e-31   
ref|XP_007030572.1|  Bacterial sec-independent translocation prot...    120   7e-31   
ref|XP_004135654.1|  PREDICTED: sec-independent protein transloca...    121   8e-31   Cucumis sativus [cucumbers]
ref|XP_010027195.1|  PREDICTED: light-inducible protein CPRF2-like      127   1e-30   
ref|XP_003556468.1|  PREDICTED: sec-independent protein transloca...    119   2e-30   Glycine max [soybeans]
ref|XP_009389019.1|  PREDICTED: sec-independent protein transloca...    119   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302052.1|  PREDICTED: sec-independent protein transloca...    119   3e-30   Fragaria vesca subsp. vesca
ref|XP_010495580.1|  PREDICTED: sec-independent protein transloca...    117   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010455196.1|  PREDICTED: sec-independent protein transloca...    119   4e-30   Camelina sativa [gold-of-pleasure]
emb|CDX86209.1|  BnaA06g29260D                                          118   4e-30   
ref|XP_002874447.1|  hypothetical protein ARALYDRAFT_489661             118   8e-30   
ref|XP_009151263.1|  PREDICTED: sec-independent protein transloca...    117   1e-29   Brassica rapa
ref|XP_009129537.1|  PREDICTED: sec-independent protein transloca...    117   1e-29   Brassica rapa
ref|NP_198227.1|  sec-independent protein translocase protein TatA      117   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421703.1|  PREDICTED: sec-independent protein transloca...    117   2e-29   Camelina sativa [gold-of-pleasure]
emb|CDY57016.1|  BnaA09g03480D                                          116   2e-29   Brassica napus [oilseed rape]
ref|XP_008450744.1|  PREDICTED: sec-independent protein transloca...    117   2e-29   Cucumis melo [Oriental melon]
ref|XP_009398562.1|  PREDICTED: sec-independent protein transloca...    117   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923487.1|  PREDICTED: sec-independent protein transloca...    117   3e-29   Elaeis guineensis
ref|XP_006588399.1|  PREDICTED: uncharacterized protein LOC100500...    116   3e-29   
gb|KHN16199.1|  Sec-independent protein translocase protein TatA        116   4e-29   Glycine soja [wild soybean]
ref|XP_009111899.1|  PREDICTED: sec-independent protein transloca...    115   4e-29   Brassica rapa
emb|CDY00023.1|  BnaC09g02780D                                          115   5e-29   
ref|XP_006288854.1|  hypothetical protein CARUB_v10002208mg             115   6e-29   Capsella rubella
emb|CDY48664.1|  BnaC07g27450D                                          115   8e-29   Brassica napus [oilseed rape]
gb|KFK31934.1|  hypothetical protein AALP_AA6G178200                    114   1e-28   Arabis alpina [alpine rockcress]
ref|XP_006650323.1|  PREDICTED: sec-independent protein transloca...    113   2e-28   
ref|XP_010936083.1|  PREDICTED: LOW QUALITY PROTEIN: sec-independ...    114   4e-28   Elaeis guineensis
gb|EEC75796.1|  hypothetical protein OsI_12727                          114   7e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_006838884.1|  hypothetical protein AMTR_s00002p00267770          112   7e-28   Amborella trichopoda
ref|NP_001237608.1|  uncharacterized protein LOC100500409               112   1e-27   
ref|XP_009399359.1|  PREDICTED: sec-independent protein transloca...    112   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788140.1|  PREDICTED: sec-independent protein transloca...    112   2e-27   Phoenix dactylifera
ref|XP_006395030.1|  hypothetical protein EUTSA_v10005085mg             111   3e-27   Eutrema salsugineum [saltwater cress]
ref|NP_001050716.1|  Os03g0634000                                       111   5e-27   
ref|XP_010528803.1|  PREDICTED: sec-independent protein transloca...    110   6e-27   Tarenaya hassleriana [spider flower]
gb|ACN32121.1|  unknown                                                 111   7e-27   Zea mays [maize]
ref|NP_001104942.1|  sec-independent protein translocase protein ...    111   7e-27   
emb|CDY05605.1|  BnaC02g39320D                                          110   7e-27   
ref|NP_001150512.1|  THA4                                               110   9e-27   
gb|EYU22665.1|  hypothetical protein MIMGU_mgv1a016077mg                109   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_004982373.1|  PREDICTED: sec-independent protein transloca...    108   5e-26   
gb|EPS74317.1|  hypothetical protein M569_00442                         107   5e-26   Genlisea aurea
ref|XP_002464206.1|  hypothetical protein SORBIDRAFT_01g014100          107   2e-25   
ref|XP_008786083.1|  PREDICTED: sec-independent protein transloca...    104   1e-24   Phoenix dactylifera
gb|EMS64861.1|  CBL-interacting protein kinase 7                        108   2e-24   Triticum urartu
gb|ACG40026.1|  THA4                                                    104   2e-24   Zea mays [maize]
ref|NP_001104943.1|  tha9 protein                                       103   4e-24   Zea mays [maize]
ref|XP_010674831.1|  PREDICTED: sec-independent protein transloca...    102   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003562204.2|  PREDICTED: CBL-interacting protein kinase 7-...    107   1e-23   Brachypodium distachyon [annual false brome]
gb|ABK21127.1|  unknown                                               93.6    2e-20   Picea sitchensis
ref|XP_002987256.1|  hypothetical protein SELMODRAFT_125456           92.0    2e-20   
gb|KEH43019.1|  twin arginine translocase                             92.4    2e-20   Medicago truncatula
ref|XP_002976419.1|  hypothetical protein SELMODRAFT_267974           92.4    6e-20   Selaginella moellendorffii
gb|KIZ03129.1|  hypothetical protein MNEG_4832                        92.0    6e-20   Monoraphidium neglectum
ref|XP_008804879.1|  PREDICTED: sec-independent protein transloca...  91.7    9e-20   Phoenix dactylifera
ref|XP_006382793.1|  hypothetical protein POPTR_0005s05490g           89.7    3e-19   
gb|EYU30524.1|  hypothetical protein MIMGU_mgv1a0158101mg             88.6    4e-19   Erythranthe guttata [common monkey flower]
ref|XP_002500552.1|  twin arginine targeting family                   89.4    7e-19   Micromonas commoda
ref|XP_001768091.1|  predicted protein                                89.7    8e-19   
gb|KEH24554.1|  twin arginine translocase                             87.8    1e-18   Medicago truncatula
ref|WP_015167027.1|  twin arginine-targeting protein translocase,...  87.0    2e-18   Synechococcus sp. PCC 7502
ref|XP_001690564.1|  TatA-like sec-independent protein translocat...  87.0    2e-18   Chlamydomonas reinhardtii
ref|XP_001774935.1|  predicted protein                                87.8    3e-18   
ref|WP_019502800.1|  hypothetical protein                             85.9    3e-18   Pseudanabaena sp. PCC 6802
ref|WP_006512458.1|  twin arginine-targeting protein translocase,...  85.5    5e-18   Xenococcus sp. PCC 7305
gb|AAS47586.1|  chloroplast Tha4-1                                    87.0    6e-18   Physcomitrella patens
ref|WP_039895374.1|  preprotein translocase subunit TatA              84.7    9e-18   Lyngbya sp. PCC 8106
ref|WP_017296345.1|  hypothetical protein                             84.7    1e-17   Geminocystis herdmanii
ref|WP_011127144.1|  primosome subunit DnaD                           84.0    1e-17   Synechococcus sp. WH 8102
ref|WP_036913569.1|  MULTISPECIES: preprotein translocase subunit...  84.3    1e-17   Prochlorococcus
ref|WP_011827044.1|  preprotein translocase subunit TatA              84.3    1e-17   
ref|WP_002735474.1|  MULTISPECIES: primosome subunit DnaD             84.0    2e-17   Microcystis
ref|WP_015188791.1|  Sec-independent protein translocase TatA         84.3    2e-17   Gloeocapsa sp. PCC 7428
ref|WP_011243599.1|  MULTISPECIES: preprotein translocase subunit...  84.3    2e-17   Synechococcus
ref|WP_002762408.1|  primosome subunit DnaD                           84.0    2e-17   Microcystis aeruginosa
ref|WP_036531210.1|  preprotein translocase subunit TatA              84.3    2e-17   Neosynechococcus sphagnicola
emb|CAO89342.1|  unnamed protein product                              84.7    2e-17   Microcystis aeruginosa PCC 7806
gb|ELS32305.1|  Sec-independent protein translocase protein tatA/...  84.3    2e-17   Pseudanabaena biceps PCC 7429
ref|WP_023067361.1|  twin arginine-targeting translocase, TatA/E ...  83.6    3e-17   Lyngbya aestuarii
ref|WP_015218443.1|  Sec-independent protein translocase TatA         83.6    3e-17   Cyanobacterium aponinum
ref|WP_002743526.1|  primosome subunit DnaD                           83.2    3e-17   Microcystis
ref|WP_036486219.1|  preprotein translocase subunit SecA              83.6    4e-17   Myxosarcina sp. GI1
ref|WP_013191028.1|  primosome subunit DnaD                           83.2    4e-17   Trichormus azollae
ref|WP_002765259.1|  primosome subunit DnaD                           82.8    5e-17   Microcystis aeruginosa
ref|WP_007100743.1|  preprotein translocase subunit TatA              82.8    5e-17   Synechococcus sp. RS9917
ref|WP_012628897.1|  preprotein translocase subunit TatA              83.2    5e-17   Cyanothece sp. PCC 7425
ref|WP_037218329.1|  preprotein translocase subunit TatA              82.4    6e-17   
ref|WP_028948124.1|  preprotein translocase subunit SecA              82.4    7e-17   Synechocystis sp. PCC 6714
emb|CEF96594.1|  Sec-independent protein translocase protein TatA/E   83.2    7e-17   Ostreococcus tauri
ref|WP_011131203.1|  preprotein translocase subunit TatA              82.4    8e-17   Prochlorococcus marinus
ref|WP_011618288.1|  prohead protease                                 82.4    8e-17   Synechococcus sp. CC9311
ref|WP_026787063.1|  MULTISPECIES: hypothetical protein               82.0    8e-17   Planktothrix
ref|WP_022607742.1|  twin arginine-targeting protein translocase,...  82.4    8e-17   Rubidibacter lacunae
ref|WP_015184092.1|  Sec-independent protein translocase TatA         82.4    9e-17   Microcoleus sp. PCC 7113
ref|WP_015222444.1|  Sec-independent protein translocase TatA         82.0    9e-17   
ref|WP_006099206.1|  primosome subunit DnaD                           82.0    1e-16   Coleofasciculus chthonoplastes
ref|WP_040688524.1|  preprotein translocase subunit TatA              81.3    1e-16   
ref|WP_009546094.1|  MULTISPECIES: primosome subunit DnaD             81.6    1e-16   Cyanothece
ref|WP_041425909.1|  preprotein translocase subunit SecA              81.6    1e-16   Synechocystis
ref|WP_019509197.1|  hypothetical protein                             81.6    1e-16   Pleurocapsa sp. PCC 7319
ref|XP_005646948.1|  twin arginine-targeting protein trans            81.3    2e-16   Coccomyxa subellipsoidea C-169
ref|WP_017718938.1|  hypothetical protein                             81.3    2e-16   Oscillatoria sp. PCC 10802
ref|WP_012267736.1|  primosome subunit DnaD                           81.3    2e-16   Microcystis
ref|WP_010314490.1|  primosome subunit DnaD                           81.3    2e-16   Synechococcus sp. CB0205
ref|WP_006633691.1|  preprotein translocase subunit TatA              81.3    2e-16   Microcoleus vaginatus
ref|WP_010871658.1|  hypothetical protein                             82.0    2e-16   
ref|WP_012410656.1|  primosome subunit DnaD                           81.3    2e-16   Nostoc punctiforme
ref|WP_015118028.1|  twin arginine-targeting protein translocase,...  80.9    2e-16   Rivularia sp. PCC 7116
ref|WP_040932916.1|  hypothetical protein                             80.9    3e-16   
ref|WP_029637480.1|  preprotein translocase subunit TatA [            80.9    3e-16   [Scytonema hofmanni] UTEX B 1581
tpg|DAA50381.1|  TPA: thylakoid assembly4                             81.6    3e-16   
ref|WP_012194832.1|  translocase                                      80.5    3e-16   Prochlorococcus marinus
ref|WP_038542939.1|  primosome subunit DnaD                           80.5    3e-16   Synechococcus sp. KORDI-100
ref|WP_015209228.1|  twin arginine-targeting protein translocase,...  80.5    3e-16   Cylindrospermum stagnale
dbj|GAL93280.1|  twin-arginine translocation protein TatB             80.5    3e-16   Microcystis aeruginosa NIES-44
ref|WP_015202296.1|  Sec-independent protein translocase TatA         80.5    3e-16   Crinalium epipsammum
ref|WP_040054321.1|  preprotein translocase subunit SecA              80.5    4e-16   
ref|WP_028083231.1|  preprotein translocase subunit TatA              80.5    4e-16   Dolichospermum circinale
ref|WP_028089196.1|  preprotein translocase subunit TatA              80.5    4e-16   Dolichospermum circinale
ref|WP_039739679.1|  preprotein translocase subunit TatA              80.5    4e-16   
ref|WP_011932240.1|  primosome subunit DnaD                           80.1    4e-16   Synechococcus sp. WH 7803
ref|WP_008275801.1|  primosome subunit DnaD                           80.5    4e-16   Cyanothece sp. CCY0110
ref|WP_035997640.1|  hypothetical protein                             80.5    5e-16   [Leptolyngbya] sp. JSC-1
ref|WP_012594970.1|  MULTISPECIES: primosome subunit DnaD             80.1    5e-16   Cyanothece
ref|WP_017327885.1|  hypothetical protein                             80.5    5e-16   Synechococcus sp. PCC 7336
ref|WP_012954283.1|  primosome subunit DnaD                           80.1    5e-16   Candidatus Atelocyanobacterium thalassa
ref|XP_002946596.1|  hypothetical protein VOLCADRAFT_120302           81.6    5e-16   Volvox carteri f. nagariensis
ref|WP_010477319.1|  MULTISPECIES: preprotein translocase subunit...  80.5    6e-16   Acaryochloris
ref|XP_003056138.1|  twin arginine targeting family                   81.3    6e-16   Micromonas pusilla CCMP1545
ref|WP_006516772.1|  twin arginine-targeting protein translocase,...  80.1    6e-16   Leptolyngbya sp. PCC 7375
ref|WP_044106578.1|  preprotein translocase subunit SecA              80.1    6e-16   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_044195831.1|  preprotein translocase subunit TatA              79.7    7e-16   Oscillatoria acuminata
ref|WP_017655009.1|  primosome subunit DnaD                           79.7    7e-16   Fortiea contorta
ref|WP_015136549.1|  twin arginine-targeting protein translocase,...  79.7    8e-16   Nostoc sp. PCC 7524
ref|WP_023071402.1|  sec-independent protein translocase              80.1    8e-16   Leptolyngbya sp. Heron Island J
ref|WP_006275635.1|  MULTISPECIES: primosome subunit DnaD             79.3    9e-16   Aphanizomenonaceae
ref|WP_044259952.1|  preprotein translocase subunit TatA              79.0    9e-16   Richelia intracellularis
ref|WP_027840950.1|  preprotein translocase subunit TatA              79.3    9e-16   Mastigocoleus testarum
ref|WP_016952632.1|  primosome subunit DnaD                           79.3    1e-15   Anabaena sp. PCC 7108
ref|WP_038019212.1|  hypothetical protein                             79.3    1e-15   
ref|WP_015176008.1|  Sec-independent protein translocase TatA         79.3    1e-15   Oscillatoria nigro-viridis
gb|EDX84644.1|  twin arginine-targeting protein translocase, TatA...  80.9    1e-15   Synechococcus sp. PCC 7335
ref|WP_008235394.1|  Twin-arginine translocation protein TatA         79.3    1e-15   Richelia intracellularis
ref|WP_015078234.1|  twin-arginine translocation protein              79.3    1e-15   Anabaena sp. 90
gb|EAW38682.1|  hypothetical protein L8106_14745                      79.0    1e-15   Lyngbya sp. PCC 8106
ref|WP_028953506.1|  primosome subunit DnaD                           78.6    1e-15   Synechococcus sp. CC9616
ref|WP_015161113.1|  twin arginine-targeting protein translocase,...  78.6    1e-15   Chamaesiphon minutus
ref|WP_015214503.1|  Sec-independent protein translocase TatA         79.0    1e-15   Anabaena cylindrica
ref|WP_015956190.1|  primosome subunit DnaD                           79.0    2e-15   Cyanothece sp. PCC 7424
ref|WP_015111805.1|  Sec-independent protein translocase TatA         78.6    2e-15   Nostoc sp. PCC 7107
ref|WP_044492070.1|  primosome subunit DnaD                           79.0    2e-15   Moorea producens
ref|WP_006530590.1|  twin arginine-targeting protein translocase,...  78.6    2e-15   Gloeocapsa sp. PCC 73106
gb|ACZ26222.1|  TatA/E                                                78.2    2e-15   Aphanizomenon sp. NH-5
ref|WP_027402857.1|  preprotein translocase subunit TatA              78.2    2e-15   Aphanizomenon flos-aquae
ref|WP_018400284.1|  hypothetical protein                             78.6    2e-15   filamentous cyanobacterium ESFC-1
ref|WP_006853679.1|  prohead protease                                 78.6    2e-15   Synechococcus sp. WH 8016
ref|WP_011936751.1|  primosome subunit DnaD                           78.2    2e-15   Synechococcus sp. RCC307
gb|AFY67086.1|  Sec-independent protein translocase TatA              78.6    3e-15   Geitlerinema sp. PCC 7407
ref|WP_010995019.1|  primosome subunit DnaD                           78.2    3e-15   Nostocaceae
ref|WP_011321124.1|  primosome subunit DnaD                           78.2    3e-15   Trichormus variabilis
ref|WP_015142774.1|  twin arginine-targeting protein translocase,...  77.8    3e-15   Pleurocapsa minor
ref|WP_015135395.1|  Sec-independent protein translocase TatA         78.2    3e-15   Leptolyngbya sp. PCC 7376
ref|WP_015191613.1|  Sec-independent protein translocase protein ...  77.8    3e-15   Stanieria cyanosphaera
ref|WP_041269048.1|  preprotein translocase subunit TatA              77.8    4e-15   
ref|WP_015129400.1|  Sec-independent protein translocase TatA         77.8    4e-15   Calothrix sp. PCC 7507
ref|WP_009788805.1|  primosome subunit DnaD                           77.4    4e-15   Synechococcus sp. BL107
ref|WP_036901406.1|  translocase                                      77.4    4e-15   Prochlorococcus sp. MIT 0601
gb|AHF62674.1|  twin-arginine translocation protein, TatA/E family    77.4    4e-15   Synechococcus sp. WH 8109
ref|WP_011360824.1|  primosome subunit DnaD                           77.0    5e-15   Synechococcus sp. CC9902
gb|KIJ84523.1|  preprotein translocase subunit TatA                   77.4    6e-15   Scytonema tolypothrichoides VB-61278
ref|WP_006042329.1|  primosome subunit DnaD                           77.0    6e-15   Synechococcus sp. WH 7805
ref|WP_007354006.1|  MULTISPECIES: preprotein translocase subunit...  76.6    8e-15   Kamptonema
ref|WP_011363292.1|  primosome subunit DnaD                           76.6    8e-15   Synechococcus sp. CC9605
ref|WP_038551417.1|  primosome subunit DnaD                           76.3    9e-15   Synechococcus sp. KORDI-52
ref|XP_010917651.1|  PREDICTED: sec-independent protein transloca...  78.2    9e-15   Elaeis guineensis
ref|WP_013323574.1|  primosome subunit DnaD                           76.6    9e-15   Cyanothece sp. PCC 7822
ref|WP_036617295.1|  preprotein translocase subunit TatA              76.3    1e-14   
ref|WP_007306580.1|  primosome subunit DnaD                           76.6    1e-14   Crocosphaera watsonii
ref|WP_016875716.1|  primosome subunit DnaD                           75.9    1e-14   Chlorogloeopsis fritschii
ref|WP_006194119.1|  primosome subunit DnaD                           76.3    1e-14   Nodularia spumigena
ref|WP_017316132.1|  primosome subunit DnaD                           76.3    1e-14   Mastigocladopsis repens
ref|WP_024124248.1|  twin-arginine protein translocation system c...  75.9    1e-14   Thermosynechococcus sp. NK55a
ref|WP_019488579.1|  primosome subunit DnaD                           75.9    2e-14   Calothrix sp. PCC 7103
ref|WP_007099747.1|  primosome subunit DnaD                           75.9    2e-14   Synechococcus sp. RS9916
ref|WP_011057225.1|  preprotein translocase subunit TatA              75.5    2e-14   Thermosynechococcus
ref|WP_006172416.1|  prohead protease                                 76.6    2e-14   
ref|WP_011294250.1|  translocase                                      75.5    2e-14   Prochlorococcus marinus
ref|WP_017746590.1|  primosome subunit DnaD                           75.5    2e-14   Scytonema hofmannii
ref|WP_011823102.1|  translocase                                      75.1    2e-14   Prochlorococcus marinus
ref|WP_041034563.1|  preprotein translocase subunit TatA              75.5    2e-14   Tolypothrix campylonemoides
ref|WP_043694585.1|  primosome subunit DnaD                           75.1    2e-14   Synechococcus sp. KORDI-49
ref|WP_015224612.1|  twin-arginine translocation protein, TatA/E ...  75.9    2e-14   Halothece sp. PCC 7418
ref|WP_016858680.1|  MULTISPECIES: primosome subunit DnaD             75.5    3e-14   Hapalosiphonaceae
ref|WP_026731687.1|  preprotein translocase subunit TatA              75.1    3e-14   Fischerella sp. PCC 9605
ref|XP_007515120.1|  twin arginine translocase protein A              76.6    3e-14   Bathycoccus prasinos
ref|WP_024546019.1|  hypothetical protein                             75.5    3e-14   Synechococcus
gb|AAP79161.1|  Tha4 plastid transport protein                        77.4    3e-14   Bigelowiella natans
ref|WP_039713404.1|  preprotein translocase subunit TatA              75.1    3e-14   
ref|WP_015157036.1|  Sec-independent protein translocase TatA         75.1    4e-14   Cyanobacteria [blue-green bacteria]
ref|WP_010312066.1|  primosome subunit DnaD                           74.7    4e-14   Synechococcus sp. CB0101
gb|EKQ67486.1|  twin arginine-targeting protein translocase, TatA...  75.5    4e-14   Oscillatoriales cyanobacterium JSC-12
ref|WP_009459239.1|  MULTISPECIES: primosome subunit DnaD             74.7    4e-14   Fischerella
ref|WP_012306345.1|  MULTISPECIES: primosome subunit DnaD             75.1    5e-14   Synechococcus
ref|WP_009632533.1|  twin arginine-targeting protein translocase,...  75.1    5e-14   Synechocystis sp. PCC 7509
ref|WP_025782329.1|  hypothetical protein                             74.7    5e-14   Candidatus Synechococcus spongiarum
gb|KIE07939.1|  preprotein translocase subunit TatA                   74.3    5e-14   Tolypothrix bouteillei VB521301
ref|WP_025956123.1|  hypothetical protein                             74.7    6e-14   
gb|AFY84251.1|  twin arginine-targeting protein translocase, TatA...  73.9    6e-14   Oscillatoria acuminata PCC 6304
ref|WP_016866312.1|  primosome subunit DnaD                           73.9    8e-14   Fischerella muscicola
ref|WP_015199060.1|  Sec-independent protein translocase TatA         73.6    1e-13   Calothrix parietina
