BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN015C05

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      186   3e-53   Nicotiana tomentosiformis
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      185   1e-52   Nicotiana sylvestris
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      184   2e-52   Nicotiana tomentosiformis
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      181   4e-51   Nicotiana sylvestris
emb|CDP21869.1|  unnamed protein product                                179   1e-50   Coffea canephora [robusta coffee]
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              178   2e-50   
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      179   2e-50   Solanum tuberosum [potatoes]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           178   3e-50   Solanum lycopersicum
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      178   4e-50   Solanum lycopersicum
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           177   1e-49   Malus domestica [apple tree]
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      176   2e-49   Cicer arietinum [garbanzo]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           176   2e-49   Sesamum indicum [beniseed]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         175   5e-49   Jatropha curcas
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           176   5e-49   Pyrus x bretschneideri [bai li]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      175   7e-49   Nelumbo nucifera [Indian lotus]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             174   1e-48   Prunus persica
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      174   2e-48   Solanum tuberosum [potatoes]
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      173   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      172   4e-48   Solanum tuberosum [potatoes]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  172   9e-48   Medicago truncatula
gb|AFK49564.1|  unknown                                                 172   9e-48   Medicago truncatula
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           172   1e-47   Brassica rapa
emb|CDX77481.1|  BnaA07g06190D                                          171   1e-47   
emb|CDX85133.1|  BnaC07g07730D                                          171   1e-47   
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      172   2e-47   Citrus sinensis [apfelsine]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             172   2e-47   Citrus clementina [clementine]
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    171   2e-47   Arabis alpina [alpine rockcress]
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           171   3e-47   Fragaria vesca subsp. vesca
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           170   3e-47   Vitis vinifera
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           170   4e-47   Brassica rapa
emb|CDY64583.1|  BnaCnng44170D                                          170   4e-47   Brassica napus [oilseed rape]
emb|CDX92990.1|  BnaA03g37120D                                          170   4e-47   
emb|CDY53207.1|  BnaC03g74010D                                          170   4e-47   Brassica napus [oilseed rape]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    170   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      170   4e-47   Populus euphratica
emb|CDY18087.1|  BnaA01g23480D                                          170   5e-47   Brassica napus [oilseed rape]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      170   5e-47   Cucumis sativus [cucumbers]
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       170   5e-47   Gossypium hirsutum [American cotton]
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      169   1e-46   Brassica rapa
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           169   1e-46   Cucumis melo [Oriental melon]
dbj|BAE71216.1|  putative NAD dependent epimerase                       169   1e-46   Trifolium pratense [peavine clover]
gb|KJB72008.1|  hypothetical protein B456_011G153500                    169   1e-46   Gossypium raimondii
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      169   1e-46   Populus euphratica
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      168   2e-46   Morus notabilis
gb|AAN60250.1|  unknown                                                 168   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    168   3e-46   Theobroma cacao [chocolate]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       168   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     168   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           168   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             168   4e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             167   4e-46   Capsella rubella
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             167   4e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           167   5e-46   Tarenaya hassleriana [spider flower]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   167   6e-46   Citrus sinensis [apfelsine]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      165   3e-45   Camelina sativa [gold-of-pleasure]
emb|CAN83418.1|  hypothetical protein VITISV_041351                     165   4e-45   Vitis vinifera
gb|KJB28115.1|  hypothetical protein B456_005G028000                    163   1e-44   Gossypium raimondii
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      163   2e-44   Glycine max [soybeans]
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       163   2e-44   Gossypium hirsutum [American cotton]
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           160   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    158   9e-43   Glycine max [soybeans]
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           158   1e-42   Eucalyptus grandis [rose gum]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      158   2e-42   Glycine max [soybeans]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             155   8e-42   Phaseolus vulgaris [French bean]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           155   2e-41   Phaseolus vulgaris [French bean]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       154   2e-41   Phaseolus vulgaris [French bean]
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          152   3e-40   Amborella trichopoda
gb|ABK25339.1|  unknown                                                 151   3e-40   Picea sitchensis
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             150   1e-39   
ref|XP_002511693.1|  UDP-glucuronate 5-epimerase, putative              142   2e-39   
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      150   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16292.1|  unknown                                                 149   2e-39   Picea sitchensis
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   3e-39   Phoenix dactylifera