ref|WP_017322731.1|  primosome subunit DnaD                           73.6    1e-13   cyanobacterium PCC 7702
ref|WP_038651129.1|  translocase                                      73.2    1e-13   Prochlorococcus sp. MIT 0801
ref|WP_036916527.1|  MULTISPECIES: hypothetical protein               73.2    1e-13   Prochlorococcus
ref|WP_025924574.1|  MULTISPECIES: translocase                        72.8    2e-13   Prochlorococcus
gb|EGJ35383.1|  twin arginine-targeting protein translocase, TatA...  73.2    2e-13   Moorea producens 3L
ref|WP_025944096.1|  translocase                                      72.4    2e-13   
gb|AFY70239.1|  Sec-independent protein translocase protein tatA/...  73.9    2e-13   Pseudanabaena sp. PCC 7367
ref|WP_011124437.1|  MULTISPECIES: translocase                        72.8    2e-13   Prochlorococcus
ref|WP_006909120.1|  prohead protease                                 73.2    3e-13   Cyanobium sp. PCC 7001
ref|WP_015124563.1|  twin arginine-targeting protein translocase,...  73.2    3e-13   Synechococcus sp. PCC 6312
ref|WP_032515017.1|  translocase                                      72.0    3e-13   Prochlorococcus marinus
ref|XP_003074238.1|  chloroplast Tha4-2 (ISS)                         73.2    3e-13   
ref|WP_041699455.1|  preprotein translocase subunit TatA              71.6    3e-13   
ref|WP_032515366.1|  hypothetical protein                             72.4    3e-13   Prochlorococcus marinus
ref|WP_025939386.1|  MULTISPECIES: translocase                        71.6    3e-13   
ref|WP_017307186.1|  hypothetical protein                             72.4    3e-13   Spirulina subsalsa
ref|WP_011377062.1|  MULTISPECIES: twin arginine-targeting protei...  72.4    4e-13   Prochlorococcus marinus
ref|WP_025980516.1|  translocase                                      71.6    4e-13   
ref|WP_006618394.1|  MULTISPECIES: preprotein translocase subunit...  72.0    4e-13   Arthrospira
ref|WP_025920894.1|  MULTISPECIES: hypothetical protein               72.0    4e-13   
ref|WP_011612401.1|  preprotein translocase subunit TatA              72.0    5e-13   Trichodesmium erythraeum
ref|WP_035156719.1|  preprotein translocase subunit TatA              71.6    5e-13   Calothrix sp. 336/3
ref|WP_035831648.1|  hypothetical protein                             71.6    7e-13   
ref|WP_015230087.1|  twin arginine-targeting protein translocase,...  71.6    8e-13   Dactylococcopsis salina
ref|WP_029977877.1|  hypothetical protein                             70.5    1e-12   
ref|WP_011434012.1|  prohead protease                                 71.2    1e-12   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_011429652.1|  prohead protease                                 71.2    1e-12   Synechococcus
ref|WP_036029486.1|  hypothetical protein                             69.7    2e-12   
ref|WP_015109628.1|  twin arginine-targeting protein translocase,...  70.1    3e-12   Cyanobium gracile
ref|XP_001415796.1|  Tat family transporter: pH-dependent thylako...  68.6    4e-12   Ostreococcus lucimarinus CCE9901
ref|WP_025931391.1|  MULTISPECIES: preprotein translocase subunit...  69.3    4e-12   
gb|KGG16679.1|  Twin-arginine translocation protein TatA              68.9    4e-12   Prochlorococcus sp. MIT 0602
ref|WP_039728023.1|  MULTISPECIES: hypothetical protein               70.1    5e-12   
ref|WP_002808122.1|  MULTISPECIES: preprotein translocase subunit...  68.9    6e-12   
ref|XP_005846144.1|  hypothetical protein CHLNCDRAFT_25319            68.2    6e-12   
ref|WP_025953436.1|  preprotein translocase subunit TatA              68.9    6e-12   
emb|CAN65505.1|  hypothetical protein VITISV_028343                   69.7    9e-12   
gb|KGG08202.1|  Twin-arginine translocation protein TatA              69.3    1e-11   
ref|XP_011087507.1|  PREDICTED: psbP domain-containing protein 1,...  70.5    1e-11   
ref|WP_025929795.1|  preprotein translocase subunit TatA              68.2    1e-11   
ref|XP_008379943.1|  PREDICTED: sec-independent protein transloca...  67.4    2e-11   
ref|WP_036921460.1|  preprotein translocase subunit TatA              67.8    2e-11   
ref|WP_042849833.1|  preprotein translocase subunit TatA              67.4    2e-11   
ref|WP_017290542.1|  hypothetical protein                             67.4    2e-11   
ref|WP_011862382.1|  preprotein translocase subunit TatA              67.0    3e-11   
ref|WP_040484823.1|  preprotein translocase subunit TatA              66.6    3e-11   
ref|WP_011131980.1|  preprotein translocase subunit TatA              67.0    3e-11   
ref|WP_019476887.1|  hypothetical protein                             67.0    4e-11   
ref|WP_025927350.1|  MULTISPECIES: preprotein translocase subunit...  66.6    4e-11   
ref|WP_032526670.1|  preprotein translocase subunit TatA              67.0    4e-11   
ref|WP_032520463.1|  preprotein translocase subunit TatA              66.6    4e-11   
ref|WP_025922921.1|  preprotein translocase subunit TatA              66.6    4e-11   
ref|WP_011817838.1|  preprotein translocase subunit TatA              66.6    4e-11   
ref|WP_025914192.1|  preprotein translocase subunit TatA              66.2    5e-11   
ref|WP_029982994.1|  preprotein translocase subunit TatA              66.2    5e-11   
ref|WP_025890446.1|  preprotein translocase subunit TatA              66.2    5e-11   
ref|WP_025891414.1|  MULTISPECIES: preprotein translocase subunit...  66.2    5e-11   
ref|WP_011375911.1|  preprotein translocase subunit TatA              66.2    5e-11   
ref|WP_025947718.1|  preprotein translocase subunit TatA              66.2    6e-11   
ref|WP_025924185.1|  MULTISPECIES: preprotein translocase subunit...  65.9    7e-11   
ref|WP_025894022.1|  MULTISPECIES: preprotein translocase subunit...  65.9    7e-11   
ref|WP_019476599.1|  hypothetical protein                             65.9    7e-11   
ref|WP_032524089.1|  preprotein translocase subunit TatA              65.9    7e-11   
ref|WP_019480068.1|  MULTISPECIES: hypothetical protein               65.5    7e-11   
ref|WP_011125382.1|  MULTISPECIES: translocase                        65.5    8e-11   
ref|WP_032515612.1|  preprotein translocase subunit TatA              65.9    8e-11   
emb|CDN11968.1|  Twin-arginine translocation protein TatB             65.1    1e-10   
ref|WP_025929169.1|  preprotein translocase subunit TatA              65.5    1e-10   
ref|WP_025927997.1|  preprotein translocase subunit TatA              65.5    1e-10   
ref|NP_001105878.1|  sec-independent protein translocase protein ...  67.4    2e-10   
ref|WP_011819696.1|  preprotein translocase subunit TatA              65.1    2e-10   
ref|WP_032521902.1|  preprotein translocase subunit TatA              65.1    2e-10   
ref|WP_014514826.1|  preprotein translocase subunit TatA              64.3    2e-10   
ref|XP_009774620.1|  PREDICTED: sec-independent protein transloca...  64.7    3e-10   
ref|XP_010917652.1|  PREDICTED: sec-independent protein transloca...  64.7    3e-10   
gb|ACN36614.1|  unknown                                               64.7    4e-10   
gb|AFW58102.1|  high chlorophyll fluorescence106c                     65.9    4e-10   
ref|WP_025971433.1|  preprotein translocase subunit TatA              62.8    4e-10   
ref|WP_026100045.1|  prohead protease                                 62.8    4e-10   
ref|NP_001104973.1|  HCF106C precursor protein                        65.9    5e-10   
gb|ACN31099.1|  unknown                                               65.9    5e-10   
ref|WP_032514028.1|  preprotein translocase subunit TatA              63.5    5e-10   
ref|WP_015116966.1|  twin arginine-targeting protein translocase,...  62.0    8e-10   
ref|WP_015127136.1|  twin-arginine translocation protein, TatA/E ...  62.0    1e-09   
ref|WP_041244377.1|  hypothetical protein                             62.0    1e-09   
ref|WP_019508711.1|  hypothetical protein                             61.6    1e-09   
ref|WP_015718151.1|  preprotein translocase subunit TatA              62.4    1e-09   
ref|WP_012595045.1|  MULTISPECIES: prohead protease                   61.6    1e-09   
gb|AGY57309.1|  twin arginine translocase protein A                   62.4    1e-09   
ref|WP_038070485.1|  preprotein translocase subunit TatA              62.0    2e-09   
ref|WP_002773949.1|  prohead protease                                 61.2    2e-09   
ref|WP_019550705.1|  preprotein translocase subunit TatA              61.6    2e-09   
ref|WP_038048152.1|  preprotein translocase subunit TatA              61.6    2e-09   
ref|WP_011142996.1|  hypothetical protein                             61.6    2e-09   
ref|WP_002733416.1|  prohead protease                                 60.8    2e-09   
ref|WP_038031563.1|  preprotein translocase subunit TatA              62.0    2e-09   
ref|WP_018111087.1|  preprotein translocase subunit TatA              61.2    2e-09   
ref|XP_002446330.1|  hypothetical protein SORBIDRAFT_06g014410        63.9    2e-09   
emb|CDY38919.1|  BnaA03g12600D                                        63.9    3e-09   
ref|WP_038324418.1|  hypothetical protein                             61.2    3e-09   
ref|WP_028494109.1|  preprotein translocase subunit TatA              61.2    4e-09   
ref|WP_038058378.1|  preprotein translocase subunit TatA              61.2    4e-09   
ref|WP_038026818.1|  prohead protease                                 60.5    4e-09   
ref|WP_002763330.1|  MULTISPECIES: prohead protease                   60.1    5e-09   
ref|WP_039457958.1|  preprotein translocase subunit TatA              60.1    5e-09   
gb|KCW46454.1|  hypothetical protein EUGRSUZ_K00283                   62.4    5e-09   
gb|EMT18555.1|  hypothetical protein F775_30996                       59.7    5e-09   
ref|WP_012470831.1|  prohead protease                                 60.5    6e-09   
ref|WP_011132011.1|  translocase                                      60.1    6e-09   
ref|XP_008787432.1|  PREDICTED: sec-independent protein transloca...  63.2    6e-09   
ref|WP_002769654.1|  prohead protease                                 59.7    6e-09   
ref|WP_036484173.1|  prohead protease                                 59.3    8e-09   
ref|WP_015210399.1|  twin arginine-targeting protein translocase,...  59.3    8e-09   
emb|CDP05165.1|  unnamed protein product                              62.8    8e-09   
ref|WP_009786034.1|  MULTISPECIES: hypothetical protein               59.3    9e-09   
emb|CDY27065.1|  BnaA02g10850D                                        62.4    9e-09   
ref|WP_009554242.1|  twin arginine-targeting protein translocase,...  59.3    9e-09   
ref|WP_016329796.1|  twin arginine-targeting protein translocase,...  59.7    9e-09   
ref|WP_015402314.1|  twin arginine-targeting protein translocase,...  59.7    1e-08   
ref|XP_009132526.1|  PREDICTED: sec-independent protein transloca...  61.6    1e-08   
dbj|BAJ93524.1|  predicted protein                                    62.4    1e-08   
ref|WP_025951424.1|  preprotein translocase subunit TatA              58.9    1e-08   
ref|WP_017300969.1|  hypothetical protein                             59.3    1e-08   
ref|WP_012412063.1|  prohead protease                                 58.9    1e-08   
ref|WP_015168538.1|  twin arginine-targeting protein translocase,...  58.9    1e-08   
ref|WP_007356474.1|  MULTISPECIES: prohead protease                   58.9    1e-08   
ref|WP_010940700.1|  primosome subunit DnaD                           60.1    1e-08   
ref|XP_009132527.1|  PREDICTED: sec-independent protein transloca...  61.2    1e-08   
ref|WP_015229068.1|  twin arginine-targeting protein translocase,...  58.5    1e-08   
ref|WP_016875501.1|  prohead protease                                 58.9    1e-08   
ref|WP_015214724.1|  Sec-independent protein translocase protein ...  58.5    1e-08   
ref|XP_010035161.1|  PREDICTED: sec-independent protein transloca...  62.0    1e-08   
ref|XP_004970559.1|  PREDICTED: sec-independent protein transloca...  61.6    2e-08   
ref|WP_041443593.1|  prohead protease                                 58.5    2e-08   
ref|WP_012062253.1|  preprotein translocase subunit TatA              58.9    2e-08   
gb|ACB00209.1|  twin-arginine translocation protein, TatA/E famil...  58.5    2e-08   
ref|WP_039745004.1|  preprotein translocase subunit TatA              59.7    2e-08   
gb|AGK51986.1|  twin-arginine translocation proteinTatA/E family ...  58.9    2e-08   
ref|WP_041580825.1|  prohead protease                                 58.5    2e-08   
ref|WP_004513699.1|  primosome subunit DnaD                           59.3    2e-08   
ref|WP_039647545.1|  preprotein translocase subunit TatA              59.3    2e-08   
ref|WP_030007305.1|  prohead protease                                 58.2    2e-08   
ref|WP_040930298.1|  prohead protease                                 57.8    2e-08   
ref|WP_008274285.1|  prohead protease                                 57.8    2e-08   
ref|XP_006279826.1|  hypothetical protein CARUB_v10028150mg           61.2    3e-08   
ref|WP_015234345.1|  twin arginine-targeting protein translocase,...  58.5    3e-08   
gb|ACB52916.1|  putative twin-arginine translocation protein TatA/E   57.8    3e-08   
ref|XP_006827568.1|  hypothetical protein AMTR_s00009p00224110        60.1    3e-08   
ref|WP_035276045.1|  hypothetical protein                             57.8    3e-08   
ref|WP_029979942.1|  preprotein translocase subunit TatA              58.2    3e-08   
ref|WP_008539032.1|  MULTISPECIES: translocase                        57.8    3e-08   
ref|WP_037224019.1|  prohead protease                                 57.4    3e-08   
gb|KIX12811.1|  primosome subunit DnaD                                58.9    4e-08   
ref|WP_009545268.1|  MULTISPECIES: prohead protease                   57.4    4e-08   
ref|WP_006456113.1|  prohead protease                                 57.4    4e-08   
ref|WP_044350231.1|  hypothetical protein                             58.5    4e-08   
ref|WP_026795770.1|  MULTISPECIES: prohead protease                   57.4    4e-08   
ref|WP_006632937.1|  prohead protease                                 57.4    4e-08   
ref|XP_004308065.1|  PREDICTED: sec-independent protein transloca...  60.8    4e-08   
ref|XP_007143455.1|  hypothetical protein PHAVU_007G073200g           60.5    4e-08   
ref|WP_041859334.1|  hypothetical protein                             57.8    4e-08   
ref|WP_041281314.1|  preprotein translocase subunit SecA              58.2    4e-08   
ref|WP_036741818.1|  hypothetical protein                             57.4    4e-08   
ref|WP_005998440.1|  preprotein translocase subunit TatA              57.4    4e-08   
ref|WP_015114757.1|  Sec-independent protein translocase protein ...  57.4    5e-08   
ref|WP_041435130.1|  hypothetical protein                             57.4    5e-08   
ref|WP_006100800.1|  prohead protease                                 57.0    5e-08   
ref|WP_035545258.1|  hypothetical protein                             57.4    5e-08   
ref|WP_021771622.1|  twin arginine-targeting protein translocase,...  57.4    5e-08   
gb|ABW68975.1|  twin-arginine translocation protein, TatA/E famil...  58.5    5e-08   
ref|WP_026788693.1|  MULTISPECIES: prohead protease                   57.4    5e-08   
ref|WP_009138980.1|  translocase                                      57.8    5e-08   
ref|WP_033396547.1|  hypothetical protein                             57.4    5e-08   
ref|WP_016950696.1|  hypothetical protein                             57.0    6e-08   
ref|WP_027890419.1|  preprotein translocase subunit TatA              57.0    6e-08   
gb|AEH45116.1|  twin-arginine translocation protein, TatB subunit     58.2    6e-08   
ref|WP_020677601.1|  hypothetical protein                             58.2    6e-08   
ref|WP_013250563.1|  twin-arginine translocation protein TatA2        57.8    6e-08   
ref|XP_005715099.1|  unnamed protein product                          58.5    6e-08   
gb|ABJ83813.1|  sec-independent translocation protein mttA/Hcf106     58.9    6e-08   
gb|KDP22247.1|  hypothetical protein JCGZ_26078                       59.3    6e-08   
ref|XP_002992704.1|  hypothetical protein SELMODRAFT_36641            57.4    6e-08   
emb|CCG45564.1|  sec-independent protein translocase protein TatA     57.0    6e-08   
ref|WP_015192754.1|  Sec-independent protein translocase protein ...  56.6    6e-08   
ref|WP_036683544.1|  hypothetical protein                             57.0    7e-08   
ref|WP_023408438.1|  hypothetical protein                             57.4    7e-08   
ref|WP_015181140.1|  Sec-independent protein secretion pathway co...  56.6    7e-08   
ref|WP_023072963.1|  prohead protease                                 56.6    7e-08   
ref|WP_040942890.1|  prohead protease                                 56.6    7e-08   
ref|WP_041036870.1|  prohead protease                                 56.6    7e-08   
ref|WP_006516307.1|  twin arginine-targeting protein translocase,...  56.6    8e-08   
ref|WP_006192924.1|  prohead protease                                 57.4    8e-08   
ref|XP_011076133.1|  PREDICTED: sec-independent protein transloca...  60.1    9e-08   
ref|WP_021684585.1|  twin arginine-targeting protein translocase,...  56.6    9e-08   
ref|WP_044493720.1|  prohead protease                                 56.6    9e-08   
ref|WP_029634807.1|  prohead protease [                               56.6    9e-08   
ref|WP_026696478.1|  preprotein translocase subunit TatA              56.6    9e-08   
ref|WP_041243663.1|  preprotein translocase subunit TatA              56.6    9e-08   
ref|WP_028052256.1|  primosome subunit DnaD                           56.2    9e-08   
gb|EMT20666.1|  Sec-independent translocase protein tatA/E-like p...  60.8    9e-08   
ref|WP_007306082.1|  prohead protease                                 56.2    9e-08   
gb|AGY56673.1|  twin-arginine translocation protein, TatA/E famil...  56.6    1e-07   
ref|XP_010442771.1|  PREDICTED: sec-independent protein transloca...  59.7    1e-07   
gb|EGJ31809.1|  twin arginine-targeting protein translocase, TatA...  56.6    1e-07   
ref|WP_039742090.1|  prohead protease                                 56.2    1e-07   
ref|XP_010255316.1|  PREDICTED: sec-independent protein transloca...  58.5    1e-07   
ref|XP_002864174.1|  HCF106                                           59.7    1e-07   
ref|XP_010555674.1|  PREDICTED: sec-independent protein transloca...  59.7    1e-07   
ref|XP_010255314.1|  PREDICTED: sec-independent protein transloca...  58.9    1e-07   
ref|WP_035984267.1|  prohead protease                                 56.2    1e-07   
ref|WP_015224853.1|  twin-arginine translocation protein, TatA/E ...  56.2    1e-07   
ref|WP_009656367.1|  twin arginine-targeting protein translocase,...  56.6    1e-07   
gb|EMS50111.1|  Sec-independent protein translocase protein tatA/...  59.3    1e-07   
ref|WP_044392335.1|  preprotein translocase subunit SecA              56.2    1e-07   
ref|XP_001784348.1|  predicted protein                                59.7    1e-07   
ref|XP_010255313.1|  PREDICTED: sec-independent protein transloca...  59.3    1e-07   
ref|XP_006401824.1|  hypothetical protein EUTSA_v10014513mg           59.3    1e-07   
ref|WP_011345436.1|  primosome subunit DnaD                           55.8    1e-07   
ref|WP_012302215.1|  primosome subunit DnaD                           56.6    1e-07   
ref|XP_008234198.1|  PREDICTED: sec-independent protein transloca...  59.7    1e-07   
ref|XP_010255315.1|  PREDICTED: sec-independent protein transloca...  58.5    1e-07   
ref|WP_006693020.1|  primosome subunit DnaD                           57.0    1e-07   
ref|WP_013162920.1|  preprotein translocase subunit TatA              56.2    1e-07   
ref|XP_008379949.1|  PREDICTED: sec-independent protein transloca...  58.2    1e-07   
ref|WP_006694806.1|  Sec-independent protein translocase protein ...  56.2    1e-07   
ref|XP_009340062.1|  PREDICTED: sec-independent protein transloca...  59.7    2e-07   
ref|WP_028895287.1|  hypothetical protein                             56.6    2e-07   
ref|WP_007289801.1|  translocase                                      55.8    2e-07   
ref|WP_035154511.1|  prohead protease                                 55.8    2e-07   
ref|WP_041601335.1|  preprotein translocase subunit SecA              55.8    2e-07   
gb|EPS59585.1|  hypothetical protein M569_15219                       60.1    2e-07   
ref|WP_015200638.1|  Sec-independent protein translocase protein ...  55.5    2e-07   
ref|WP_017742890.1|  prohead protease                                 55.5    2e-07   
ref|XP_004140768.1|  PREDICTED: sec-independent protein transloca...  58.2    2e-07   
ref|WP_007294095.1|  preprotein translocase subunit TatA              56.2    2e-07   
emb|CDX91651.1|  BnaC02g15090D                                        58.5    2e-07   
emb|CEG28936.1|  twin-arginine translocation protein TatA             55.5    2e-07   
ref|WP_025942164.1|  MULTISPECIES: preprotein translocase subunit...  56.2    2e-07   
ref|XP_010935803.1|  PREDICTED: sec-independent protein transloca...  58.2    2e-07   
ref|WP_017303810.1|  prohead protease                                 55.1    2e-07   
ref|WP_043926097.1|  preprotein translocase subunit TatA              55.5    2e-07   
ref|WP_028842558.1|  hypothetical protein                             56.2    2e-07   
ref|WP_027323705.1|  preprotein translocase subunit TatA              55.5    2e-07   
ref|WP_005998441.1|  twin-arginine translocation protein, TatA/E ...  55.8    2e-07   
ref|WP_016870212.1|  prohead protease                                 55.5    2e-07   
ref|XP_002513673.1|  conserved hypothetical protein                   58.5    2e-07   
ref|NP_200057.1|  sec-independent protein translocase protein TATB    58.5    3e-07   
ref|XP_007038767.1|  Bacterial sec-independent translocation prot...  58.5    3e-07   
ref|WP_020877977.1|  Sec-independent protein translocase protein ...  56.2    3e-07   
ref|WP_015562776.1|  Sec-independent protein translocase TatA         55.5    3e-07   
gb|KDO51971.1|  hypothetical protein CISIN_1g023111mg                 57.8    3e-07   
ref|WP_006690241.1|  primosome subunit DnaD                           56.2    3e-07   
ref|WP_009438175.1|  MULTISPECIES: twin arginine-targeting protei...  55.5    3e-07   



>ref|XP_009785953.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Nicotiana sylvestris]
Length=157

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 85/109 (78%), Gaps = 4/109 (4%)
 Frame = -3

Query  551  RMVSGQRAARSS----GGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGK  384
            R +   RA R+S      +K  SCNCLFGLGVPELVVIAGVAALVFGPKKLP+VGRSIGK
Sbjct  48   RALVPSRARRTSKLVSNDKKGLSCNCLFGLGVPELVVIAGVAALVFGPKKLPDVGRSIGK  107

Query  383  TFKGFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            T K FQQAAKEFETELKKEPD+    P E   EI Q+EK+DA+VSSTKE
Sbjct  108  TVKSFQQAAKEFETELKKEPDASIDPPVEKAREIGQEEKQDASVSSTKE  156



>ref|XP_009610432.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Nicotiana tomentosiformis]
Length=158

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  521  SSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFET  342
            +S  +K FSCNCLFGLGVPELVVIAGVAALVFGPK+LPEVGR+IG+T K FQQAAKEFET
Sbjct  62   TSSAKKGFSCNCLFGLGVPELVVIAGVAALVFGPKQLPEVGRTIGRTVKSFQQAAKEFET  121

Query  341  ELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            ELKKEP++ A+ P E   E +Q+EK+DATVSSTKE S
Sbjct  122  ELKKEPEASAEPPMEKAIEASQEEKQDATVSSTKESS  158



>ref|XP_009766133.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Nicotiana sylvestris]
Length=158

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = -3

Query  533  RAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAK  354
            R  RSSG +K  SCNCLFGLGVPELVVIAGVAALVFGPK+LPEVGR+IGKT K FQQAAK
Sbjct  59   RKVRSSG-KKGLSCNCLFGLGVPELVVIAGVAALVFGPKQLPEVGRTIGKTVKSFQQAAK  117

Query  353  EFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            EFETELKKEP + A+ P E   E +Q+EK+DATVSSTKE S
Sbjct  118  EFETELKKEPVASAEPPVEKAIEASQEEKQDATVSSTKESS  158



>ref|XP_002531294.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31107.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V G+  +R+   RK  +CN LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT K F
Sbjct  44   LVLGKTRSRTERTRKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSF  103

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            Q+AAKEFE+ELKKEPDS  ++P E    I++++K+DA VSS+KE 
Sbjct  104  QEAAKEFESELKKEPDSALESPGETPTAISEEKKQDAEVSSSKES  148



>ref|XP_002279607.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Vitis vinifera]
 emb|CBI34159.3| unnamed protein product [Vitis vinifera]
Length=136

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +KR +C CLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT K FQQAAKEFETELKK
Sbjct  44   QKRLTCTCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAAKEFETELKK  103

Query  329  EPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            EP S+ +AP E    +++++++D  VSS KE 
Sbjct  104  EPASVTEAPVETPATLSEEKEKDVEVSSKKES  135



>ref|XP_006347746.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Solanum tuberosum]
Length=167

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  518  SGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETE  339
            S  ++  SC CLFGLGVPEL VIAGVAALVFGPK+LPEVGR+IGKT K FQQAAKEFETE
Sbjct  72   SNSKRGLSCYCLFGLGVPELAVIAGVAALVFGPKQLPEVGRTIGKTVKSFQQAAKEFETE  131

Query  338  LKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            L+KEPD+ AQ P E   E +Q+EK+D  VSSTKE S
Sbjct  132  LRKEPDASAQPPVEKAIEGSQEEKQDTKVSSTKESS  167



>ref|XP_004230095.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Solanum lycopersicum]
Length=160

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  518  SGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETE  339
            S  ++  SC CLFGLGVPEL VIAGVAALVFGPK+LPEVGR+IGKT K FQQAAKEFE+E
Sbjct  65   SNSKRGLSCYCLFGLGVPELAVIAGVAALVFGPKQLPEVGRNIGKTVKSFQQAAKEFESE  124

Query  338  LKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            LKKEPD+ AQ P E   E++ +EK+D  V STKE S
Sbjct  125  LKKEPDASAQPPVEKAIEVSHEEKQDTKVPSTKESS  160



>gb|KDP23662.1| hypothetical protein JCGZ_23495 [Jatropha curcas]
Length=148

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -3

Query  536  QRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            +R  R++ G    +CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAA
Sbjct  50   RRTQRTAKG---LTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAA  106

Query  356  KEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            KEFE+ELKKEPDSL+ +P E    +++++K+D  +SSTKE
Sbjct  107  KEFESELKKEPDSLSDSPGEKPTGVSEEKKQDVEISSTKE  146



>gb|ACJ85933.1| unknown [Medicago truncatula]
 gb|AFK48565.1| unknown [Medicago truncatula]
 gb|KEH43020.1| twin arginine translocase [Medicago truncatula]
Length=139

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 80/110 (73%), Gaps = 8/110 (7%)
 Frame = -3

Query  566  NGAGLRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIG  387
            N   L +   +   RS+   KRF+CN  FGLGVPELVVIAGVAALVFGPKKLPEVGRSIG
Sbjct  36   NTTSLLLKKARTRTRST---KRFTCNAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIG  92

Query  386  KTFKGFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            KT K FQQAAKEFETELKKEP+S     +E +   N QE +D  VSSTK+
Sbjct  93   KTVKSFQQAAKEFETELKKEPNS-----TEEISVTNDQEDQDNKVSSTKD  137



>gb|KHG04000.1| Sec-independent translocase protein TatA [Gossypium arboreum]
Length=157

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  536  QRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            +R   +   +K  +CN LFGLGVPELVVIAGVAAL+FGPKKLPEVG+SIGKT K FQQAA
Sbjct  56   RRGTTAEPAKKGLTCNALFGLGVPELVVIAGVAALLFGPKKLPEVGKSIGKTVKSFQQAA  115

Query  356  KEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            KEFETELKKEP+S+ + P E    +++++K D  VSS+KE 
Sbjct  116  KEFETELKKEPESMTEQPKENTTAVSEEKKPDLEVSSSKES  156



>gb|ABK93649.1| unknown [Populus trichocarpa]
Length=150

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V G+  + S   +K  +CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT + F
Sbjct  44   LVLGKTTSGSQRAKKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVRSF  103

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            QQAAKEFE+ELKKEP+S  + P E  + I +++K+D  VSSTKE S
Sbjct  104  QQAAKEFESELKKEPESEPETPGEQPKAIIEEKKQDVEVSSTKEKS  149



>ref|XP_011032407.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Populus euphratica]
Length=148

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V G+  + S   +K  +CN LFGLGVPELVVIAGVA L+FGPK+LPEVGRSIGKT K F
Sbjct  43   LVLGKARSSSQRAKKGLTCNALFGLGVPELVVIAGVATLLFGPKQLPEVGRSIGKTVKSF  102

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            QQAAKEFE+ELKKEPDS +  P E    I++++K D  VSS+KE
Sbjct  103  QQAAKEFESELKKEPDSTSDTPGEQPTTISEEKKHDIAVSSSKE  146



>gb|KJB82529.1| hypothetical protein B456_013G200900 [Gossypium raimondii]
Length=157

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  512  GRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELK  333
             +K  +CN LFGLGVPELVVIAGVAAL+FGPKKLPEVG+SIGKT K FQQAAKEFETELK
Sbjct  64   AKKGLTCNALFGLGVPELVVIAGVAALLFGPKKLPEVGKSIGKTVKSFQQAAKEFETELK  123

Query  332  KEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            KEP+S+ + P E    +++++K D  VSS+KE 
Sbjct  124  KEPESITEQPKENTSAVSEEKKPDLEVSSSKES  156



>ref|XP_007147171.1| hypothetical protein PHAVU_006G101800g [Phaseolus vulgaris]
 gb|ESW19165.1| hypothetical protein PHAVU_006G101800g [Phaseolus vulgaris]
Length=147

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = -3

Query  533  RAARSSGGRKR---FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQ  363
            RA    GGR+R    +CN +FGLG+PELVVIAGVAALVFGPKKLPEVGRSIGKT K FQQ
Sbjct  44   RAVSVKGGRRRNRGLTCNAIFGLGMPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQ  103

Query  362  AAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            AAKEFE+ELKKEPDS     SE    I +QEK+D  +SS+KE 
Sbjct  104  AAKEFESELKKEPDSTEGDSSEKPIAIGEQEKQDNELSSSKES  146



>ref|XP_010550921.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Tarenaya hassleriana]
Length=150

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
             V G+   R    RKRF+CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT K F
Sbjct  44   FVVGRPGIRPEPTRKRFTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSF  103

Query  368  QQAAKEFETELKKEPDSLAQAPS-EGVEEINQQEKRDATVSSTKE  237
            QQAAKEFE+ELKKEPD    + S E   E++  E++ A VS++KE
Sbjct  104  QQAAKEFESELKKEPDPPTDSSSAEKPVEVSITEEKKAEVSTSKE  148



>ref|XP_011078757.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Sesamum indicum]
Length=148

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = -3

Query  566  NGAGLRMVSGQRAARSSGGRKR-FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSI  390
            N AGL +     A R    +KR  SCNCLFGLGVPELVVIAGVAALVFGPK+LPEVGRSI
Sbjct  38   NRAGLVLY----ADRPRRAKKRGLSCNCLFGLGVPELVVIAGVAALVFGPKQLPEVGRSI  93

Query  389  GKTFKGFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS*T  225
            GKT K FQQAAKEFE+ELKKE ++ A+   E +  ++++EK++  V STKE S T
Sbjct  94   GKTVKSFQQAAKEFESELKKEGETSAEPSVEKITTVSEEEKQEGKVPSTKESSYT  148



>ref|XP_004495801.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Cicer arietinum]
Length=135

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 78/102 (76%), Gaps = 5/102 (5%)
 Frame = -3

Query  536  QRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            ++A  SS   K F+C   FGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT K FQQAA
Sbjct  38   KKARISSRRTKGFTCKAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAA  97

Query  356  KEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            KEFETELKKEP+S  + P       + QE++D  VSSTKEDS
Sbjct  98   KEFETELKKEPNSTEEIPV-----TSDQEEQDIKVSSTKEDS  134



>emb|CDP06816.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = -3

Query  521  SSGGRKR-FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFE  345
            SS  RKR  SC CLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT K FQQAAKEFE
Sbjct  56   SSRARKRGLSCTCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAAKEFE  115

Query  344  TELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            +ELKKEP S A+  +E V+ ++ +  +DA V S KE 
Sbjct  116  SELKKEPISAAEPSAEKVKAVSDEGGQDAEVKSIKES  152



>ref|XP_002319073.2| thylakoid assembly family protein [Populus trichocarpa]
 gb|EEE94996.2| thylakoid assembly family protein [Populus trichocarpa]
Length=149

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V G+  + S   +K  +CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT + F
Sbjct  44   LVLGKTTSGSQRAKKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVRSF  103

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            QQAAKEFE+ELKKEP+S  + P E  + I +++K+D  VSS+KE 
Sbjct  104  QQAAKEFESELKKEPESEPETPGEQPKAIIEEKKQDVEVSSSKES  148



>gb|ABK93003.1| unknown [Populus trichocarpa]
Length=148

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V G+  +RS   +K  +CN LFGLGVPELVVIAGVA L+FGPK+LPEVGRSIGKT K F
Sbjct  43   LVLGKTRSRSQRAKKGLTCNALFGLGVPELVVIAGVATLLFGPKQLPEVGRSIGKTVKSF  102

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRD  261
            QQAAKEFE+ELKKEPDS +  P E    I++++K D
Sbjct  103  QQAAKEFESELKKEPDSTSDTPGEQPTTISEEKKHD  138



>ref|XP_008218264.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Prunus mume]
Length=150

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 4/93 (4%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +K  +CN LFGLG+PELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEFETELKK
Sbjct  62   KKGLTCNALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFETELKK  121

Query  329  EPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            EP++L + P+     ++++EK++  VSS+KE++
Sbjct  122  EPEALTETPT----AVSEEEKQEVKVSSSKENA  150



>gb|AFK47858.1| unknown [Lotus japonicus]
Length=147

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD  321
             +CN LFGLGVPELVVIAGVAA+VFGPKKLPEVGRSIGKT K FQQAAKEFETELKKEPD
Sbjct  59   LTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTLKSFQQAAKEFETELKKEPD  118

Query  320  SLAQAPSEGVEEINQQEKRDATVSSTKED  234
            S+    SE    +++QEK++  VSS+KE 
Sbjct  119  SIG-GQSEEPLAVSEQEKQETEVSSSKES  146



>ref|XP_004494699.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Cicer arietinum]
Length=144

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD  321
             +CN LFGLGVPELVVIAGVAA+VFGPKKLPEVGRSIGKT K FQQAAKEFE+ELKKEPD
Sbjct  55   LTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVKSFQQAAKEFESELKKEPD  114

Query  320  SLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            S    PS+     ++QE +D  VSS+KE +
Sbjct  115  STGGEPSDKSFAASKQETQDTEVSSSKESA  144



>ref|XP_007206084.1| hypothetical protein PRUPE_ppa012899mg [Prunus persica]
 gb|EMJ07283.1| hypothetical protein PRUPE_ppa012899mg [Prunus persica]
Length=150

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 79/93 (85%), Gaps = 4/93 (4%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +K  +CN LFGLG+PELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEFETELKK
Sbjct  62   KKGLTCNALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFETELKK  121

Query  329  EPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            EP++L + P+     ++++EK++  VSS++E++
Sbjct  122  EPEALTETPT----AVSEEEKQEVKVSSSQENA  150



>gb|AFK44195.1| unknown [Medicago truncatula]
 gb|KEH24553.1| twin arginine translocase [Medicago truncatula]
Length=144

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD  321
            F+CN LFGLGVPELVVIAGVAA+VFGPKKLPEVGRSIGKT K FQQAAKEFE+ELKKEP 
Sbjct  55   FTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVKSFQQAAKEFESELKKEPG  114

Query  320  SLAQAPSEGVEEINQQEKRDATVSSTKED  234
            S    PSE    +++++K+D  VSS+KE 
Sbjct  115  SSGGEPSEKSIAVSEEKKQDTEVSSSKES  143



>sp|Q9XH46.1|TATA_PEA RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Pisum sativum]
 gb|AAD33943.1|AF144708_1 Tha4 protein [Pisum sativum]
Length=137

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 5/91 (5%)
 Frame = -3

Query  506  KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            K F+CN  FGLGVPELVVIAGVAALVFGPKKLPEVGRSIG+T K FQQAAKEFETELKKE
Sbjct  51   KGFTCNAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGQTVKSFQQAAKEFETELKKE  110

Query  326  PDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            P+     P+E +   ++QEK++  VSSTK++
Sbjct  111  PN-----PTEEISVASEQEKQEIKVSSTKDN  136



>ref|XP_008345714.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Malus domestica]
Length=148

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = -3

Query  566  NGAGLRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIG  387
            NG+ L  V  +   R+    K  +C  LFGLG+PELVVIAGVAALVFGPKKLPEVG+SIG
Sbjct  43   NGSAL--VLSRXRTRTXRAZKGMTCTALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIG  100

Query  386  KTFKGFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            KT K FQQAAKEFETELKKEP+ L + P+   EE    EK+DA V+S++E++
Sbjct  101  KTVKSFQQAAKEFETELKKEPEGLTETPTAASEE----EKQDAKVASSQENA  148



>ref|XP_003521755.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Glycine max]
 gb|KHN31463.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=143

 Score =   126 bits (316),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -3

Query  512  GRKR---FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFET  342
            GR+R    SCN +FGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT K FQQAAKEFE+
Sbjct  46   GRRRNKGLSCNAMFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAAKEFES  105

Query  341  ELKKEPDSLAQAPSEG-VEEINQQEKRDATVSSTKE  237
            ELKKEPDS     SE  +  + +Q++ D  VS++KE
Sbjct  106  ELKKEPDSTQGDSSEKPIVTVTEQQQEDNEVSTSKE  141



>ref|XP_008388678.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Malus domestica]
Length=148

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 84/110 (76%), Gaps = 4/110 (4%)
 Frame = -3

Query  560  AGLRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT  381
            +G  +V  +   R+   +   +CN LFGLG+PELVVIAGVAALVFGPKKLPEVG+SIGKT
Sbjct  43   SGSALVLSRSRTRTERAQTGMTCNALFGLGMPELVVIAGVAALVFGPKKLPEVGKSIGKT  102

Query  380  FKGFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
             K FQQAAKEFETELKKEP+ L + P+     ++++EK++A V S++E++
Sbjct  103  VKSFQQAAKEFETELKKEPEGLTETPT----AVSEEEKQEAKVPSSQENA  148



>gb|EYU33033.1| hypothetical protein MIMGU_mgv1a021859mg [Erythranthe guttata]
Length=97

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD  321
            FSCNCLFGLGVPELVVIAGVA ++FGPK+LPEVGRSIGKT K FQQAAKEFETELKK+P+
Sbjct  9    FSCNCLFGLGVPELVVIAGVAVILFGPKQLPEVGRSIGKTVKSFQQAAKEFETELKKDPE  68

Query  320  SLAQAPS-EGVEEINQQEKRDATVSSTKEDS  231
               + P      E  QQE  DA VSSTKE S
Sbjct  69   PSGEEPKITTASEEKQQE--DARVSSTKESS  97



>ref|NP_001238018.1| uncharacterized protein LOC100306385 [Glycine max]
 gb|ACU14531.1| unknown [Glycine max]
 gb|KHN43189.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=142

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 4/103 (4%)
 Frame = -3

Query  533  RAARSSGGRKR---FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQ  363
            R A +  GR R    SCN +FGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT K FQQ
Sbjct  38   RVAVNVNGRGRNKGLSCNAMFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQ  97

Query  362  AAKEFETELKKEPDSLAQAPSEGVEEINQ-QEKRDATVSSTKE  237
            AAKEFE+ELKKEPDS     SE    +++ Q+++D  VS++KE
Sbjct  98   AAKEFESELKKEPDSTEGDSSEKSIVVSEKQQQQDNEVSTSKE  140



>ref|XP_006432928.1| hypothetical protein CICLE_v10002770mg [Citrus clementina]
 ref|XP_006471679.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Citrus sinensis]
 gb|ESR46168.1| hypothetical protein CICLE_v10002770mg [Citrus clementina]
 gb|KDO48914.1| hypothetical protein CISIN_1g031919mg [Citrus sinensis]
Length=150

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD  321
            F+C  LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEFE+ELKKEPD
Sbjct  61   FTCYALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKKEPD  120

Query  320  SLAQAPSEGVEEINQQEKRDATVSSTKE  237
            S    P E    I+++ K +  +SS+KE
Sbjct  121  SETDPPGEKPTAISEERKDEGKISSSKE  148



>ref|XP_009364497.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Pyrus x bretschneideri]
Length=148

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = -3

Query  527  ARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEF  348
             R+   +K  +CN LFGLG+PE+VVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEF
Sbjct  54   TRTERAQKGMTCNALFGLGMPEIVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEF  113

Query  347  ETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            ETELKKEP+ L + P+     ++++EK++A V+ ++E++
Sbjct  114  ETELKKEPEGLTETPT----AVSEEEKQEAKVAISQENA  148



>ref|XP_010246331.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Nelumbo nucifera]
Length=146