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    149   5e-39   Phoenix dactylifera
ref|XP_006386474.1|  hypothetical protein POPTR_0002s11750g             142   8e-39   
emb|CDY67756.1|  BnaA03g56770D                                          147   8e-39   Brassica napus [oilseed rape]
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           147   8e-39   Brassica rapa
emb|CAN73017.1|  hypothetical protein VITISV_004389                     140   8e-39   Vitis vinifera
emb|CAN83831.1|  hypothetical protein VITISV_003974                     140   1e-38   Vitis vinifera
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   1e-38   Elaeis guineensis
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX95646.1|  BnaC03g25270D                                          147   2e-38   
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             146   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           146   3e-38   Populus euphratica
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630          145   4e-38   Amborella trichopoda
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             145   5e-38   Eutrema salsugineum [saltwater cress]
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             145   9e-38   Capsella rubella
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           145   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    144   1e-37   Arabidopsis lyrata subsp. lyrata
emb|CDP09891.1|  unnamed protein product                                145   1e-37   Coffea canephora [robusta coffee]
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      144   1e-37   
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       144   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      144   1e-37   Elaeis guineensis
emb|CDO97699.1|  unnamed protein product                                144   2e-37   Coffea canephora [robusta coffee]
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     144   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      144   2e-37   Populus euphratica
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      143   4e-37   Cicer arietinum [garbanzo]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      142   7e-37   Solanum tuberosum [potatoes]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      142   8e-37   Solanum lycopersicum
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      142   9e-37   Nicotiana tomentosiformis
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           142   9e-37   Tarenaya hassleriana [spider flower]
gb|KHN25558.1|  UDP-glucuronate 4-epimerase 3                           138   1e-36   Glycine soja [wild soybean]
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             142   1e-36   Prunus persica
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             142   1e-36   Citrus clementina [clementine]
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      142   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU31982.1|  hypothetical protein MIMGU_mgv1a012102mg                138   1e-36   Erythranthe guttata [common monkey flower]
dbj|BAF00333.1|  putative nucleotide sugar epimerase                    139   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    142   1e-36   
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           141   1e-36   Medicago truncatula
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      141   1e-36   Solanum lycopersicum
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       141   2e-36   Gossypium hirsutum [American cotton]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           141   2e-36   Cucumis melo [Oriental melon]
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      141   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      141   2e-36   
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      140   3e-36   
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           140   3e-36   
emb|CAN73016.1|  hypothetical protein VITISV_004388                     140   3e-36   Vitis vinifera
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           140   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      140   6e-36   Nicotiana sylvestris
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      140   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           140   7e-36   Elaeis guineensis
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      140   7e-36   Vitis vinifera
gb|AFK41785.1|  unknown                                                 133   8e-36   Medicago truncatula
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      139   8e-36   Vitis vinifera
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      139   8e-36   Solanum tuberosum [potatoes]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         139   9e-36   Jatropha curcas
ref|XP_001761086.1|  predicted protein                                  139   1e-35   
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           139   1e-35   Eucalyptus grandis [rose gum]
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    139   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KJB09908.1|  hypothetical protein B456_001G174300                    139   1e-35   Gossypium raimondii
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      139   1e-35   Nicotiana sylvestris
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       139   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           139   1e-35   Nicotiana tomentosiformis
emb|CBI24539.3|  unnamed protein product                                137   1e-35   Vitis vinifera
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      139   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             139   2e-35   
emb|CDY63064.1|  BnaAnng18570D                                          139   2e-35   Brassica napus [oilseed rape]
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             139   2e-35   Phaseolus vulgaris [French bean]
gb|EMT26004.1|  UDP-glucuronate 4-epimerase 4                           133   2e-35   
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    138   2e-35   
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      139   2e-35   Morus notabilis
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           139   2e-35   Brassica rapa
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              139   2e-35   Selaginella moellendorffii
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      138   2e-35   Nicotiana sylvestris
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         138   2e-35   Jatropha curcas
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    138   2e-35   Arabis alpina [alpine rockcress]
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      138   2e-35   Glycine max [soybeans]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           138   3e-35   Solanum lycopersicum
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      138   3e-35   Glycine max [soybeans]