 Score =   123 bits (308),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  488  CLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ  309
            CLFGLGVPELVVIAGVAALVFGPKKLPE+GRS GKT K FQQAAKEFE+ELKK+P+S  +
Sbjct  61   CLFGLGVPELVVIAGVAALVFGPKKLPEIGRSFGKTLKSFQQAAKEFESELKKDPESAIE  120

Query  308  APSEGVEEINQQEKRDATVSSTKED  234
            A SE    ++++ K D  VSST E+
Sbjct  121  ATSEKPTTVSEERKEDTKVSSTNEN  145



>ref|XP_011078758.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Sesamum indicum]
Length=141

 Score =   123 bits (308),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 5/106 (5%)
 Frame = -3

Query  566  NGAGLRMVSGQRAARSSGGRKR-FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSI  390
            N AGL +     A R    +KR  SCNCLFGLGVPELVVIAGV ALVFGPKKLPEVGRSI
Sbjct  38   NRAGLVLY----ADRPRTAKKRGLSCNCLFGLGVPELVVIAGVTALVFGPKKLPEVGRSI  93

Query  389  GKTFKGFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATV  252
            GKT K FQQAAKEFE+ELKKE +S A+  SE +   +++EK++  V
Sbjct  94   GKTVKSFQQAAKEFESELKKEGESSAEPSSEKITTASEEEKQEDKV  139



>gb|KHN04931.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=146

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -3

Query  533  RAARSSGGR-KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            R AR S  R K  +CN LFGLGVPELVVIAGVA L FGPK LP+VGRSIGKT K FQQAA
Sbjct  43   RKARISTRRSKALTCNALFGLGVPELVVIAGVAVLAFGPKNLPQVGRSIGKTIKSFQQAA  102

Query  356  KEFETELKKEPDSLAQAPSEGVEEI--NQQEKRDATVSSTKE  237
            KEFE+E+KKEPDS  + P+   + I  ++QE+++  VS TK+
Sbjct  103  KEFESEIKKEPDSTEENPAAAEKSIAVSEQEEQETKVSGTKD  144



>ref|XP_004171639.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like, partial [Cucumis sativus]
Length=146

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
             K F+CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEFE+ELKK
Sbjct  54   HKGFTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKK  113

Query  329  EPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            EP+   +   E       +E++D  VS+ KE
Sbjct  114  EPEPTEETSVEKPTSTEAEERQDLKVSNQKE  144



>ref|XP_007030572.1| Bacterial sec-independent translocation protein mttA/Hcf106 [Theobroma 
cacao]
 gb|EOY11074.1| Bacterial sec-independent translocation protein mttA/Hcf106 [Theobroma 
cacao]
Length=153

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  536  QRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            +R  R+   ++  +CN LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT K FQQAA
Sbjct  54   RRRTRAEPAKRGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVKSFQQAA  113

Query  356  KEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVS  249
            KEFE+ELKK P+S  +   E    + ++ K+D  VS
Sbjct  114  KEFESELKKSPESPTEPSEENPTAVIEENKQDVEVS  149



>ref|XP_004135654.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Cucumis sativus]
 gb|KGN66148.1| hypothetical protein Csa_1G573670 [Cucumis sativus]
Length=158

 Score =   121 bits (303),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
             K F+CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEFE+ELKK
Sbjct  66   HKGFTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKK  125

Query  329  EPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            EP+   +   E       +E++D  VS+ KE
Sbjct  126  EPEPTEETSVEKPTSTEAEERQDLKVSNQKE  156



>ref|XP_010027195.1| PREDICTED: light-inducible protein CPRF2-like [Eucalyptus grandis]
Length=679

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -3

Query  524  RSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFE  345
            R+   ++  +CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEFE
Sbjct  585  RNQRAKRGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFE  644

Query  344  TELKKEPDSLAQAPSEGVEEINQQEKRDAT  255
            +E+KKEP+SL +   E  EE+ Q+EK D+T
Sbjct  645  SEIKKEPESLTEPSIEKPEEVAQEEKVDST  674



>ref|XP_003556468.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like isoform X1 [Glycine max]
Length=142

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = -3

Query  533  RAARSSGGR-KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            R AR S  R K  +CN LFGLGVPELVVIAGVA L FGPK  P+VGRSIGKT K FQQAA
Sbjct  39   RKARISTRRSKALTCNALFGLGVPELVVIAGVAVLAFGPKNFPQVGRSIGKTIKSFQQAA  98

Query  356  KEFETELKKEPDSLAQAPSEGVEEI--NQQEKRDATVSSTKE  237
            KEFE+E+KKEPDS  + P+   + I  ++QE+++  VS TK+
Sbjct  99   KEFESEIKKEPDSTEENPAAAEKSIAVSEQEEQETKVSGTKD  140



>ref|XP_009389019.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 75/103 (73%), Gaps = 6/103 (6%)
 Frame = -3

Query  533  RAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAK  354
            R  RS G      C CLFGLGVPELVVIAGVAALVFGPK LPE+GRSIGKT K FQQAAK
Sbjct  51   RPGRSGG----LGCRCLFGLGVPELVVIAGVAALVFGPKNLPEIGRSIGKTVKSFQQAAK  106

Query  353  EFETELKKEP-DSLAQAPSEGVEEI-NQQEKRDATVSSTKEDS  231
            EFETELKK+P DS   AP+E  + + ++ EK++   S T + S
Sbjct  107  EFETELKKDPEDSSKSAPAESPKAVSSEDEKKELETSGTTDSS  149



>ref|XP_004302052.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=150

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  527  ARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEF  348
            +R+   RK  +CN LFGLGVPEL VIAGVAALVFGPKKLPEVG+S+GKT K FQQAAKEF
Sbjct  52   SRTERARKGLTCNALFGLGVPELAVIAGVAALVFGPKKLPEVGKSLGKTIKSFQQAAKEF  111

Query  347  ETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            ETELKKEP+   +  ++    +++++K +  V S++E
Sbjct  112  ETELKKEPEPNTEVLTDEPTTVSEEQKPEVKVPSSQE  148



>ref|XP_010495580.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like, partial [Camelina sativa]
Length=106

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 3/107 (3%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V+ +R  R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K F
Sbjct  1    LVAIRRRIRPEQTRKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSF  60

Query  368  QQAAKEFETELKKEP-DSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            QQAAKEFE+ELK EP DS+    S  V   N++E++ A VSS+  ++
Sbjct  61   QQAAKEFESELKTEPEDSVTD--SSPVAMSNKEEEKKAEVSSSSNEN  105



>ref|XP_010455196.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Camelina sativa]
Length=146

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V+ +R  R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K F
Sbjct  41   LVAIRRRIRPEQTRKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSF  100

Query  368  QQAAKEFETELKKEP-DSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            QQAAKEFE+ELK EP DS+    S  V   N++E++ A VSS+ +++
Sbjct  101  QQAAKEFESELKTEPEDSVTD--SSPVAMSNKEEEKKAEVSSSSKEN  145



>emb|CDX86209.1| BnaA06g29260D [Brassica napus]
Length=144

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  530  AARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKE  351
            A R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKE
Sbjct  44   AIRPEQRRKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKE  103

Query  350  FETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            FE+ELK EP+      S  V   N++E+++   SS+K+++
Sbjct  104  FESELKTEPEDSVAGSSSPVAMSNKEEEKNEVSSSSKDNN  143



>ref|XP_002874447.1| hypothetical protein ARALYDRAFT_489661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50706.1| hypothetical protein ARALYDRAFT_489661 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score =   118 bits (295),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  524  RSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFE  345
            R    RKR +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKEFE
Sbjct  50   RQEPTRKRLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFE  109

Query  344  TELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            +ELK EP+      S+      ++EK+    SS+KE+
Sbjct  110  SELKIEPEDSVADSSQVTMSNKEEEKKTEVSSSSKEN  146



>ref|XP_009151263.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Brassica rapa]
Length=144

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  530  AARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKE  351
            A R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKE
Sbjct  44   AIRPEQRRKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKE  103

Query  350  FETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            FE+ELK EP+      S  V   N++E++    SS+K+++
Sbjct  104  FESELKTEPEDSVAGSSSPVAMSNKEEEKTEVSSSSKDNN  143



>ref|XP_009129537.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like, partial [Brassica rapa]
Length=142

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  530  AARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKE  351
            A R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKE
Sbjct  42   AIRPEQRRKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKE  101

Query  350  FETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            FE+ELK EP+      S  V   N++E++    SS+K+++
Sbjct  102  FESELKTEPEDSVAGSSSPVAMSNKEEEKTEVSSSSKDNN  141



>ref|NP_198227.1| sec-independent protein translocase protein TatA  [Arabidopsis 
thaliana]
 sp|Q9LKU2.1|TATA_ARATH RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG40358.1|AF325006_1 AT5g28750 [Arabidopsis thaliana]
 gb|AAF67362.1| Hypothetical protein T32B20.e [Arabidopsis thaliana]
 gb|AAL07125.1| putative Tha4 protein [Arabidopsis thaliana]
 gb|AAM14368.1| putative Tha4 protein [Arabidopsis thaliana]
 gb|AED93831.1| sec-independent protein translocase protein TatA [Arabidopsis 
thaliana]
Length=147

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V+  R  R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K F
Sbjct  42   LVAIGRRIRQEPTRKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSF  101

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            QQAAKEFE+ELK EP+      S+      ++EK+    SS+KE+
Sbjct  102  QQAAKEFESELKTEPEESVAESSQVATSNKEEEKKTEVSSSSKEN  146



>ref|XP_010421703.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Camelina sativa]
 ref|XP_010421704.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Camelina sativa]
Length=146

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V+ +R  R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K F
Sbjct  41   LVAIRRRIRPEQTRKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSF  100

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            QQAAKEFE+ELK EP+      S       ++EK+    SS+KE+
Sbjct  101  QQAAKEFESELKTEPEDSVTDSSPVAMSNKEEEKKTEISSSSKEN  145



>emb|CDY57016.1| BnaA09g03480D [Brassica napus]
Length=141

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -3

Query  530  AARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKE  351
            A R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKE
Sbjct  43   AIRPEQRRKALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKE  102

Query  350  FETELKKEP-DSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            FE+ELK EP DS+A   S  V   N+ E++    SS+KE+
Sbjct  103  FESELKTEPEDSVAD--SSPVAMSNKAEEKTEVSSSSKEN  140



>ref|XP_008450744.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Cucumis melo]
 ref|XP_008450746.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Cucumis melo]
Length=158

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
             K  +CN LFGLGVPELVVIAGVAALVFGPKKLPEVG+SIGKT K FQQAAKEFE+ELKK
Sbjct  66   HKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKK  125

Query  329  EPDSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            EP+   +   E       ++++D  VS+ KE
Sbjct  126  EPEPTEETSVEKPTSTEAEKRQDLKVSNQKE  156



>ref|XP_009398562.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=146

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 80/110 (73%), Gaps = 7/110 (6%)
 Frame = -3

Query  539  GQRAARSSGGRKR-----FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFK  375
            G RAAR+   R++       C CLFGLGVPELVVIAGVAALVFGPKKLPE+GRS GKT K
Sbjct  37   GGRAARAPLLRRQHGSGALGCRCLFGLGVPELVVIAGVAALVFGPKKLPEIGRSFGKTIK  96

Query  374  GFQQAAKEFETELKKEPDSLAQAPS-EGVEEI-NQQEKRDATVSSTKEDS  231
             FQQAAKEFETELKK+P+  +  PS E  + + ++ +K++   S TK+ +
Sbjct  97   SFQQAAKEFETELKKDPEDSSNPPSVESPKAVSSEDDKKELETSGTKDST  146



>ref|XP_010923487.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Elaeis guineensis]
Length=154

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = -3

Query  554  LRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFK  375
            L +VSG+R   SSGG     C CLFGLGVPELVVIAGVAALVFG K LPE+GRSIGKT K
Sbjct  47   LALVSGRRRKGSSGG---LGCRCLFGLGVPELVVIAGVAALVFGTKNLPEMGRSIGKTVK  103

Query  374  GFQQAAKEFETELKKEPDSLAQ--APSEGVEEINQQEKRDATVSSTKEDS  231
             FQQAAKEFETELKK+ +  ++  +P+E  + ++ ++++ A  +S  E S
Sbjct  104  SFQQAAKEFETELKKDDEDASKPTSPAESPKAVSSEDEKKALEASATEKS  153



>ref|XP_006588399.1| PREDICTED: uncharacterized protein LOC100500409 isoform X1 [Glycine 
max]
Length=136

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = -3

Query  542  SGQRAARSSGGR-KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQ  366
            +  R AR S  R K  +CN LFGLG+PEL VIAGVAAL FGPK LP+VGRS+GKT K FQ
Sbjct  31   ANSRKARISTRRSKALTCNALFGLGLPELAVIAGVAALAFGPKNLPQVGRSLGKTIKSFQ  90

Query  365  QAAKEFETELKKEPDSLAQAPSEGVEEI--NQQEKRDATVSS  246
            QAAKEFE+E+KKEPDS  + P+   + I  ++QE+++  VS+
Sbjct  91   QAAKEFESEIKKEPDSTEENPTAAEKPIAASKQEEQETKVST  132



>gb|KHN16199.1| Sec-independent protein translocase protein TatA [Glycine soja]
Length=139

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = -3

Query  542  SGQRAARSSGGR-KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQ  366
            +  R AR S  R K  +CN LFGLG+PEL VIAGVAAL FGPK LP+VGRS+GKT K FQ
Sbjct  34   ANSRKARISTRRSKALTCNALFGLGLPELAVIAGVAALAFGPKNLPQVGRSLGKTIKSFQ  93

Query  365  QAAKEFETELKKEPDSLAQAPSEGVEEI--NQQEKRDATVSS  246
            QAAKEFE+E+KKEPDS  + P+   + I  ++QE+++  VS+
Sbjct  94   QAAKEFESEIKKEPDSTEENPTAAEKPIAASKQEEQETKVST  135



>ref|XP_009111899.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Brassica rapa]
Length=141

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = -3

Query  530  AARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKE  351
            A R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKE
Sbjct  43   AIRPEQRRKALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKE  102

Query  350  FETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            FE+ELK EP+    A S  V   N+ E++    SS+KE+
Sbjct  103  FESELKTEPEETV-ADSSTVAMSNKAEEKTEVSSSSKEN  140



>emb|CDY00023.1| BnaC09g02780D [Brassica napus]
Length=142

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 3/93 (3%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKEFE+ELK 
Sbjct  51   RKALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  110

Query  329  EP-DSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            EP DS+A   S  V   N+ E++   +SS+KE+
Sbjct  111  EPEDSVAG--SSPVAMSNKAEEKTEVLSSSKEN  141



>ref|XP_006288854.1| hypothetical protein CARUB_v10002208mg [Capsella rubella]
 gb|EOA21752.1| hypothetical protein CARUB_v10002208mg [Capsella rubella]
Length=146

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V+ +   R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K F
Sbjct  41   LVAIRPKIRPEQTRKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSF  100

Query  368  QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            QQAAKEFE+ELK EP+      S       ++EK++   SS+KE+
Sbjct  101  QQAAKEFESELKTEPEDSVTDSSPVAMSNKEEEKKNEVSSSSKEN  145



>emb|CDY48664.1| BnaC07g27450D [Brassica napus]
Length=146

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 77/103 (75%), Gaps = 4/103 (4%)
 Frame = -3

Query  530  AARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKE  351
            A R    RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKE
Sbjct  44   AIRPEQRRKSLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKE  103

Query  350  FETELKKEP---DSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            FE+ELK EP   DS+A + S  V   N++E++    SS+K+++
Sbjct  104  FESELKTEPEPEDSVAGS-SSPVAMSNKEEEKTEVSSSSKDNN  145



>gb|KFK31934.1| hypothetical protein AALP_AA6G178200 [Arabis alpina]
Length=135

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 7/93 (8%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            RK  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKEFE+ELK 
Sbjct  48   RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT  107

Query  329  EP-DSLAQAPSEGVEEINQQEKRDATVSSTKED  234
            EP DS+  A S      NQ++++    SS+KE+
Sbjct  108  EPEDSVPVATS------NQEDEKTEVSSSSKEN  134



>ref|XP_006650323.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Oryza brachyantha]
Length=93

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD--  321
            C CLFGLGVPELVVIAGVAALVFGPK+LPE+GRSIGKT K FQQAAKEFETELKKEP+  
Sbjct  3    CKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPEDG  62

Query  320  -SLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
                  P++     + +EK +   SS+KE +
Sbjct  63   GDQPPPPTQTAVSDDGEEKEELEASSSKEST  93



>ref|XP_010936083.1| PREDICTED: LOW QUALITY PROTEIN: sec-independent protein translocase 
protein TATA, chloroplastic-like [Elaeis guineensis]
Length=153

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 73/99 (74%), Gaps = 6/99 (6%)
 Frame = -3

Query  518  SGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETE  339
            SGG     C CLFGLGVPELVVIAGVAALVFGPKKLPE+GRSIGKT K FQQAAKEFETE
Sbjct  58   SGG---LGCRCLFGLGVPELVVIAGVAALVFGPKKLPEIGRSIGKTVKSFQQAAKEFETE  114

Query  338  LKK--EPDSLAQAPSEGVEEI-NQQEKRDATVSSTKEDS  231
            LKK  E  S    P+E  + + ++ EK++   S TKE S
Sbjct  115  LKKDGEDASKPPPPAESPKAVSSEDEKKELEASGTKETS  153



>gb|EEC75796.1| hypothetical protein OsI_12727 [Oryza sativa Indica Group]
Length=171

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD--  321
            C CLFGLGVPELVVIAGVAALVFGPK+LPE+GRSIGKT K FQQAAKEFETELKKE D  
Sbjct  81   CKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKESDDG  140

Query  320  -SLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
                  P+E       +EK++   SS+KE +
Sbjct  141  GDQPPPPTETAVSDGGEEKKELEASSSKEST  171



>ref|XP_006838884.1| hypothetical protein AMTR_s00002p00267770 [Amborella trichopoda]
 gb|ERN01453.1| hypothetical protein AMTR_s00002p00267770 [Amborella trichopoda]
Length=140

 Score =   112 bits (281),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  524  RSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFE  345
            R S G    +C CLFGLGVPELVVIAGVAA+VFGPKKLPEVGRSIGKT + FQQAAKEFE
Sbjct  48   RRSHGNAGLNCRCLFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVRSFQQAAKEFE  107

Query  344  TELKKEPDSLAQAP  303
            TELKK+ +++ + P
Sbjct  108  TELKKDKETIEEPP  121



>ref|NP_001237608.1| uncharacterized protein LOC100500409 [Glycine max]
 gb|ACU15483.1| unknown [Glycine max]
Length=138

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 3/97 (3%)
 Frame = -3

Query  542  SGQRAARSSGGR-KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQ  366
            +  R AR S  R K  +CN LFGLG+PEL VIAGVAAL FGPK LP+VGRS+GKT K FQ
Sbjct  31   ANSRKARISTRRSKALTCNALFGLGLPELAVIAGVAALAFGPKNLPQVGRSLGKTIKSFQ  90

Query  365  QAAKEFETELKKEPDSLAQAPSEGVEEI--NQQEKRD  261
            QAAKEFE+E+KKEPDS  + P+   + I  ++QE+++
Sbjct  91   QAAKEFESEIKKEPDSTEENPTAAEKPIAASKQEEQE  127



>ref|XP_009399359.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009399360.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=153

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEP-DS  318
            C C+FGLGVPELVVIAGV ALVFGPKKLPE+GRS GKT K FQQAAKEFETELKK P DS
Sbjct  63   CRCMFGLGVPELVVIAGVTALVFGPKKLPEIGRSFGKTVKSFQQAAKEFETELKKGPEDS  122

Query  317  LAQAPSEGVEE-INQQEKRDATVSSTKEDS  231
                P+E +++ ++ +E+++   S  KE S
Sbjct  123  SKSPPAESLDKAMSSEEEKELETSGGKESS  152



>ref|XP_008788140.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Phoenix dactylifera]
Length=153

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK--EPD  321
            C CLFGLGVPELVVIAGVAALVFGPKKLPE+GRSIGKT K FQ+AAKEFETELKK  E  
Sbjct  63   CRCLFGLGVPELVVIAGVAALVFGPKKLPEIGRSIGKTVKSFQEAAKEFETELKKDGEDA  122

Query  320  SLAQAPSEGVEEI-NQQEKRDATVSSTKEDS  231
            S    P+E  + + ++ EK++   S TKE S
Sbjct  123  SKPPPPAESPKVVSSEDEKKELEASGTKESS  153



>ref|XP_006395030.1| hypothetical protein EUTSA_v10005085mg [Eutrema salsugineum]
 gb|ESQ32316.1| hypothetical protein EUTSA_v10005085mg [Eutrema salsugineum]
Length=145

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -3

Query  506  KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            K  +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+SIGKT K FQQAAKEFE+ELK E
Sbjct  55   KPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKTE  114

Query  326  P-DSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
            P DS+A +       ++++E+    VSS+ +DS
Sbjct  115  PEDSVADS---SPVAMSKKEEEKTEVSSSSKDS  144



>ref|NP_001050716.1| Os03g0634000 [Oryza sativa Japonica Group]
 sp|Q75GK3.1|TATA_ORYSJ RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|AAS07275.1| putative sec-independent protein transporter [Oryza sativa Japonica 
Group]
 gb|ABF97773.1| twin-arginine translocation protein, TatA/E family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12630.1| Os03g0634000 [Oryza sativa Japonica Group]
 dbj|BAG88816.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59547.1| hypothetical protein OsJ_11824 [Oryza sativa Japonica Group]
Length=170

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            C CLFGLGVPELVVIAGVAALVFGPK+LPE+GRSIGKT K FQQAAKEFETELKKE D  
Sbjct  81   CKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKESDDG  140

Query  314  AQAPSEGVEEINQQ--EKRDATVSSTKEDS  231
               P    E       E+++   SS+KE +
Sbjct  141  GDQPPPPTETAVSDGGEEKELEASSSKEST  170



>ref|XP_010528803.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Tarenaya hassleriana]
Length=151