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      137   4e-35   Sesamum indicum [beniseed]
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    137   4e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           137   4e-35   
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           137   5e-35   
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           137   5e-35   Pyrus x bretschneideri [bai li]
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           137   5e-35   
gb|KJB41101.1|  hypothetical protein B456_007G090500                    137   5e-35   Gossypium raimondii
gb|EYU31498.1|  hypothetical protein MIMGU_mgv1a008581mg                136   6e-35   Erythranthe guttata [common monkey flower]
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      137   6e-35   Solanum tuberosum [potatoes]
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    137   7e-35   Arabis alpina [alpine rockcress]
emb|CBI22155.3|  unnamed protein product                                133   8e-35   Vitis vinifera
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             137   9e-35   Eutrema salsugineum [saltwater cress]
gb|KJB24820.1|  hypothetical protein B456_004G162700                    136   9e-35   Gossypium raimondii
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      136   9e-35   Phoenix dactylifera
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      136   1e-34   Solanum lycopersicum
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      136   1e-34   Vitis vinifera
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      135   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      136   1e-34   
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      136   1e-34   Sesamum indicum [beniseed]
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           136   1e-34   Elaeis guineensis
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           136   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           136   1e-34   Sesamum indicum [beniseed]
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    136   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           136   2e-34   Nicotiana tomentosiformis
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           135   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           135   3e-34   Phoenix dactylifera
emb|CBI18845.3|  unnamed protein product                                132   3e-34   Vitis vinifera
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      134   5e-34   Cicer arietinum [garbanzo]
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             135   5e-34   
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              135   5e-34   
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           134   5e-34   Fragaria vesca subsp. vesca
gb|EPS60141.1|  hypothetical protein M569_14661                         134   5e-34   Genlisea aurea
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             134   5e-34   Capsella rubella
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             134   5e-34   Citrus clementina [clementine]
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      134   6e-34   Nicotiana tomentosiformis
ref|XP_008776445.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      128   6e-34   Phoenix dactylifera
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      134   8e-34   Prunus mume [ume]
gb|KGN57287.1|  hypothetical protein Csa_3G176330                       131   8e-34   Cucumis sativus [cucumbers]
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             134   8e-34   Prunus persica
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        134   8e-34   Medicago truncatula
ref|XP_010662214.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           132   1e-33   Vitis vinifera
emb|CDP21367.1|  unnamed protein product                                134   1e-33   Coffea canephora [robusta coffee]
gb|KHN17533.1|  UDP-glucuronate 4-epimerase 1                           130   1e-33   Glycine soja [wild soybean]
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160          134   1e-33   Amborella trichopoda
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             133   1e-33   Prunus persica
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      132   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           133   1e-33   Prunus mume [ume]
gb|EPS72617.1|  hypothetical protein M569_02133                         133   1e-33   Genlisea aurea
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           133   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              133   2e-33   Ricinus communis
ref|XP_001759693.1|  predicted protein                                  133   2e-33   
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      133   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110          133   2e-33   Amborella trichopoda
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           133   2e-33   Prunus mume [ume]
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      132   2e-33   Solanum tuberosum [potatoes]
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             132   2e-33   
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       132   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    132   2e-33   
ref|XP_001777338.1|  predicted protein                                  132   3e-33   
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             132   3e-33   Populus trichocarpa [western balsam poplar]
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   132   3e-33   Citrus sinensis [apfelsine]
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           132   3e-33   Medicago truncatula
gb|EMT33438.1|  UDP-glucuronate 4-epimerase 6                           129   4e-33   
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                132   4e-33   Erythranthe guttata [common monkey flower]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          132   5e-33   Sorghum bicolor [broomcorn]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           132   5e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      132   5e-33   Oryza brachyantha
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      132   5e-33   Populus euphratica
ref|NP_001048359.1|  Os02g0791500                                       132   5e-33   
dbj|BAJ88176.1|  predicted protein                                      132   5e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      132   6e-33   
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           132   6e-33   Nelumbo nucifera [Indian lotus]
gb|KJB76605.1|  hypothetical protein B456_012G096800                    132   6e-33   Gossypium raimondii
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      131   6e-33   Pyrus x bretschneideri [bai li]