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +K F+C  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT + FQ+AAKEFE+ELKK
Sbjct  59   KKGFTCYALFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTVRSFQEAAKEFESELKK  118

Query  329  EP-DSLAQAPSEGVEEINQQEKRDATVSS  246
            EP ++LA    +  + ++  ++++   SS
Sbjct  119  EPAEALADGEGDKPKAVSNDQRQEGAPSS  147



>gb|ACN32121.1| unknown [Zea mays]
 tpg|DAA50382.1| TPA: thylakoid assembly4 [Zea mays]
Length=170

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEP-DS  318
            C CLFGLGVPEL VIAGVAALVFGPK+LPE+GRSIGKT K FQQAAKEFETELKKEP + 
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPGEG  141

Query  317  LAQAPSEGVEEINQQEKRDATVSSTKEDS  231
              Q P      ++  E++    SS+KE +
Sbjct  142  GDQPPPATPTAVSGGEEKGLEASSSKESA  170



>ref|NP_001104942.1| sec-independent protein translocase protein TATA, chloroplastic 
[Zea mays]
 sp|Q9XFJ8.1|TATA_MAIZE RecName: Full=Sec-independent protein translocase protein TATA, 
chloroplastic; AltName: Full=Protein THYLAKOID ASSEMBLY 4; 
AltName: Full=Protein TWIN-ARGININE TRANSLOCATION A; Flags: 
Precursor [Zea mays]
 gb|AAD31522.1|AF145755_1 THA4 [Zea mays]
Length=170

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEP-DS  318
            C CLFGLGVPEL VIAGVAALVFGPK+LPE+GRSIGKT K FQQAAKEFETELKKEP + 
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPGEG  141

Query  317  LAQAPSEGVEEINQQEKRDATVSSTKEDS  231
              Q P      ++  E++    SS+KE +
Sbjct  142  GDQPPPATPTAVSGGEEKGLEASSSKESA  170



>emb|CDY05605.1| BnaC02g39320D [Brassica napus]
Length=147

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = -3

Query  530  AARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKE  351
            A R    R   +CN LFGLGVPEL VIAGVAAL+FGPKKLPE+G+S+GKT K FQQAAKE
Sbjct  43   AFRPEQRRNALTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSLGKTVKSFQQAAKE  102

Query  350  FETELKKEP-DSLAQAPSEGVEEINQQEKRDATVSSTKE  237
            FE+ELK EP DS+A   S  +   N+ E++    SS+K+
Sbjct  103  FESELKTEPEDSVAD--SSPIAMSNKAEEKPEVSSSSKD  139



>ref|NP_001150512.1| THA4 [Zea mays]
 gb|ACG39360.1| THA4 [Zea mays]
Length=170

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEP-DS  318
            C CLFGLGVPEL VIAGVAALVFGPK+LPE+GRSIGKT K FQQAAKEFETELKKEP + 
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFETELKKEPGEG  141

Query  317  LAQAPSEGVEEINQQEKRDATVSSTKEDS  231
              Q P      ++  E +    SS+KE +
Sbjct  142  GDQPPPATPTAVSGGEDKGLEASSSKESA  170



>gb|EYU22665.1| hypothetical protein MIMGU_mgv1a016077mg [Erythranthe guttata]
Length=135

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            ++  SCNCLFGLGVPE+ VIAGV ALVFGPKKLPEVGRSIGKT KGFQQAAKEFETELK 
Sbjct  53   KRGLSCNCLFGLGVPEIAVIAGVVALVFGPKKLPEVGRSIGKTLKGFQQAAKEFETELKS  112

Query  329  EPDSLAQAPSEGVEE  285
            + +  A+  +   EE
Sbjct  113  DVEPSAEKITTVAEE  127



>ref|XP_004982373.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Setaria italica]
Length=170

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            C CLFGLGVPELVVIAGVAALVFGPK+LPE+GR+IGKT K FQQAAKEFETELKKEP   
Sbjct  80   CKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRNIGKTVKSFQQAAKEFETELKKEPGEG  139

Query  314  AQAPSEGVEEI--NQQEKRDATVSSTKEDS  231
               P         + +EK+    SS+ ++S
Sbjct  140  GDQPPPATPTAVGDGEEKKGLEASSSSKES  169



>gb|EPS74317.1| hypothetical protein M569_00442, partial [Genlisea aurea]
Length=111

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            FSCNCLFGLGVPELVVIAGVAALVFGPKKLPE+G+SIG+T K FQQAAKEFE+ELKK+
Sbjct  42   FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEIGKSIGRTVKSFQQAAKEFESELKKD  99



>ref|XP_002464206.1| hypothetical protein SORBIDRAFT_01g014100 [Sorghum bicolor]
 gb|EER91204.1| hypothetical protein SORBIDRAFT_01g014100 [Sorghum bicolor]
Length=173

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEP-  324
              C CLFGLGVPEL VIAGVAALVFGPK+LPE+GRSIGKT K FQQAAKEFE+ELKKEP 
Sbjct  82   LGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFESELKKEPG  141

Query  323  DSLAQAPSEGVEEIN-QQEKRDATVSSTKEDS  231
            +   Q P      ++  +EK+    SS+KE +
Sbjct  142  EGDDQPPPATPAAVSGGEEKKGLEASSSKEST  173



>ref|XP_008786083.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Phoenix dactylifera]
Length=156

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 7/91 (8%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE------P  324
            LFGLGVPELVVIAGVAALVFGPKKLPE+GRSIGKT K FQQAAKEFETELKK+      P
Sbjct  67   LFGLGVPELVVIAGVAALVFGPKKLPEIGRSIGKTAKSFQQAAKEFETELKKDDEDATKP  126

Query  323  DSLAQAPSEGVEEINQQEKRDATVSSTKEDS  231
               A++P + V   +++E+ +A+ S TK+ S
Sbjct  127  TPPAESP-QVVSSEDEKEEMEASGSGTKKSS  156



>gb|EMS64861.1| CBL-interacting protein kinase 7 [Triticum urartu]
Length=354

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  524  RSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFE  345
            R+  G     C CLFGLGVPE+VVIAGVAAL+FGPK+LPE+GRS+GKT K FQQAAKEFE
Sbjct  267  RTGAGGGALGCKCLFGLGVPEMVVIAGVAALLFGPKQLPEIGRSVGKTVKSFQQAAKEFE  326

Query  344  TELKKEP  324
            TELKKEP
Sbjct  327  TELKKEP  333



>gb|ACG40026.1| THA4 [Zea mays]
Length=161

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -3

Query  533  RAARSSGGRK-RFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            R  R+  GR     C CLFGLGVPEL VIAGVAALVFGPK+LPE+GRS+GKT K FQ+AA
Sbjct  58   RPRRAGSGRDGALGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSLGKTVKSFQEAA  117

Query  356  KEFETELKKEP  324
            KEFE+ELKKEP
Sbjct  118  KEFESELKKEP  128



>ref|NP_001104943.1| tha9 protein [Zea mays]
 gb|AAD31523.1|AF145756_1 THA9 [Zea mays]
 gb|AFW68189.1| THA9 [Zea mays]
Length=169

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  533  RAARSSGGR-KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAA  357
            R  R+  GR     C CLFGLGVPEL VIAGVAALVFGPK+LPE+GRS+GKT K FQ+AA
Sbjct  58   RPRRAGSGRGDALGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSLGKTVKSFQEAA  117

Query  356  KEFETELKKEPDSLAQAP  303
            KEFE+ELKKEP      P
Sbjct  118  KEFESELKKEPGEGGDQP  135



>ref|XP_010674831.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=149

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 61/84 (73%), Gaps = 6/84 (7%)
 Frame = -3

Query  563  GAGLRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGK  384
            G GLR     R   +   RK  +CN LFGLGVPEL VIAGVAALVFGPK+LPE+GR+ GK
Sbjct  42   GLGLRA----RVRPAYRARKGLTCNSLFGLGVPELAVIAGVAALVFGPKQLPEIGRNFGK  97

Query  383  TFKGFQQAAKEFETELKK--EPDS  318
            T K FQQAAKEFE EL K  EP+S
Sbjct  98   TIKSFQQAAKEFEQELTKPEEPES  121



>ref|XP_003562204.2| PREDICTED: CBL-interacting protein kinase 7-like [Brachypodium 
distachyon]
Length=536

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            C CLFGLGVPE+VVIAGVAAL+FGPK+LPE+GRS+GKT K FQQAAKEFE+ELKKEP+  
Sbjct  446  CKCLFGLGVPEMVVIAGVAALLFGPKQLPEIGRSVGKTVKSFQQAAKEFESELKKEPEDG  505

Query  314  AQAP  303
               P
Sbjct  506  GDQP  509



>gb|ABK21127.1| unknown [Picea sitchensis]
Length=146

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -3

Query  491  NCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
              LFGLGVPEL VIAGVAAL+FGPKKLPE+G+S+GKT K FQ+AAKEFETE+KKE
Sbjct  65   TALFGLGVPELAVIAGVAALIFGPKKLPEIGKSLGKTVKSFQEAAKEFETEVKKE  119



>ref|XP_002987256.1| hypothetical protein SELMODRAFT_125456 [Selaginella moellendorffii]
 gb|EFJ11832.1| hypothetical protein SELMODRAFT_125456 [Selaginella moellendorffii]
Length=95

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 9/71 (13%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            M++ +R AR            LFGLGVPELVVIAGVAALVFGPKKLPE+G+S+GKT K F
Sbjct  1    MLATRRTAR---------VMALFGLGVPELVVIAGVAALVFGPKKLPEIGKSLGKTVKSF  51

Query  368  QQAAKEFETEL  336
            QQAA EF+TEL
Sbjct  52   QQAADEFQTEL  62



>gb|KEH43019.1| twin arginine translocase [Medicago truncatula]
Length=107

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = -3

Query  566  NGAGLRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIG  387
            N   L +   +   RS+   KRF+CN  FGLGVPELVVIAGVAALVFGPKKLPEVGRSIG
Sbjct  36   NTTSLLLKKARTRTRST---KRFTCNAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIG  92

Query  386  KTFKGFQQ  363
            KT K FQQ
Sbjct  93   KTVKSFQQ  100



>ref|XP_002976419.1| hypothetical protein SELMODRAFT_267974 [Selaginella moellendorffii]
 gb|EFJ22679.1| hypothetical protein SELMODRAFT_267974 [Selaginella moellendorffii]
Length=156

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 13/104 (13%)
 Frame = -3

Query  560  AGLRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKT  381
            +G  M++ +R AR            LFGLGVPELVVIAGVAALVFGPKKLPE+G+S+GKT
Sbjct  58   SGNSMLATRRTAR---------VMALFGLGVPELVVIAGVAALVFGPKKLPEIGKSLGKT  108

Query  380  FKGFQQAAKEFETEL--KKEPDSLAQAP--SEGVEEINQQEKRD  261
             K FQQAA EF+TEL  KK  +   + P  SE  E + +   ++
Sbjct  109  VKSFQQAADEFQTELTAKKSAEEEEKVPGSSEETEAVKKTTAKE  152



>gb|KIZ03129.1| hypothetical protein MNEG_4832 [Monoraphidium neglectum]
Length=143

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            ++  +C  LFGLGVPELVVIAGVAALVFGP KLPE+G+ +GKT K FQ AAKEFETELK+
Sbjct  57   QRTVACRGLFGLGVPELVVIAGVAALVFGPSKLPELGKGLGKTVKSFQTAAKEFETELKQ  116



>ref|XP_008804879.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like [Phoenix dactylifera]
Length=144

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  482  FGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQAP  303
            FGLGVPE+ VIAGVAALVFGP ++P VG+S GKT K FQQAAKEFE ELKKE + + ++P
Sbjct  59   FGLGVPEVAVIAGVAALVFGPSQIPVVGQSFGKTIKSFQQAAKEFEAELKKETEDVRESP  118

Query  302  S-EGVEEIN-QQEKRDATVSSTKEDS  231
            + E  + IN   +K +   S+TKE +
Sbjct  119  AIEAQKVINSNDDKMELKPSATKESA  144



>ref|XP_006382793.1| hypothetical protein POPTR_0005s05490g, partial [Populus trichocarpa]
 gb|ERP60590.1| hypothetical protein POPTR_0005s05490g, partial [Populus trichocarpa]
Length=127

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -3

Query  548  MVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGF  369
            +V G+  +RS   +K  +CN LFGLGVPELVVIAGVA L+FGPK+LPEVGRSIGKT K F
Sbjct  43   LVLGKTRSRSQRAKKGLTCNALFGLGVPELVVIAGVATLLFGPKQLPEVGRSIGKTVKSF  102

Query  368  QQAAKEF  348
            QQ +  F
Sbjct  103  QQVSGSF  109



>gb|EYU30524.1| hypothetical protein MIMGU_mgv1a0158101mg, partial [Erythranthe 
guttata]
Length=102

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = -3

Query  536  QRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQ  363
             R  RS+  R  FSCNCLFGLGVPELVVIAGVA ++FGPK+LPEVGRSIGKT K FQQ
Sbjct  47   DRPRRSN--RNGFSCNCLFGLGVPELVVIAGVAVILFGPKQLPEVGRSIGKTVKSFQQ  102



>ref|XP_002500552.1| twin arginine targeting family [Micromonas sp. RCC299]
 gb|ACO61810.1| twin arginine targeting family [Micromonas sp. RCC299]
Length=144

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = -3

Query  551  RMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKG  372
            ++ +G  A RS  G +  +   LFGLG+PELVVI GVAA++FGP KLPE+G+S+GKT K 
Sbjct  51   QLSAGITAGRSGAGTRSVATMGLFGLGLPELVVIGGVAAVLFGPSKLPELGKSLGKTVKS  110

Query  371  FQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRD  261
            FQ AA EF+ ELK + +   Q P    ++I + EK+ 
Sbjct  111  FQAAANEFQDELKSDKEGEEQPP----KQIEEGEKKS  143



>ref|XP_001768091.1| predicted protein [Physcomitrella patens]
 gb|EDQ67163.1| predicted protein [Physcomitrella patens]
Length=171

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 9/94 (10%)
 Frame = -3

Query  503  RFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEP  324
            RF    LFGLGVPEL VIAGVAALVFGPK+LP +G+S+GKT K FQ AAKEFE+E+ K  
Sbjct  78   RFEVCGLFGLGVPELAVIAGVAALVFGPKQLPAIGKSLGKTVKSFQTAAKEFESEISKAK  137

Query  323  DS---------LAQAPSEGVEEINQQEKRDATVS  249
            +S         + + P EGV    +  + D+  S
Sbjct  138  ESGEEGQDSTAVGETPKEGVVTSPKNSETDSNSS  171



>gb|KEH24554.1| twin arginine translocase [Medicago truncatula]
Length=121

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD  321
            F+CN LFGLGVPELVVIAGVAA+VFGPKKLPEVGRSIGKT K FQQ       E + + +
Sbjct  55   FTCNALFGLGVPELVVIAGVAAIVFGPKKLPEVGRSIGKTVKSFQQTKWRIPFETRTQLE  114

Query  320  S  318
            S
Sbjct  115  S  115



>ref|WP_015167027.1| twin arginine-targeting protein translocase, TatA/E family [Synechococcus 
sp. PCC 7502]
 gb|AFY72368.1| twin arginine-targeting protein translocase, TatA/E family [Synechococcus 
sp. PCC 7502]
Length=90

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FGLG+PE++VI GVA L+FGPKKLPE+GRS+GKT KGFQ A+++F+ E  KE + L + 
Sbjct  3    IFGLGLPEMIVIMGVALLIFGPKKLPEIGRSVGKTIKGFQDASRDFQAEFTKEVEQLEKV  62

Query  305  P  303
            P
Sbjct  63   P  63



>ref|XP_001690564.1| TatA-like sec-independent protein translocator subunit [Chlamydomonas 
reinhardtii]
 gb|EDP05823.1| TatA-like sec-independent protein translocator subunit [Chlamydomonas 
reinhardtii]
Length=114

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  551  RMVSGQRAARSSGGRKR-FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFK  375
            R V     ARSS  R R  +C  LFGLG+PE+ VIAGVAAL+FGP KLPE+G+S+GKT K
Sbjct  19   RRVVAPIPARSSIARSRQVACQGLFGLGLPEVAVIAGVAALIFGPSKLPELGKSLGKTVK  78

Query  374  GFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQEK  267
             FQ AA EF  ELK    +        VEE  ++ K
Sbjct  79   SFQTAASEFNDELKAGMAADDAKKPAAVEEKKEETK  114



>ref|XP_001774935.1| predicted protein [Physcomitrella patens]
 gb|AAS47587.1| chloroplast Tha4-2 [Physcomitrella patens]
 gb|EDQ60201.1| predicted protein [Physcomitrella patens]
Length=159

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  500  FSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            F    LFGLGVPEL VIAGVAAL+FGPK+LP++G+ +G+T   FQQAAKEFETE+KK+
Sbjct  72   FVVRGLFGLGVPELAVIAGVAALLFGPKQLPQIGKKLGQTVTSFQQAAKEFETEVKKD  129



>ref|WP_019502800.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=82

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 2/78 (3%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE++VI  VA L+FGPKKLPE+GRS+GK  KGFQ A++EFE+E K+E + L ++
Sbjct  3    IFGIGLPEMIVIMVVALLIFGPKKLPEIGRSVGKAIKGFQDASREFESEFKREAELLEES  62

Query  305  --PSEGVEEINQQEKRDA  258
              PS  VE  ++  K  A
Sbjct  63   TKPSTTVETSSESSKPSA  80



>ref|WP_006512458.1| twin arginine-targeting protein translocase, TatA/E family [Xenococcus 
sp. PCC 7305]
 gb|ELS00305.1| twin arginine-targeting protein translocase, TatA/E family [Xenococcus 
sp. PCC 7305]
Length=93

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VIA +A LVFGPKKLPE+GRS+GK+ + FQ+A+KEFETELKKE   + ++
Sbjct  3    VFGIGLPEMAVIAVIALLVFGPKKLPEIGRSLGKSLRSFQEASKEFETELKKEAQKMEES  62



>gb|AAS47586.1| chloroplast Tha4-1 [Physcomitrella patens]
Length=164

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = -3

Query  503  RFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEP  324
            RF    LFGLGVPEL VIAGVAALVFGPK+LP +G+S+GKT K FQ AAKEFE+E+ K  
Sbjct  78   RFEVCGLFGLGVPELAVIAGVAALVFGPKQLPAIGKSLGKTVKSFQTAAKEFESEISKAK  137

Query  323  DS---------LAQAPSEGV  291
            +S         + + P EGV
Sbjct  138  ESGEEGQDSTAVGETPKEGV  157



>ref|WP_039895374.1| preprotein translocase subunit TatA [Lyngbya sp. PCC 8106]
Length=86

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  488  CLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ  309
             +FG+G+PE+ VI  +A L+FGPKKLPE+GRS+GK  +GFQ+A+KEFE E K+E   L +
Sbjct  2    SIFGMGLPEIAVILVLALLIFGPKKLPEIGRSMGKAIRGFQEASKEFENEFKREAKQLEE  61

Query  308  APSEGVEEINQQEKRDATVSSTKE  237
            A        +Q EK   TV+ST E
Sbjct  62   ATKMSK---SQPEKAMTTVASTDE  82



>ref|WP_017296345.1| hypothetical protein [Geminocystis herdmanii]
Length=87

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+++I  VA L+FGPKKLPE+GRS+GKT KGFQ+A+KEF+ E KKE + + +A
Sbjct  3    VFGIGLPEMILIFVVALLIFGPKKLPEIGRSLGKTIKGFQEASKEFQEEFKKEVEQVEEA  62

Query  305  PSEGVE-EINQQEKRDATVSSTKED  234
             S   + E +Q ++++ T +   E+
Sbjct  63   VSMNAKLEPSQNQEKETTSAKVIEN  87



>ref|WP_011127144.1| primosome subunit DnaD [Synechococcus sp. WH 8102]
 emb|CAE06785.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=77

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K      Q 
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPEQL  62

Query  305  PSEGVEEINQQEKRD  261
            PS  VE  N +   D
Sbjct  63   PSSDVEASNAKPSND  77



>ref|WP_036913569.1| MULTISPECIES: preprotein translocase subunit TatA [Prochlorococcus]
 gb|KGG26560.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
MIT 0701]
 gb|KGG30115.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
MIT 0702]
 gb|KGG33228.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
MIT 0703]
Length=91

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 6/82 (7%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  +A LVFGPK+LPE GR++GKT KGFQ A+KEFE E+ K   EP+S+
Sbjct  3    VFGIGLPEMAVIGAIALLVFGPKRLPEFGRTLGKTLKGFQAASKEFEREIHKTMAEPESI  62

Query  314  AQAPSEGVEEINQQEKRDATVS  249
             QA     EE  QQ+  + + S
Sbjct  63   EQA---ATEESTQQDSNEISES  81



>ref|WP_011827044.1| preprotein translocase subunit TatA [Prochlorococcus marinus]
 gb|ABM79192.1| mttA/Hcf106 family protein [Prochlorococcus marinus str. MIT 
9303]
Length=91

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 8/88 (9%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  +A LVFGPK+LPE GR++GKT KGFQ A+KEFE E+ K   EP+S+
Sbjct  3    VFGIGLPEMAVIGAIALLVFGPKRLPEFGRTLGKTLKGFQAASKEFEREIHKTMAEPESI  62

Query  314  AQAPSEGVEEINQQEKRDATVSSTKEDS  231
             QA     EE  QQ+     +S T +++
Sbjct  63   EQA---ATEEFKQQDTN--AISETPQEA  85



>ref|WP_002735474.1| MULTISPECIES: primosome subunit DnaD [Microcystis]
 emb|CCH93470.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9432]
 emb|CCI13596.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9806]
 emb|CCI31330.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
sp. T1-4]
 gb|ELP53414.1| twin arginine-targeting translocase, TatA/E family protein [Microcystis 
aeruginosa TAIHU98]
Length=82

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GKT +GFQ+A+KEFE+E K+E   +  +
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQIEDS  62