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           132   6e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    131   6e-33   Malus domestica [apple tree]
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           131   6e-33   Nicotiana tomentosiformis
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      131   6e-33   Setaria italica
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           130   6e-33   Glycine soja [wild soybean]
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           131   6e-33   Medicago truncatula
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      132   7e-33   Brachypodium distachyon [annual false brome]
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           131   7e-33   Cucumis melo [Oriental melon]
dbj|BAJ85817.1|  predicted protein                                      131   8e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      131   1e-32   Morus notabilis
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      130   1e-32   
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           131   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      130   1e-32   Cucumis sativus [cucumbers]
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     130   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      130   1e-32   Glycine max [soybeans]
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                130   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           130   1e-32   Nicotiana sylvestris
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    130   1e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           130   1e-32   Populus euphratica
emb|CAN60968.1|  hypothetical protein VITISV_008097                     130   1e-32   Vitis vinifera
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      130   1e-32   Glycine max [soybeans]
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             130   1e-32   Phaseolus vulgaris [French bean]
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           130   1e-32   Sesamum indicum [beniseed]
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      130   2e-32   Phoenix dactylifera
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      130   2e-32   Vitis vinifera
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           130   2e-32   
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       130   2e-32   Gossypium hirsutum [American cotton]
ref|XP_001754001.1|  predicted protein                                  130   2e-32   
gb|EEC83913.1|  hypothetical protein OsI_29968                          127   2e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001105911.1|  LOC732831                                          130   2e-32   Zea mays [maize]
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      130   2e-32   Populus euphratica
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             129   2e-32   Populus trichocarpa [western balsam poplar]
gb|KDP38751.1|  hypothetical protein JCGZ_04104                         130   2e-32   Jatropha curcas
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    130   2e-32   Zea mays [maize]
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                130   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      130   3e-32   Cicer arietinum [garbanzo]
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    129   3e-32   Arabis alpina [alpine rockcress]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      129   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           129   3e-32   Eucalyptus grandis [rose gum]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           129   3e-32   Brassica rapa
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           129   4e-32   Fragaria vesca subsp. vesca
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      129   4e-32   Zea mays [maize]
ref|NP_001147328.1|  protein capI                                       129   5e-32   Zea mays [maize]
emb|CDY70926.1|  BnaCnng70410D                                          129   5e-32   Brassica napus [oilseed rape]
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      129   5e-32   Solanum tuberosum [potatoes]
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      129   5e-32   
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           129   5e-32   Solanum lycopersicum
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      129   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      129   6e-32   Morus notabilis
ref|XP_010113442.1|  UDP-glucuronate 4-epimerase 3                      127   6e-32   
ref|XP_001751991.1|  predicted protein                                  129   6e-32   
ref|NP_001142515.1|  hypothetical protein                               129   6e-32   Zea mays [maize]
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      129   6e-32   Eucalyptus grandis [rose gum]
dbj|BAJ86203.1|  predicted protein                                      129   6e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          129   8e-32   Sorghum bicolor [broomcorn]
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           128   9e-32   
dbj|BAH20281.1|  AT4G30440                                              125   9e-32   
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           128   1e-31   
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      128   1e-31   
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      128   1e-31   
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      128   1e-31   
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      128   1e-31   
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           128   1e-31   
ref|NP_001049561.1|  Os03g0249500                                       128   1e-31   
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      127   1e-31   
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      127   1e-31   
ref|NP_001062295.1|  Os08g0526100                                       128   2e-31   
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      127   2e-31   
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    127   2e-31   
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           127   2e-31   
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      127   2e-31   
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           127   2e-31   
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      127   2e-31   
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           127   2e-31   
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      127   2e-31   
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      127   2e-31   
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          127   2e-31   
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      127   2e-31   
dbj|BAK06545.1|  predicted protein                                      127   3e-31   