Query  305  PSEGVEEINQQEKRDATVSS  246
                 E    Q  RD T SS
Sbjct  63   VKIKAELEESQSTRDQTRSS  82



>ref|WP_015188791.1| Sec-independent protein translocase TatA [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30919.1| Sec-independent protein translocase TatA [Gloeocapsa sp. PCC 
7428]
Length=90

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 4/89 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GK  +GFQ+A+KEFE E K+E + + QA
Sbjct  3    IFGIGLPEMAVIMIVALLIFGPKKLPEIGRSMGKAVRGFQEASKEFENEFKREAEQIEQA  62

Query  305  PSEGVEEINQQEKRDATVSSTKEDS*TAT  219
                V+   Q E +    +   E++ T++
Sbjct  63   ----VQTTAQLEPKQIAAAEASENNTTSS  87



>ref|WP_011243599.1| MULTISPECIES: preprotein translocase subunit TatA [Synechococcus]
 sp|Q5N2J3.1|TATA_SYNP6 RecName: Full=Sec-independent protein translocase protein TatA 
[Synechococcus elongatus PCC 6301]
 sp|Q31RR1.1|TATA_SYNE7 RecName: Full=Sec-independent protein translocase protein TatA 
[Synechococcus elongatus PCC 7942]
 dbj|BAD79477.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB56258.1| Sec-independent protein translocase TatA [Synechococcus elongatus 
PCC 7942]
 gb|AJD56693.1| preprotein translocase subunit TatA [Synechococcus sp. UTEX 2973]
Length=91

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
             FG+G+PE++VI  +A LVFGPKKLPE+GRS+GK  +GFQ A++EFE+E+K+E D     
Sbjct  3    FFGIGLPEMLVILAIALLVFGPKKLPEIGRSLGKALRGFQDASREFESEIKREIDRTPAT  62

Query  305  PSEGVEE  285
            P+E   E
Sbjct  63   PAEATVE  69



>ref|WP_002762408.1| primosome subunit DnaD [Microcystis aeruginosa]
 emb|CCH99140.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI22743.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9809]
Length=82

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GKT +GFQ+A+KEFE+E K+E + +  +
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAEQIEDS  62

Query  305  PSEGVEEINQQEKRDATVSS  246
                 E    Q  RD T SS
Sbjct  63   VKIKAELEESQSPRDQTRSS  82



>ref|WP_036531210.1| preprotein translocase subunit TatA [Neosynechococcus sphagnicola]
 gb|KGF73481.1| hypothetical protein DO97_18365 [Neosynechococcus sphagnicola 
sy1]
Length=115

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ+A+KEFETE K+E D L   
Sbjct  3    VFGIGLPEMALIMVLALLVFGPKKLPEIGRSMGKAIRGFQEASKEFETEFKREADRLESV  62

Query  305  PSEGV  291
            P E +
Sbjct  63   PPEPM  67



>emb|CAO89342.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
Length=121

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GKT +GFQ+A+KEFE+E K+E   +  +
Sbjct  42   IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQIEDS  101

Query  305  PSEGVEEINQQEKRDATVSS  246
                 E    Q  RD T SS
Sbjct  102  VKIKAELEESQSPRDQTRSS  121



>gb|ELS32305.1| Sec-independent protein translocase protein tatA/E-like protein 
[Pseudanabaena biceps PCC 7429]
Length=107

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ-  309
            +FG+G+PE+++I  VA L+FGPKKLPE+GRS+GK  KGFQ A++EFE+E K+E + L Q 
Sbjct  3    IFGIGLPEMILIMLVALLIFGPKKLPEIGRSMGKAIKGFQDASREFESEFKREAERLEQP  62

Query  308  ------APSEGVEEINQQEKRDATVSS  246
                  AP+     ++ Q    A+V++
Sbjct  63   TTTAESAPATSSATVSSQSPEAASVAA  89



>ref|WP_023067361.1| twin arginine-targeting translocase, TatA/E family protein [Lyngbya 
aestuarii]
 gb|ERT06391.1| twin arginine-targeting translocase, TatA/E family protein [Lyngbya 
aestuarii BL J]
Length=85

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  +A L+FGPKKLPE+GRS+GK  +GFQ+A+KEFE E K+E   L +A
Sbjct  3    IFGIGLPEMAVILVLALLIFGPKKLPEIGRSMGKAIRGFQEASKEFENEFKREAKQLEEA  62

Query  305  PSEGVEEINQQEKRDATVSSTKE  237
                      Q ++  TV+ST E
Sbjct  63   TKTS----KSQPEKTMTVASTDE  81



>ref|WP_015218443.1| Sec-independent protein translocase TatA [Cyanobacterium aponinum]
 gb|AFZ52712.1| Sec-independent protein translocase TatA [Cyanobacterium aponinum 
PCC 10605]
Length=89

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+++I  VA L+FGPKKLPE+G+S+GKT KGFQ+A+KEF+ E KKE + + + 
Sbjct  3    VFGIGLPEMILIFVVALLIFGPKKLPEIGKSLGKTLKGFQEASKEFQEEFKKEAEKIEET  62

Query  305  PSEGVEEINQQEKRDATVSST  243
             S   +  + +E  +  V+S+
Sbjct  63   VSMKAQLESSKETEENVVNSS  83



>ref|WP_002743526.1| primosome subunit DnaD [Microcystis aeruginosa]
 emb|CCI09330.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 7941]
 emb|CCI16179.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9807]
 emb|CCI27315.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI38137.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELS48172.1| twin arginine-targeting translocase, TatA/E family protein [Microcystis 
aeruginosa DIANCHI905]
 gb|EPF17324.1| Sec-independent protein translocase protein TatAd [Microcystis 
aeruginosa SPC777]
Length=82

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GKT +GFQ+A+KEFE+E K+E   +  +
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQIEDS  62

Query  305  PSEGVEEINQQEKRDATVSS  246
                 E    Q  RD T SS
Sbjct  63   VKIKAELEESQSPRDQTRSS  82



>ref|WP_036486219.1| preprotein translocase subunit SecA [Myxosarcina sp. GI1]
Length=98

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL---  315
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  +GFQ A+KEFETE K+E   L   
Sbjct  3    IFGIGLPEMALIMVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFETEFKREAQQLEKS  62

Query  314  ----AQAPSEGVEEINQQEKRDATVSSTKED  234
                A+  S+  E+    + ++A  S++  +
Sbjct  63   VKMHAELESDSEEQTQSSKSQEAEYSTSHNE  93



>ref|WP_013191028.1| primosome subunit DnaD [Trichormus azollae]
 gb|ADI64011.1| twin-arginine translocation protein, TatA/E family subunit ['Nostoc 
azollae' 0708]
Length=90

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF+ E K+E + + QA
Sbjct  3    IFGIGLPEMAIIMVVAVLIFGPKKLPEIGRSLGKTIRSFQEASNEFQNEFKREAEQIGQA  62

Query  305  PSEGVEEINQQEKRDATVSSTKEDS*TATAT  213
                V+   + E +    + +++D+  +TAT
Sbjct  63   ----VKTTAEIESKQIESAKSQQDNAGSTAT  89



>ref|WP_002765259.1| primosome subunit DnaD [Microcystis aeruginosa]
 emb|CCI05126.1| Sec-independent protein translocase protein tatA/E homolog [Microcystis 
aeruginosa PCC 9443]
Length=82

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GKT +GFQ+A+KEFE+E K+E   +  +
Sbjct  3    IFGIGLPEMGLIFLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQIEDS  62

Query  305  PSEGVEEINQQEKRDATVSS  246
                 E    Q  RD T SS
Sbjct  63   VKIKAELEESQSPRDQTRSS  82



>ref|WP_007100743.1| preprotein translocase subunit TatA [Synechococcus sp. RS9917]
 gb|EAQ68671.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
RS9917]
Length=91

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K   EP+ +
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPEPI  62

Query  314  AQAPSEGVEE  285
             QAP   V E
Sbjct  63   EQAPLPPVAE  72



>ref|WP_012628897.1| preprotein translocase subunit TatA [Cyanothece sp. PCC 7425]
 gb|ACL45837.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 7425]
Length=104

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ  309
            +FG+G+PE+V+I  +A L+FGPKKLPE+GRS+GK  +GFQ A+KEFE+ELK++ + L Q
Sbjct  3    VFGIGLPEMVLILVIALLIFGPKKLPEIGRSLGKALRGFQDASKEFESELKRQAELLEQ  61



>ref|WP_037218329.1| preprotein translocase subunit TatA [Richelia intracellularis]
Length=82

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI GVA L+FGPKKLPE+GRS+GK  +GFQ+A+ EF+ E +KE + L  A
Sbjct  3    IFGIGLPEMAVIMGVALLIFGPKKLPEIGRSVGKAIRGFQEASNEFQNEFQKEAEQLQDA  62

Query  305  PSEGVE  288
             +   E
Sbjct  63   MTTTAE  68



>ref|WP_028948124.1| preprotein translocase subunit SecA [Synechocystis sp. PCC 6714]
 gb|AIE74360.1| Twin-arginine translocation protein TatB [Synechocystis sp. PCC 
6714]
Length=83

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PEL +I  +A LVFGPKKLPEVGRS+GK  +GFQ+A+KEFETELK+E  +L ++
Sbjct  3    IFGIGLPELGLIFVIALLVFGPKKLPEVGRSLGKALRGFQEASKEFETELKREAQNLEKS  62



>emb|CEF96594.1| Sec-independent protein translocase protein TatA/E [Ostreococcus 
tauri]
Length=116

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  509  RKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            R R     LFGLG+PE+VVI GVAA++FGP+KLPE+G+S+GKT K FQ+AAKEF+ E++ 
Sbjct  40   RDRVVVRGLFGLGLPEIVVIGGVAAVLFGPQKLPELGKSLGKTVKSFQEAAKEFKDEMQT  99

Query  329  E  327
            E
Sbjct  100  E  100



>ref|WP_011131203.1| preprotein translocase subunit TatA [Prochlorococcus marinus]
 emb|CAE22011.1| mttA/Hcf106 family [Prochlorococcus marinus str. MIT 9313]
Length=91

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  +A LVFGPK+LPE GR++GKT KGFQ A+KEFE E+ K   EP+S+
Sbjct  3    VFGIGLPEMAVIGAIALLVFGPKRLPEFGRTLGKTLKGFQAASKEFEREIHKTMAEPESI  62

Query  314  AQAPSE  297
             QA +E
Sbjct  63   EQAATE  68



>ref|WP_011618288.1| prohead protease [Synechococcus sp. CC9311]
 gb|ABI45131.1| twin-arginine translocation protein TatA [Synechococcus sp. CC9311]
Length=92

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 9/89 (10%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VIA VA LVFGPK+LPE GR++GKT KGFQ A+KEFE E+ K   EP+ +
Sbjct  3    VFGIGLPEMAVIAAVALLVFGPKRLPEFGRTLGKTLKGFQSASKEFEREINKAMAEPEPI  62

Query  314  A------QAPSEGVEEINQQEKRDATVSS  246
            A      +AP+E V       K + T  S
Sbjct  63   ADQAKALEAPAETVVPPTVAPKTEPTSPS  91



>ref|WP_026787063.1| MULTISPECIES: hypothetical protein [Planktothrix]
 gb|KEI65479.1| TatA [Planktothrix agardhii NIVA-CYA 126/8]
Length=86

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  +A L+FGPKKLPE+G S+GK  KGFQQA+KEFE E KKE   L   
Sbjct  3    IFGIGLPEMAVILVLALLIFGPKKLPEIGSSLGKALKGFQQASKEFEDEFKKEAQKLE--  60

Query  305  PSEGVEEINQQEKRDATVSST  243
                 E    Q ++++TV+ST
Sbjct  61   -----ETAKIQPEKNSTVAST  76



>ref|WP_022607742.1| twin arginine-targeting protein translocase, TatA/E family [Rubidibacter 
lacunae]
 gb|ERN40968.1| twin arginine-targeting protein translocase, TatA/E family [Rubidibacter 
lacunae KORDI 51-2]
Length=98

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+V+I  +A LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E K+E   L +A
Sbjct  3    VFGIGLPEMVLILAIALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKRESQELEEA  62



>ref|WP_015184092.1| Sec-independent protein translocase TatA [Microcoleus sp. PCC 
7113]
 gb|AFZ19956.1| Sec-independent protein translocase TatA [Microcoleus sp. PCC 
7113]
Length=95

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (67%), Gaps = 9/93 (10%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ A++EFE+E K+E + + QA
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQDASREFESEFKREAEQIEQA  62

Query  305  PSE---------GVEEINQQEKRDATVSSTKED  234
                        GV+E    E  + T +S++++
Sbjct  63   ARTPTLPESGEVGVKEAATAESNNQTTTSSQQN  95



>ref|WP_015222444.1| Sec-independent protein translocase TatA [Cyanobacterium stanieri]
 gb|AFZ47126.1| Sec-independent protein translocase TatA [Cyanobacterium stanieri 
PCC 7202]
Length=90

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE++VI  VA LVFGPKKLPE+GR++GKT KGFQ A+KEF+ E KKE   + + 
Sbjct  3    VFGIGLPEMIVIFVVALLVFGPKKLPEIGRTLGKTLKGFQDASKEFQDEFKKEAQQIEET  62

Query  305  PSEG--VEEINQQEK----RDATVSSTK  240
             S    +E   ++EK     D T S T+
Sbjct  63   ISMNAQIESGKEEEKVPTPNDNTASKTE  90



>ref|WP_006099206.1| primosome subunit DnaD [Coleofasciculus chthonoplastes]
 gb|EDX77093.1| twin arginine-targeting protein translocase, TatA/E family, putative 
[Coleofasciculus chthonoplastes PCC 7420]
Length=95

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA LVFGPKKLPE+G+S+GK  +GFQ A++EFETE K+E   L QA
Sbjct  3    VFGIGLPEMALILIVALLVFGPKKLPEIGQSLGKAIRGFQDASREFETEFKREAQQLEQA  62



>ref|WP_040688524.1| preprotein translocase subunit TatA, partial [Pseudanabaena biceps]
Length=67

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ  309
            +FG+G+PE+++I  VA L+FGPKKLPE+GRS+GK  KGFQ A++EFE+E K+E + L Q
Sbjct  3    IFGIGLPEMILIMLVALLIFGPKKLPEIGRSMGKAIKGFQDASREFESEFKREAERLEQ  61



>ref|WP_009546094.1| MULTISPECIES: primosome subunit DnaD [Cyanothece]
 gb|ACB50212.1| putative twin-arginine translocation protein TatA/E [Cyanothece 
sp. ATCC 51142]
Length=89

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E K+E   L ++
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKREAQQLEES  62

Query  305  PSEGVEEINQQEKRDATVSSTKED  234
             +   E    +E + A  +ST  D
Sbjct  63   VTMKAE---LEENKMANPTSTDHD  83



>ref|WP_041425909.1| preprotein translocase subunit SecA [Synechocystis sp. PCC 6803]
Length=85

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PEL +I  +A LVFGPKKLPEVGRS+GK  +GFQ+A+KEFETELK+E  +L ++
Sbjct  3    IFGIGLPELGLIFVIALLVFGPKKLPEVGRSLGKALRGFQEASKEFETELKREAQNLEKS  62



>ref|WP_019509197.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=89

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+ KT + FQ A+KEFE E K+E   + ++
Sbjct  3    IFGIGLPEMALILIVALLVFGPKKLPEIGRSVAKTLRSFQDASKEFENEFKREAQKIEES  62

Query  305  PS-----EGVEEINQQEKRDATVSS  246
             S     E  +++N  +K D+  +S
Sbjct  63   VSMSAKLEAAKDLNPSDKVDSPSTS  87



>ref|XP_005646948.1| twin arginine-targeting protein trans [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22404.1| twin arginine-targeting protein trans [Coccomyxa subellipsoidea 
C-169]
Length=79

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELK  333
            LFGLGVPE+ VIAGVA L+FGP KLPE+GR +GK+ K FQ AAKEFE+ELK
Sbjct  3    LFGLGVPEIAVIAGVAVLIFGPSKLPELGRELGKSVKSFQTAAKEFESELK  53



>ref|WP_017718938.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=89

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +FG+G+PE+ VI GVA L+FGPKKLPE+GRS+GK  +GFQ+A+++FE ELK+E + L
Sbjct  3    IFGIGLPEMAVILGVALLIFGPKKLPEIGRSLGKAIRGFQEASRDFENELKREVEQL  59



>ref|WP_012267736.1| primosome subunit DnaD [Microcystis aeruginosa]
 dbj|BAG05223.1| putative TatA protein [Microcystis aeruginosa NIES-843]
Length=82

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GKT +GFQ+A+KEFE+E K+E + +  +
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAEQIEDS  62

Query  305  PSEGVEEINQQEKRDATVSS  246
                 E    Q   D T SS
Sbjct  63   VKIKAELEESQSPSDQTRSS  82



>ref|WP_010314490.1| primosome subunit DnaD [Synechococcus sp. CB0205]
Length=83

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VIA V  LVFGPK+LPE+GR++GKT KGFQ A+KEFE E +K  D++   
Sbjct  3    VFGIGLPEMAVIAAVGLLVFGPKRLPELGRTLGKTLKGFQSASKEFEQEFRKAVDTVEAE  62

Query  305  PSEGVEEINQQEKRD  261
             ++   E   Q K D
Sbjct  63   VTQASSEPQPQLKAD  77



>ref|WP_006633691.1| preprotein translocase subunit TatA [Microcoleus vaginatus]
 gb|EGK86699.1| Sec-independent protein translocase protein tatA/E-like protein 
[Microcoleus vaginatus FGP-2]
Length=86

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  +A LVFGPKKLPE+GRS+GK  +GFQ A+++FE+E  +E   L +A
Sbjct  3    IFGIGLPEMAVIFTIALLVFGPKKLPEIGRSMGKAIRGFQDASRDFESEFTREAKQLEEA  62

Query  305  PSEGVEEINQQEKRDATVSSTKEDS  231
                V   ++ E    T ++ KEDS
Sbjct  63   ----VATSSKPETEKLTAATPKEDS  83



>ref|WP_010871658.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_440350.1| hypothetical protein slr1046 [Synechocystis sp. PCC 6803]
 dbj|BAA17030.1| slr1046 [Synechocystis sp. PCC 6803]
 dbj|BAK49202.1| hypothetical protein SYNGTS_0454 [Synechocystis sp. PCC 6803]
 dbj|BAL28201.1| hypothetical protein SYNGTI_0454 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31371.1| hypothetical protein SYNPCCN_0454 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34540.1| hypothetical protein SYNPCCP_0454 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM50745.1| hypothetical protein BEST7613_1814 [Synechocystis sp. PCC 6803]
 gb|AGF50720.1| hypothetical protein MYO_14600 [Synechocystis sp. PCC 6803]
Length=126

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PEL +I  +A LVFGPKKLPEVGRS+GK  +GFQ+A+KEFETELK+E  +L ++
Sbjct  44   IFGIGLPELGLIFVIALLVFGPKKLPEVGRSLGKALRGFQEASKEFETELKREAQNLEKS  103



>ref|WP_012410656.1| primosome subunit DnaD [Nostoc punctiforme]
 gb|ACC82691.1| twin-arginine translocation protein, TatA/E family subunit [Nostoc 
punctiforme PCC 73102]
Length=91

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+KEF++E +KE + L
Sbjct  3    IFGIGLPEMAVIMVVALLIFGPKKLPEIGRSVGKTIRSFQEASKEFQSEFQKEAEQL  59



>ref|WP_015118028.1| twin arginine-targeting protein translocase, TatA/E family [Rivularia 
sp. PCC 7116]
 gb|AFY54452.1| twin arginine-targeting protein translocase, TatA/E family [Rivularia 
sp. PCC 7116]
Length=83

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA LVFGPKKLPE+GRS+GK  +GFQ+A+++F+ E KKE   L +A
Sbjct  3    IFGIGLPEMAVIMAVALLVFGPKKLPEIGRSMGKALRGFQEASQDFQDEFKKEASQLEEA  62

Query  305  PSEGVEEINQQEKRDATVSSTKE  237
                 E    + K   TV  T+E
Sbjct  63   VKTTAE---LEPKLSGTVDKTEE  82



>ref|WP_040932916.1| hypothetical protein [Prochloron didemni]
Length=92

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ+A+KEFE+E K++ + L ++
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQEASKEFESEFKRQAEELEES  62

Query  305  PSEGVEEINQQEKRDATVSSTKEDS  231
                 +  + QE ++  V+  +  S
Sbjct  63   VKMNAQLESSQEGKEVKVTKAETTS  87



>ref|WP_029637480.1| preprotein translocase subunit TatA [[Scytonema hofmanni] UTEX 
B 1581]
Length=90

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+ EF+ E K+E + L   
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASSEFQNEFKREAEKL---  59

Query  305  PSEGVEEINQQEKRDATVSSTKEDS  231
              E V+   + E +    SST++D+
Sbjct  60   -EEAVKTTAELEPKQIEASSTQKDT  83



>tpg|DAA50381.1| TPA: thylakoid assembly4 [Zea mays]
Length=125

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQ  363
            C CLFGLGVPEL VIAGVAALVFGPK+LPE+GRSIGKT K FQQ
Sbjct  82   CKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQ  125



>ref|WP_012194832.1| translocase [Prochlorococcus marinus]
 gb|ABX08207.1| Sec-independent protein secretion pathway component [Prochlorococcus 
marinus str. MIT 9211]
Length=83

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 54/69 (78%), Gaps = 3/69 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI G+A ++FGPK+LPE+GR++GKT KG Q+A+ EFE+E++K   EPD+ 
Sbjct  3    IFGVGLPEIAVIVGLALVIFGPKRLPELGRTLGKTLKGLQKASTEFESEIQKAMTEPDNS  62

Query  314  AQAPSEGVE  288
              A  EG +
Sbjct  63   ESATKEGAD  71



>ref|WP_038542939.1| primosome subunit DnaD [Synechococcus sp. KORDI-100]
 gb|AII42304.1| primosome subunit DnaD [Synechococcus sp. KORDI-100]
Length=77

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K   +P+++
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMADPEAI  62

Query  314  AQAPSEGVEE  285
                SE  E+
Sbjct  63   DAETSEASEQ  72



>ref|WP_015209228.1| twin arginine-targeting protein translocase, TatA/E family [Cylindrospermum 
stagnale]
 gb|AFZ25985.1| twin arginine-targeting protein translocase, TatA/E family [Cylindrospermum 
stagnale PCC 7417]
Length=90

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GKT +GFQ+A+ EF++E K+E +++ QA
Sbjct  3    IFGIGLPEMGLIMIVALLIFGPKKLPEIGRSLGKTIRGFQEASNEFQSEFKREAENIEQA  62



>dbj|GAL93280.1| twin-arginine translocation protein TatB [Microcystis aeruginosa 
NIES-44]
Length=82

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GKT +GFQ+A+KEFE+E K+E   +  +
Sbjct  3    IFGIGLPEMGLILLIALLVFGPKKLPEIGRSLGKTIRGFQEASKEFESEFKREAQQIEDS  62

Query  305  PSEGVEEINQQEKRDATVSS  246
                 E    Q   D T SS
Sbjct  63   VKIKAELEESQSPSDQTRSS  82



>ref|WP_015202296.1| Sec-independent protein translocase TatA [Crinalium epipsammum]
 gb|AFZ12174.1| Sec-independent protein translocase TatA [Crinalium epipsammum 
PCC 9333]
Length=89

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQQA+ +FE E K+E + + QA
Sbjct  3    IFGVGLPEMAIIMVIALLVFGPKKLPEIGRSLGKGIRGFQQASSDFEAEFKREAEQIEQA  62



>ref|WP_040054321.1| preprotein translocase subunit SecA [Candidatus Atelocyanobacterium 
thalassa]
 gb|KFF41861.1| twin arginine-targeting protein translocase, TatA/E family [Candidatus 
Atelocyanobacterium thalassa isolate SIO64986]
Length=90

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  ++ LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E K+E   L  +
Sbjct  3    IFGIGLPEMALILIISLLVFGPKKLPEIGRSLGKAVRGFQDASKEFEDEFKRETQHLQDS  62

Query  305  PSEGVEEINQQEKRDATVSSTKED  234
             S     IN + + + T SS++ +
Sbjct  63   LS-----INAELEDNKTDSSSQSN  81



>ref|WP_028083231.1| preprotein translocase subunit TatA [Dolichospermum circinale]
Length=86

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF+TE K+E + L + 
Sbjct  3    IFGIGLPEMAVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQTEFKRETEQLKET  62



>ref|WP_028089196.1| preprotein translocase subunit TatA [Dolichospermum circinale]
Length=86

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF+TE K+E + L + 
Sbjct  3    IFGIGLPEMAVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQTEFKRETEQLKET  62



>ref|WP_039739679.1| preprotein translocase subunit TatA [Hassallia byssoidea]
 gb|KIF37065.1| preprotein translocase subunit TatA [Hassallia byssoidea VB512170]
Length=90

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+ EF+ E K+E + L   
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASSEFQNEFKQEAEKL---  59

Query  305  PSEGVEEINQQEKRDATVSSTKEDS  231
              E V+   + E +    SST++D+
Sbjct  60   -QEAVKTTAELEPKQIEASSTQKDT  83



>ref|WP_011932240.1| primosome subunit DnaD [Synechococcus sp. WH 7803]
 emb|CAK22740.1| Sec-independent protein translocase protein TatA [Synechococcus 
sp. WH 7803]
Length=82

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K   EP+ L
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPERL  62

Query  314  AQA  306
             +A
Sbjct  63   PEA  65



>ref|WP_008275801.1| primosome subunit DnaD [Cyanothece sp. CCY0110]
 gb|EAZ91191.1| hypothetical protein CY0110_13027 [Cyanothece sp. CCY0110]
Length=89

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E K+E   L ++
Sbjct  3    VFGIGLPEMALILVIALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKREAQQLEES  62

Query  305  PSEGVEEINQQEKRDATVSSTKED  234
             +   E    +E + A  + T  D
Sbjct  63   VTMNAE---LEENKMANPTPTDND  83



>ref|WP_035997640.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=104

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A L+FGPKKLPE+GRS+GK  +GFQ+A+KEFETE KKE + + + 
Sbjct  3    IFGIGLPEMALIMILALLIFGPKKLPEIGRSLGKAIRGFQEASKEFETEFKKEAERIEKV  62

Query  305  PSE  297
             +E
Sbjct  63   VNE  65



>ref|WP_012594970.1| MULTISPECIES: primosome subunit DnaD [Cyanothece]
 gb|ACK65697.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 8801]
 gb|ACV00578.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 8802]
Length=91

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+V+I  +A LVFGPKKLPE+GRS+GK  +GFQ+A+KEFE E K+E   L ++
Sbjct  3    VFGIGLPEMVLILVIALLVFGPKKLPEIGRSLGKAIRGFQEASKEFENEFKREAQQLEES  62



>ref|WP_017327885.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=108

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE +VI  VA LVFGPKKLPE+GR++ KT K  Q A+KEFE E+K+E       
Sbjct  3    IFGVGLPEAIVILAVALLVFGPKKLPEIGRTVAKTIKSLQDASKEFEAEIKRE-------  55

Query  305  PSEGVEEINQQEKRDATVSSTKEDS  231
             +E V  + +Q K  A +S    D+
Sbjct  56   -AEQVSSLEKQAKPVANISPPAADT  79



>ref|WP_012954283.1| primosome subunit DnaD [Candidatus Atelocyanobacterium thalassa]
 gb|ADB95596.1| twin arginine-targeting protein translocase, TatA/E family [Candidatus 
Atelocyanobacterium thalassa isolate ALOHA]
Length=90

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  ++ LVFGPKKLPE+G+S+GK  KGFQ A+KEFE E K+E   L  +
Sbjct  3    IFGIGLPEMAVILIISLLVFGPKKLPEIGKSLGKAVKGFQDASKEFEDEFKRETQHLQDS  62

Query  305  PSEGVE  288
             S   E
Sbjct  63   LSMNAE  68



>ref|XP_002946596.1| hypothetical protein VOLCADRAFT_120302 [Volvox carteri f. nagariensis]
 gb|EFJ52523.1| hypothetical protein VOLCADRAFT_120302 [Volvox carteri f. nagariensis]
Length=159

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  506  KRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELK  333
            ++ +C  LFGLG+PE+ VIAGVAALVFGP KLPE+G+++GKT K FQ AA EF  ELK
Sbjct  26   RQVTCQGLFGLGLPEVAVIAGVAALVFGPSKLPELGKTLGKTVKSFQTAANEFSEELK  83



>ref|WP_010477319.1| MULTISPECIES: preprotein translocase subunit TatA [Acaryochloris]
 gb|ABW30467.1| twin-arginine translocation protein TatA/E family [Acaryochloris 
marina MBIC11017]
Length=106

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 4/69 (6%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD----S  318
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  K FQ+A+KEFE E KKE D    +
Sbjct  3    VFGIGLPEMALIMVIALLVFGPKKLPEIGRSMGKALKSFQEASKEFENEFKKEADRINET  62

Query  317  LAQAPSEGV  291
            L + P E  
Sbjct  63   LNETPMEAT  71



>ref|XP_003056138.1| twin arginine targeting family [Micromonas pusilla CCMP1545]
 gb|EEH59514.1| twin arginine targeting family [Micromonas pusilla CCMP1545]
Length=144

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  554  LRMVSGQRAARSSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFK  375
            + + +G  + ++  G +  +   LFGLG+PELVVI GVAA++FGP KLPE+G+S+GKT K
Sbjct  50   MNLSAGLGSKKAGAGPRSVATMGLFGLGLPELVVIGGVAAVLFGPSKLPELGKSLGKTVK  109

Query  374  GFQQAAKEFETELKKE  327
             FQ AA EF+ ELK++
Sbjct  110  SFQAAANEFQDELKEK  125



>ref|WP_006516772.1| twin arginine-targeting protein translocase, TatA/E family [Leptolyngbya 
sp. PCC 7375]
 gb|EKV02389.1| twin arginine-targeting protein translocase, TatA/E family [Leptolyngbya 
sp. PCC 7375]
Length=105

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  KGFQ A+KEFE E KKE
Sbjct  3    IFGIGLPEMALIMMVALLVFGPKKLPEIGRSLGKALKGFQDASKEFEDEFKKE  55



>ref|WP_044106578.1| preprotein translocase subunit SecA [cyanobacterium endosymbiont 
of Epithemia turgida]
 dbj|BAP17800.1| twin arginine translocase protein A [cyanobacterium endosymbiont 
of Epithemia turgida isolate EtSB Lake Yunoko]
Length=94

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+V+I  V+ L+FGPKKLPE+GRS+GK  +GFQ+A+KEFE E K+E   L  +
Sbjct  3    VFGIGLPEMVLIFAVSLLIFGPKKLPEIGRSLGKAIRGFQEASKEFENEFKREAQKLENS  62



>ref|WP_044195831.1| preprotein translocase subunit TatA [Oscillatoria acuminata]
Length=83

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +FG+G+PE++VI  +A L+FGPKKLPE+GRS+GK  +GFQ A++EFE+E+K+E + +
Sbjct  3    IFGMGLPEIMVILTIALLIFGPKKLPEIGRSMGKAIRGFQDASREFESEIKREAEQI  59



>ref|WP_017655009.1| primosome subunit DnaD [Microchaete sp. PCC 7126]
Length=90

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF++E K+E + L QA
Sbjct  3    IFGIGLPEMGVIFVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKREAEQLEQA  62



>ref|WP_015136549.1| twin arginine-targeting protein translocase, TatA/E family [Nostoc 
sp. PCC 7524]
 gb|AFY46081.1| twin arginine-targeting protein translocase, TatA/E family [Nostoc 
sp. PCC 7524]
Length=90

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+ EF++E K+E + L QA
Sbjct  3    IFGIGLPEMALIMVVALLIFGPKKLPEIGRSLGKAIRGFQEASNEFQSEFKREAEQLEQA  62



>ref|WP_023071402.1| sec-independent protein translocase [Leptolyngbya sp. Heron Island 
J]
 gb|ESA37819.1| sec-independent protein translocase [Leptolyngbya sp. Heron Island 
J]
Length=104

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  KGFQ A+KEFE E KKE
Sbjct  3    IFGIGLPEMALIMMVALLVFGPKKLPEIGRSLGKAIKGFQDASKEFEDEFKKE  55



>ref|WP_006275635.1| MULTISPECIES: primosome subunit DnaD [Nostocaceae]
 gb|EFA71396.1| Twin-arginine translocation protein TatA/E [Cylindrospermopsis 
raciborskii CS-505]
 gb|EFA71620.1| Twin-arginine translocation protein TatA/E [Raphidiopsis brookii 
D9]
Length=83

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+VVI  VA L+FGPKKLPE+GRS+ KT + FQQA+ EF+ E KKE   L + 
Sbjct  3    IFGIGLPEMVVIGVVALLIFGPKKLPEIGRSLAKTIRSFQQASSEFQNEFKKEVQQLEET  62



>ref|WP_044259952.1| preprotein translocase subunit TatA, partial [Richelia intracellularis]
Length=71

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GK  +GFQ+A+KEF+ E  KE   L + 
Sbjct  3    IFGIGLPEMAVIMSVALLIFGPKKLPEIGRSMGKAIRGFQEASKEFQDEFHKESAHLKET  62

Query  305  PSEGVE  288
             +   E
Sbjct  63   VTTTAE  68



>ref|WP_027840950.1| preprotein translocase subunit TatA [Mastigocoleus testarum]
Length=92

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA LVFGPKKLPE+GRS+GK  KGFQ+A+++F+ E KKE   L ++
Sbjct  3    IFGIGLPEMAVIMVVALLVFGPKKLPEIGRSLGKALKGFQEASQDFQEEFKKEASELEES  62



>ref|WP_016952632.1| primosome subunit DnaD [Anabaena sp. PCC 7108]
Length=90

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPEVGRS+GKT + FQ+A+ EF+TE K+E + L + 
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEVGRSLGKTIRSFQEASNEFQTEFKRETEQLEET  62



>ref|WP_038019212.1| hypothetical protein, partial [Synechococcus sp. PCC 7335]
Length=86

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  KGFQ A KEFETE KKE + + + 
Sbjct  3    IFGIGLPEMGLIMIVALLVFGPKKLPEIGRSLGKAMKGFQDATKEFETEFKKEAERIEKT  62



>ref|WP_015176008.1| Sec-independent protein translocase TatA [Oscillatoria nigro-viridis]
 gb|AFZ06707.1| Sec-independent protein translocase TatA [Oscillatoria nigro-viridis 
PCC 7112]
Length=86

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  +A LVFGPKKLPE+GRS+GK  +GFQ A+++FE+E  +E   L   
Sbjct  3    IFGIGLPEMAVIFTIALLVFGPKKLPEIGRSMGKAIRGFQDASRDFESEFTREAKQL---  59

Query  305  PSEGVEEINQQEKRDATVSSTKEDS  231
              E V   ++ E      ++ KEDS
Sbjct  60   -EEAVATSSKPETEKLAAATPKEDS  83



>gb|EDX84644.1| twin arginine-targeting protein translocase, TatA/E family, putative 
[Synechococcus sp. PCC 7335]
Length=145

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  KGFQ A KEFETE KKE + +
Sbjct  3    IFGIGLPEMGLIMIVALLVFGPKKLPEIGRSLGKAMKGFQDATKEFETEFKKEAERI  59



>ref|WP_008235394.1| Twin-arginine translocation protein TatA [Richelia intracellularis]
 emb|CCH68073.1| Twin-arginine translocation protein TatA [Richelia intracellularis 
HH01]
Length=83

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GK  +GFQ+A+KEF+ E  KE   L   
Sbjct  3    IFGIGLPEMAVIMSVALLIFGPKKLPEIGRSMGKAIRGFQEASKEFQDEFHKESAHLKDT  62

Query  305  PSEGVE  288
             +   E
Sbjct  63   VTTTAE  68



>ref|WP_015078234.1| twin-arginine translocation protein [Anabaena sp. 90]
 gb|AFW93070.1| twin-arginine translocation protein [Anabaena sp. 90]
Length=86

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF++E KKE + L + 
Sbjct  3    IFGIGLPEMGVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKKESEQLKET  62



>gb|EAW38682.1| hypothetical protein L8106_14745 [Lyngbya sp. PCC 8106]
Length=81

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -3

Query  476  LGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQAPSE  297
            +G+PE+ VI  +A L+FGPKKLPE+GRS+GK  +GFQ+A+KEFE E K+E   L +A   
Sbjct  1    MGLPEIAVILVLALLIFGPKKLPEIGRSMGKAIRGFQEASKEFENEFKREAKQLEEATKM  60

Query  296  GVEEINQQEKRDATVSSTKE  237
                 +Q EK   TV+ST E
Sbjct  61   SK---SQPEKAMTTVASTDE  77



>ref|WP_028953506.1| primosome subunit DnaD [Synechococcus sp. CC9616]
Length=77

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K   +P+ +
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMADPEVI  62

Query  314  AQAPSEGVEE  285
                SE  E 
Sbjct  63   EAESSEASEH  72



>ref|WP_015161113.1| twin arginine-targeting protein translocase, TatA/E family [Chamaesiphon 
minutus]
 gb|AFY95001.1| twin arginine-targeting protein translocase, TatA/E family [Chamaesiphon 
minutus PCC 6605]
Length=83

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
             FG+G+PE + IA V  LVFGPKKLPE+G+S+GK  KGFQ+A+ +F++E KKE D++  A
Sbjct  3    FFGIGLPETIAIAVVVLLVFGPKKLPEIGKSLGKAIKGFQEASNDFQSEFKKEVDAIESA  62



>ref|WP_015214503.1| Sec-independent protein translocase TatA [Anabaena cylindrica]
 gb|AFZ57867.1| Sec-independent protein translocase TatA [Anabaena cylindrica 
PCC 7122]
Length=90

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ  309
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF+ E K+E + L Q
Sbjct  3    IFGIGLPEMALIMVVALLIFGPKKLPEIGRSVGKTIRSFQEASNEFQNEFKREAEQLEQ  61



>ref|WP_015956190.1| primosome subunit DnaD [Cyanothece sp. PCC 7424]
 gb|ACK72605.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 7424]
Length=92

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+++I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+KEFE+E  +E   + ++
Sbjct  3    IFGIGLPEMMLILVVALLIFGPKKLPEIGRSLGKAIRGFQEASKEFESEFNREAQQIEES  62



>ref|WP_015111805.1| Sec-independent protein translocase TatA [Nostoc sp. PCC 7107]
 gb|AFY41566.1| Sec-independent protein translocase TatA [Nostoc sp. PCC 7107]
Length=85

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA LVFGPKKLPE+GRS+GK  +GFQ+A+ EF+ E K+E + + Q 
Sbjct  3    IFGIGLPEMAVIMIVALLVFGPKKLPEIGRSVGKAIRGFQEASNEFQNEFKREAEQIEQV  62



>ref|WP_044492070.1| primosome subunit DnaD [Moorea producens]
Length=100

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ-  309
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ A+KEFE + K E   + Q 
Sbjct  3    VFGMGLPEMALIMVIALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENQFKLEAQQIEQG  62

Query  308  ----APSEGVEEINQQEKRDATVSSTKEDS  231
                 PSE  ++I  +E   A V + + ++
Sbjct  63   LNTPTPSES-DQITTKEVATAEVDTAESNN  91



>ref|WP_006530590.1| twin arginine-targeting protein translocase, TatA/E family [Gloeocapsa 
sp. PCC 73106]
 gb|ELR96558.1| twin arginine-targeting protein translocase, TatA/E family [Gloeocapsa 
sp. PCC 73106]
Length=89

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +FG+G+PE+ +I  +A LVFGPKKLPE+G+S+GK  +GFQ+A++EFETE +KE   L
Sbjct  3    IFGIGLPEMALILVIALLVFGPKKLPEIGQSLGKAIRGFQEASREFETEFQKEARQL  59



>gb|ACZ26222.1| TatA/E [Aphanizomenon sp. NH-5]
Length=86

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF++E KKE + L + 
Sbjct  3    IFGIGLPEMGVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKKESEQLKET  62



>ref|WP_027402857.1| preprotein translocase subunit TatA [Aphanizomenon flos-aquae]
Length=84

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF++E KKE + L + 
Sbjct  3    IFGIGLPEMGVIMVVALLIFGPKKLPEIGRSLGKTIRSFQEASNEFQSEFKKESEQLKET  62



>ref|WP_018400284.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=95

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+++I  +A LVFGPKKLPE+GRS+GK  +GFQ A+ EF+ E K+E   L ++
Sbjct  3    IFGMGLPEIMLIMVIALLVFGPKKLPEIGRSMGKAIRGFQDASNEFQNEFKREAAQLEES  62

Query  305  --PSEGVEEINQQEKRDATVSS  246
                  +EE   +EK   TV S
Sbjct  63   VKMKAELEESKAKEKEAETVDS  84



>ref|WP_006853679.1| prohead protease [Synechococcus sp. WH 8016]
 gb|EHA62246.1| twin-arginine translocation protein, TatA/E family subunit [Synechococcus 
sp. WH 8016]
Length=98

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VIA VA LVFGPK+LPE GR++GKT KGFQ A+KEFE E+ K   +P+ +
Sbjct  3    VFGIGLPEMAVIAAVALLVFGPKRLPEFGRTLGKTLKGFQSASKEFEREINKAMADPEPV  62

Query  314  AQ  309
            A 
Sbjct  63   AD  64



>ref|WP_011936751.1| primosome subunit DnaD [Synechococcus sp. RCC307]
 emb|CAK29242.1| Sec-independent protein translocase protein TatA [Synechococcus 
sp. RCC307]
Length=89

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +FG+G+PE+ VIA +  LVFGPKKLPE+GRS+GKT KGFQ A+ EFE E +K  DS+
Sbjct  3    VFGVGLPEMAVIAVIGLLVFGPKKLPELGRSLGKTLKGFQAASSEFEQEFRKAVDSV  59



>gb|AFY67086.1| Sec-independent protein translocase TatA [Geitlerinema sp. PCC 
7407]
Length=105

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E ++E + + +A
Sbjct  3    VFGVGLPEMAIIMVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFRREAEQIERA  62



>ref|WP_010995019.1| primosome subunit DnaD [Nostoc sp. PCC 7120]
 dbj|BAB72802.1| asl0845 [Nostoc sp. PCC 7120]
Length=90

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+ EF++E K+E + L QA
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASNEFQSEFKREAEQLEQA  62



>ref|WP_011321124.1| primosome subunit DnaD [Anabaena variabilis]
 gb|ABA24047.1| Sec-independent protein translocase TatA [Anabaena variabilis 
ATCC 29413]
Length=90

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+ EF++E K+E + L QA
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSLGKAIRGFQEASNEFQSEFKREAEQLEQA  62



>ref|WP_015142774.1| twin arginine-targeting protein translocase, TatA/E family [Pleurocapsa 
minor]
 gb|AFY76466.1| twin arginine-targeting protein translocase, TatA/E family [Pleurocapsa 
sp. PCC 7327]
Length=90

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
             FG+G+PE+++I  +A L+FGPKKLPE+GRS+GK  + FQ+A+KEFE E K+E   L ++
Sbjct  3    FFGIGLPEMILIMVIALLIFGPKKLPEIGRSVGKAIRSFQEASKEFENEFKREAQQLEES  62



>ref|WP_015135395.1| Sec-independent protein translocase TatA [Leptolyngbya sp. PCC 
7376]
 gb|AFY39655.1| Sec-independent protein translocase TatA [Leptolyngbya sp. PCC 
7376]
Length=94

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GR++GKT K FQ A+ EF+ E+KKE D + ++
Sbjct  3    VFGIGLPEMALIFVIALLVFGPKKLPEIGRTLGKTLKSFQAASNEFQEEIKKETDKIEKS  62



>ref|WP_015191613.1| Sec-independent protein translocase protein tatA/E-like protein 
[Stanieria cyanosphaera]
 gb|AFZ33940.1| Sec-independent protein translocase protein tatA/E-like protein 
[Stanieria cyanosphaera PCC 7437]
Length=91

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E K+E
Sbjct  3    IFGIGLPEMALILVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFKRE  55



>ref|WP_041269048.1| preprotein translocase subunit TatA, partial [Geitlerinema sp. 
PCC 7407]
Length=86

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E ++E + + +A
Sbjct  3    VFGVGLPEMAIIMVVALLVFGPKKLPEIGRSLGKAIRGFQDASKEFENEFRREAEQIERA  62



>ref|WP_015129400.1| Sec-independent protein translocase TatA [Calothrix sp. PCC 7507]
 gb|AFY33591.1| Sec-independent protein translocase TatA [Calothrix sp. PCC 7507]
Length=90

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GKT + FQ+A+ EF++E K+E + L Q 
Sbjct  3    IFGIGLPEMGVIFVVALLIFGPKKLPEIGRSLGKTLRSFQEASNEFQSEFKREAEQLEQV  62



>ref|WP_009788805.1| primosome subunit DnaD [Synechococcus sp. BL107]
 gb|EAU71447.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
BL107]
Length=77

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE+G+++GKT KGFQ A+KEFE E+ K   EP++L
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGKTLGKTLKGFQSASKEFEREINKAMAEPEAL  62

Query  314  AQAPSEGVEE  285
                 +  EE
Sbjct  63   PSTEQQANEE  72



>ref|WP_036901406.1| translocase [Prochlorococcus sp. MIT 0601]
Length=72

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 56/70 (80%), Gaps = 3/70 (4%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VIAG+A ++FGPK+LPE+GR++GKT K  QQA+ EFE+E+K   ++++++
Sbjct  3    IFGVGLPEIAVIAGLALVIFGPKRLPELGRTLGKTLKSLQQASTEFESEIK---NAMSES  59

Query  305  PSEGVEEINQ  276
             S+  E+ N 
Sbjct  60   ESKDSEQKND  69



>gb|AHF62674.1| twin-arginine translocation protein, TatA/E family [Synechococcus 
sp. WH 8109]
Length=76

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K   EP+  
Sbjct  3    IFGVGLPEVAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPEVS  62

Query  314  AQAPSEGVEEI  282
             +A S+ VEE+
Sbjct  63   GEA-SKPVEEL  72



>ref|WP_011360824.1| primosome subunit DnaD [Synechococcus sp. CC9902]
 gb|ABB27038.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
CC9902]
Length=77

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE+G+++GKT KGFQ A+KEFE E+ K   EP++L
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGKTLGKTLKGFQSASKEFEREINKAMAEPEAL  62

Query  314  AQA  306
              A
Sbjct  63   PSA  65



>gb|KIJ84523.1| preprotein translocase subunit TatA [Scytonema tolypothrichoides 
VB-61278]
Length=98

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPEVGRS+GK  +GFQ+A+KEF+ E +KE   L +A
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEVGRSLGKAIRGFQEASKEFQNEFQKEAIQLQEA  62



>ref|WP_006042329.1| primosome subunit DnaD [Synechococcus sp. WH 7805]
 gb|EAR19205.1| Twin-arginine translocation protein TatA/E [Synechococcus sp. 
WH 7805]
Length=81

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 3/62 (5%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK---EPDSL  315
            +FG+G+PE+ VI  VA LVFGPK+LPE GR++GKT KGFQ A+KEFE E+ K   EP+ L
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPEFGRTLGKTLKGFQSASKEFEREINKAMAEPEVL  62

Query  314  AQ  309
             +
Sbjct  63   PE  64



>ref|WP_007354006.1| MULTISPECIES: preprotein translocase subunit TatA [Kamptonema]
 emb|CBN54781.1| Sec-independent protein translocase protein tatA/E homolog [ 
[[Oscillatoria] sp. PCC 6506]
Length=84

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GK  +GFQ A+++FE+E K+E   L +A
Sbjct  3    IFGIGLPEMGVILVVALLIFGPKKLPEIGRSMGKALRGFQDASRDFESEFKREAQQLEEA  62



>ref|WP_011363292.1| primosome subunit DnaD [Synechococcus sp. CC9605]
 gb|ABB34040.1| twin-arginine translocation protein, TatA/E family [Synechococcus 
sp. CC9605]
Length=76

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINK  54



>ref|WP_038551417.1| primosome subunit DnaD [Synechococcus sp. KORDI-52]
 gb|AII47775.1| primosome subunit DnaD [Synechococcus sp. KORDI-52]
Length=76

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K
Sbjct  3    IFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINK  54



>ref|XP_010917651.1| PREDICTED: sec-independent protein translocase protein TATA, 
chloroplastic-like isoform X1 [Elaeis guineensis]
Length=144

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  482  FGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQAP  303
            FGLGVPE+ VIAGVAALVFGP ++P +G+S GKT K FQQAAKEFE ELKKE +   ++P
Sbjct  59   FGLGVPEVAVIAGVAALVFGPSQMPAIGQSFGKTIKSFQQAAKEFEAELKKEAEEAKESP  118

Query  302  S-EGVEEINQQ-EKRDATVSSTKEDS  231
              EG + I+ + EK +   S+TKE +
Sbjct  119  PIEGQKVISSEDEKMELKPSATKEST  144



>ref|WP_013323574.1| primosome subunit DnaD [Cyanothece sp. PCC 7822]
 gb|ADN15505.1| twin-arginine translocation protein, TatA/E family subunit [Cyanothece 
sp. PCC 7822]
Length=94

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+++I  VA L+FGPKKLPE+GRS+GK  +GFQ A+KEFE E ++
Sbjct  3    IFGIGLPEMILILVVALLIFGPKKLPEIGRSLGKAIRGFQDASKEFENEFQR  54



>ref|WP_036617295.1| preprotein translocase subunit TatA, partial [Oscillatoriales 
cyanobacterium JSC-12]
Length=72

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ+A+ EF+ E K+E + + +A
Sbjct  3    IFGIGLPEMALIFVIALLVFGPKKLPEIGRSLGKAIRGFQEASNEFQNEFKREAEQIEKA  62

Query  305  PSEGVE  288
              + +E
Sbjct  63   VKQPME  68



>ref|WP_007306580.1| primosome subunit DnaD [Crocosphaera watsonii]
 gb|EAM49731.1| Twin-arginine translocation protein TatA/E [Crocosphaera watsonii 
WH 8501]
 gb|EHJ11573.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0003]
 emb|CCQ62909.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0401]
 emb|CCQ53221.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 8502]
 emb|CCQ55142.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0005]
 emb|CCQ66787.1| Twin-arginine translocation protein TatA [Crocosphaera watsonii 
WH 0402]
Length=95

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ A+KEFE E K+E   L ++
Sbjct  3    VFGIGLPEMGLILVIALLVFGPKKLPEIGRSLGKAVRGFQDASKEFENEFKREAQQLEES  62



>ref|WP_016875716.1| primosome subunit DnaD [Chlorogloeopsis fritschii]
Length=82

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+KEF+ E +KE   + +A
Sbjct  3    VFGIGLPEMALIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASKEFQNEFQKEAAQIEEA  62



>ref|WP_006194119.1| primosome subunit DnaD [Nodularia spumigena]
 gb|EAW47273.1| Twin-arginine translocation protein TatA/E [Nodularia spumigena 
CCY9414]
 gb|AHJ28989.1| Twin-arginine translocation protein TatA [Nodularia spumigena 
CCY9414]
Length=90

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ+A+ EF++E K+E + + +A
Sbjct  3    IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSVGKAVRGFQEASNEFQSEFKREAEQIEEA  62



>ref|WP_017316132.1| primosome subunit DnaD [Mastigocladopsis repens]
Length=90

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPEVGRS+GK  + FQQA+ EF++E +KE   L +A
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEVGRSLGKAIRSFQQASSEFQSEFQKEAVQLKEA  62



>ref|WP_024124248.1| twin-arginine protein translocation system component MttA [Thermosynechococcus 
sp. NK55a]
 gb|AHB87835.1| twin-arginine protein translocation system component MttA [Thermosynechococcus 
sp. NK55a]
Length=77

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ  309
            +FG+G+PEL+VI  VA L+FGPKKLPE+GRS+GKT + F++A++EF+ E+K++  +L +
Sbjct  3    VFGIGLPELIVILVVALLIFGPKKLPEIGRSLGKTKRAFEEASREFQDEMKRQTAALEE  61



>ref|WP_019488579.1| primosome subunit DnaD [Calothrix sp. PCC 7103]
Length=82

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
             FG+G+PE+ VI  VA LVFGPKKLPE+GRS+GK  +GFQ A+++F+ E +KE   L +A
Sbjct  3    FFGIGLPEMAVIMVVALLVFGPKKLPEIGRSMGKAIRGFQDASRDFQDEFQKEATQLQEA  62



>ref|WP_007099747.1| primosome subunit DnaD [Synechococcus sp. RS9916]
 gb|EAU72692.1| twin-arginine translocation protein, TatA/E family [Synechococcus 
sp. RS9916]
Length=86

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VI  VA LVFGPK+LPE+GR++GKT KGFQ A+KEFE E+ K
Sbjct  3    VFGIGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQAASKEFEREINK  54



>ref|WP_011057225.1| preprotein translocase subunit TatA [Thermosynechococcus elongatus]
 ref|NP_682175.1| hypothetical protein tsl1385 [Thermosynechococcus elongatus BP-1]
 sp|Q8DJ44.1|TATA_THEEB RecName: Full=Sec-independent protein translocase protein TatA 
[Thermosynechococcus elongatus BP-1]
 dbj|BAC08937.1| tsl1385 [Thermosynechococcus elongatus BP-1]
Length=77

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 57/74 (77%), Gaps = 5/74 (7%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL---  315
            +FG+G+PEL+VI  VA L+FGPKKLPE+GRS+GKT + F++A++EF+ E+K++  +L   
Sbjct  3    VFGIGLPELIVILVVALLIFGPKKLPEIGRSLGKTKRAFEEASREFQDEIKRQTAALEEE  62

Query  314  --AQAPSEGVEEIN  279
              A+A +E   EI+
Sbjct  63   QQAKAEAESPREIS  76



>ref|WP_006172416.1| prohead protease [Synechococcus sp. WH 5701]
 gb|EAQ75466.1| twin-arginine translocation protein, TatA/E family protein [Synechococcus 
sp. WH 5701]
Length=125

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDS  318
             FG+G+PE+ VIA +  LVFGPK+LPE+GR++G+T KGFQ A++EFE E +K  D+
Sbjct  3    FFGIGLPEMAVIAAIGLLVFGPKRLPELGRTLGRTLKGFQSASREFEQEFRKAVDT  58



>ref|WP_011294250.1| translocase [Prochlorococcus marinus]
 gb|AAZ59105.1| Twin-arginine translocation protein TatA/E [Prochlorococcus marinus 
str. NATL2A]
Length=71

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VIAG+A ++FGPK+LPE+GR+IGKT KG Q A+ EFE E+K 
Sbjct  3    IFGVGLPEIAVIAGLALVIFGPKRLPELGRTIGKTLKGLQSASTEFEREIKN  54



>ref|WP_017746590.1| primosome subunit DnaD [Scytonema hofmanni]
Length=82

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ A+KEF+ E +KE   L +A
Sbjct  3    VFGIGLPEMALIFIVALLIFGPKKLPEIGRSVGKAIRGFQDASKEFQNEFQKETVQLEEA  62



>ref|WP_011823102.1| translocase [Prochlorococcus marinus]
 gb|ABM74893.1| Hypothetical protein NATL1_03291 [Prochlorococcus marinus str. 
NATL1A]
 gb|KGG20273.1| Twin-arginine translocation protein TatA [Prochlorococcus marinus 
str. PAC1]
Length=71

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VIAG+A ++FGPK+LPE+GR+IGKT KG Q A+ EFE E+K 
Sbjct  3    IFGVGLPEIAVIAGLALVIFGPKRLPELGRTIGKTLKGLQSASTEFEREIKN  54



>ref|WP_041034563.1| preprotein translocase subunit TatA [Tolypothrix campylonemoides]
 gb|KIJ77162.1| preprotein translocase subunit TatA [Tolypothrix campylonemoides 
VB511288]
Length=90

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPEVGRS+GK  + FQQA+ EF+ E +KE   L +A
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEVGRSLGKAIRSFQQASNEFQNEFQKEAVQLQEA  62



>ref|WP_043694585.1| primosome subunit DnaD [Synechococcus sp. KORDI-49]
 gb|AII46826.1| primosome subunit DnaD [Synechococcus sp. KORDI-49]
Length=77

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VI  VA LVFGPK+LPE+G+++GKT KGFQ A+KEFE E+ K
Sbjct  3    VFGVGLPEMAVIGAVALLVFGPKRLPELGKTLGKTLKGFQSASKEFEREINK  54



>ref|WP_015224612.1| twin-arginine translocation protein, TatA/E family subunit [Halothece 
sp. PCC 7418]
 gb|AFZ42734.1| twin-arginine translocation protein, TatA/E family subunit [Halothece 
sp. PCC 7418]
Length=99

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPD  321
            +FG+G+PE+ +I  +A LVFGPKKLPE+G S+GK  +GFQ A+KEFE E K+E +
Sbjct  3    VFGIGLPEMALIFVIALLVFGPKKLPEIGSSLGKAIRGFQDASKEFENEFKRETN  57



>ref|WP_016858680.1| MULTISPECIES: primosome subunit DnaD [Stigonematales]
 gb|KIY09317.1| preprotein translocase subunit TatA [Mastigocladus laminosus 
UU774]
Length=82

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            +FG+G+PE+ VI  VA L+FGPKKLPE+GRS+GK  +GFQ A+KEF+ E +KE
Sbjct  3    VFGIGLPEMAVIMVVALLIFGPKKLPEIGRSMGKAIRGFQDASKEFQNEFQKE  55



>ref|WP_026731687.1| preprotein translocase subunit TatA [Fischerella sp. PCC 9605]
Length=82

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ A++EF+ E +KE   L +A
Sbjct  3    VFGIGLPEMALIMVVALLIFGPKKLPEIGRSMGKAIRGFQDASREFQNEFQKEAAQLEEA  62



>ref|XP_007515120.1| twin arginine translocase protein A [Bathycoccus prasinos]
 emb|CCO13999.1| twin arginine translocase protein A [Bathycoccus prasinos]
Length=145

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  494  CNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFE  345
             N LFGLG+PELVVI GV AL+FGP KLPE+G+S+GKT K FQ AA EF 
Sbjct  71   SNGLFGLGLPELVVIGGVTALLFGPSKLPELGKSLGKTVKSFQSAANEFN  120



>ref|WP_024546019.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=92

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A L+FGPKKLPE+GRS+GKT + FQ A+ EF+ E KKE + +   
Sbjct  3    IFGIGLPEMALIFIIALLIFGPKKLPEIGRSLGKTIRSFQDASNEFQEEFKKEAEKIENT  62

Query  305  PS  300
             S
Sbjct  63   VS  64



>gb|AAP79161.1| Tha4 plastid transport protein [Bigelowiella natans]
Length=201

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  521  SSGGRKRFSCNCLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFET  342
            +S   +  S N LFGLG+PELVVI GVAAL+FGP KLPE G+ +G T K    A KEF  
Sbjct  112  ASSPDREVSVNSLFGLGLPELVVIGGVAALIFGPSKLPEFGKQLGVTAKSLGSAVKEFNE  171

Query  341  ELKKE  327
            ELK E
Sbjct  172  ELKDE  176



>ref|WP_039713404.1| preprotein translocase subunit TatA [Scytonema millei]
 gb|KIF21063.1| preprotein translocase subunit TatA [Scytonema millei VB511283]
Length=95

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  + FQ A+ EF++E K+E + + QA
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEIGRSLGKAIRSFQDASNEFQSEFKREAEQIEQA  62



>ref|WP_015157036.1| Sec-independent protein translocase TatA [Chroococcidiopsis thermalis]
 gb|AFY90498.1| Sec-independent protein translocase TatA [Chroococcidiopsis thermalis 
PCC 7203]
Length=95

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  + FQ A+ EF++E K+E + + QA
Sbjct  3    VFGIGLPEMALIFVVALLIFGPKKLPEIGRSLGKAIRSFQDASSEFQSEFKREAEQIEQA  62



>ref|WP_010312066.1| primosome subunit DnaD [Synechococcus sp. CB0101]
Length=87

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +FG+G+PEL VIA +  LVFGPK+LPE+G+++G+T KGFQ A+ EFE E +K  D++
Sbjct  3    VFGVGLPELAVIAAIGLLVFGPKRLPELGKTLGRTLKGFQSASSEFEKEFRKAVDTV  59



>gb|EKQ67486.1| twin arginine-targeting protein translocase, TatA/E family [Oscillatoriales 
cyanobacterium JSC-12]
Length=111

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A LVFGPKKLPE+GRS+GK  +GFQ+A+ EF+ E K+E + + +A
Sbjct  3    IFGIGLPEMALIFVIALLVFGPKKLPEIGRSLGKAIRGFQEASNEFQNEFKREAEQIEKA  62



>ref|WP_009459239.1| MULTISPECIES: primosome subunit DnaD [Fischerella]
 gb|EHC09741.1| Sec-independent protein translocase protein tatA/E-like protein 
[Fischerella sp. JSC-11]
Length=82

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ A+KEF+ E +KE
Sbjct  3    VFGIGLPEMALIMMVALLIFGPKKLPEIGRSLGKAIRGFQDASKEFQNEFQKE  55



>ref|WP_012306345.1| MULTISPECIES: primosome subunit DnaD [Synechococcus]
 gb|ACA98721.1| twin-arginine translocation protein [Synechococcus sp. PCC 7002]
Length=98

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  +A L+FGPKKLPE+GRS+GKT + FQ A+ EF+ E KKE + + + 
Sbjct  3    IFGIGLPEMALIFIIALLIFGPKKLPEIGRSLGKTIRSFQDASNEFQEEFKKEAEKIEKT  62

Query  305  PS  300
             S
Sbjct  63   VS  64



>ref|WP_009632533.1| twin arginine-targeting protein translocase, TatA/E family [Synechocystis 
sp. PCC 7509]
Length=104

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  + FQ A+K+FE E K+E + +  A
Sbjct  3    VFGIGLPEMALIMVVALLIFGPKKLPEIGRSMGKAIRSFQDASKDFENEFKREAEQIETA  62



>ref|WP_025782329.1| hypothetical protein [Candidatus Synechococcus spongiarum]
Length=98

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = -3

Query  488  CLFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQ  309
             +FG+G+PE+ VIA V  LVFGP+KLPE+GR++GKT K FQ A++EF   +  E    A 
Sbjct  2    SVFGVGLPEMAVIAVVGLLVFGPRKLPELGRTLGKTLKAFQSASQEFSNAVMAE----AN  57

Query  308  APSEGVEEINQQEKRDATVSSTKEDS  231
            AP   V    QQ    A VS  +  S
Sbjct  58   APETPVATTEQQVASPAVVSPAESGS  83



>gb|KIE07939.1| preprotein translocase subunit TatA [Tolypothrix bouteillei VB521301]
Length=82

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ A+KEF+ E +KE   + +A
Sbjct  3    VFGIGLPEMALIFIVALLIFGPKKLPEIGRSVGKAIRGFQDASKEFQNEFQKEAVQIEEA  62



>ref|WP_025956123.1| hypothetical protein [Prochlorococcus sp. scB243_498I20]
Length=89

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VI  +A L+FGPKKLPE+GRSIGKT K FQQA+ EF+ E++K
Sbjct  3    IFGVGIPEIAVIFVLALLIFGPKKLPELGRSIGKTLKSFQQASGEFQKEIEK  54



>gb|AFY84251.1| twin arginine-targeting protein translocase, TatA/E family [Oscillatoria 
acuminata PCC 6304]
Length=78

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  476  LGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSL  315
            +G+PE++VI  +A L+FGPKKLPE+GRS+GK  +GFQ A++EFE+E+K+E + +
Sbjct  1    MGLPEIMVILTIALLIFGPKKLPEIGRSMGKAIRGFQDASREFESEIKREAEQI  54



>ref|WP_016866312.1| primosome subunit DnaD [Fischerella muscicola]
Length=82

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKE  327
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  +GFQ A+KEF+ E +KE
Sbjct  3    VFGIGLPEMALIMIVALLIFGPKKLPEIGRSMGKAIRGFQDASKEFQNEFQKE  55



>ref|WP_015199060.1| Sec-independent protein translocase TatA [Calothrix parietina]
 gb|AFZ02433.1| Sec-independent protein translocase TatA [Calothrix sp. PCC 6303]
Length=82

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
             FG+G+PE+ +I  VA LVFGPKKLPE+GRS+GK  +GFQ+A++EF+ E +KE   L +A
Sbjct  3    FFGIGLPEMGLIMVVALLVFGPKKLPEIGRSMGKAIRGFQEASREFQDEFQKEAVQLQEA  62



>ref|WP_017322731.1| primosome subunit DnaD [cyanobacterium PCC 7702]
Length=82

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKKEPDSLAQA  306
            +FG+G+PE+ +I  VA L+FGPKKLPE+GRS+GK  + FQ A++EF+ E +KE   L +A
Sbjct  3    IFGIGLPEMALIMIVALLIFGPKKLPEIGRSLGKAIRSFQDASREFQNEFQKEAVQLEEA  62



>ref|WP_038651129.1| translocase [Prochlorococcus sp. MIT 0801]
 gb|AIQ96436.1| Twin-arginine translocation protein TatA [Prochlorococcus sp. 
MIT 0801]
Length=71

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VIAG+A ++FGPK+LPE GR+IGKT KG Q A+ EFE E++ 
Sbjct  3    IFGVGLPEIAVIAGLALIIFGPKRLPEFGRTIGKTLKGLQSASTEFEREIQN  54



>ref|WP_036916527.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
Length=77

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  485  LFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGKTFKGFQQAAKEFETELKK  330
            +FG+G+PE+ VI  +A +VFGPKKLPE+GR+IGKT K  Q+A+ EFE EL+K
Sbjct  3    IFGVGLPEIAVIVALALVVFGPKKLPELGRNIGKTLKSLQKASSEFENELQK  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960