emb|CDX97356.1|  BnaA02g21470D                                          127   3e-31   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      127   3e-31   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      127   3e-31   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      126   3e-31   
emb|CDY39205.1|  BnaA03g50170D                                          126   4e-31   
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             126   4e-31   
emb|CDX72242.1|  BnaC07g42640D                                          126   4e-31   
ref|XP_001769370.1|  predicted protein                                  126   4e-31   
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                           126   4e-31   
ref|XP_001761984.1|  predicted protein                                  126   5e-31   
dbj|BAJ99315.1|  predicted protein                                      126   6e-31   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           126   7e-31   
gb|EMS47781.1|  UDP-glucuronate 4-epimerase 6                           125   7e-31   
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           125   8e-31   
emb|CDY04398.1|  BnaC02g28500D                                          125   8e-31   
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             125   8e-31   
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       125   8e-31   
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      126   8e-31   
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          127   8e-31   
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          125   9e-31   
gb|KJB27035.1|  hypothetical protein B456_004G273500                    125   1e-30   
ref|XP_006660306.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      123   1e-30   
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      125   1e-30   
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      125   1e-30   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    125   1e-30   
gb|EEC83914.1|  hypothetical protein OsI_29969                          126   1e-30   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      124   2e-30   
gb|KJB23560.1|  hypothetical protein B456_004G105200                    124   2e-30   
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                           124   2e-30   
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      125   2e-30   
ref|XP_001767292.1|  predicted protein                                  124   2e-30   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             124   3e-30   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   124   3e-30   
gb|KGN65261.1|  hypothetical protein Csa_1G277970                       124   3e-30   
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      124   3e-30   
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      124   3e-30   
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                124   3e-30   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      124   3e-30   
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           122   9e-30   
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             122   9e-30   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      123   1e-29   
ref|XP_010092236.1|  UDP-glucuronate 4-epimerase 3                      119   1e-29   
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           124   1e-29   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    122   2e-29   
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      122   2e-29   
gb|KJB25649.1|  hypothetical protein B456_004G202200                    122   2e-29   
gb|EEC84839.1|  hypothetical protein OsI_31939                          122   2e-29   
ref|NP_001063595.1|  Os09g0504000                                       122   2e-29   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    121   3e-29   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      121   3e-29   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    120   4e-29   
ref|NP_001057015.1|  Os06g0187200                                       119   5e-29   
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    120   1e-28   
gb|EAY99954.1|  hypothetical protein OsI_21957                          120   1e-28   
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           119   1e-28   
gb|EAZ36080.1|  hypothetical protein OsJ_20391                          119   1e-28   
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           119   1e-28   
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           119   1e-28   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           119   2e-28   
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           119   2e-28   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      119   3e-28   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                         117   5e-28   
gb|KJB43946.1|  hypothetical protein B456_007G225300                    117   6e-28   
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      117   9e-28   
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                           117   1e-27   
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           115   3e-27   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           115   3e-27   
ref|XP_001781238.1|  predicted protein                                  115   4e-27   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      115   5e-27   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             115   5e-27   
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      115   5e-27   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          115   6e-27   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        114   6e-27   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      114   8e-27   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      114   9e-27   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         114   1e-26   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      114   1e-26   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    114   1e-26   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    113   1e-26   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           114   1e-26   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    113   2e-26   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    113   2e-26   
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             113   2e-26   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    113   2e-26   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    113   2e-26   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      113   2e-26   
gb|EPS64795.1|  hypothetical protein M569_09984                         112   3e-26   
gb|AEW08736.1|  hypothetical protein CL1437Contig1_03                   105   6e-26   
ref|XP_009114689.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      109   2e-25   
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             110   2e-25   
gb|AEW08737.1|  hypothetical protein CL1437Contig1_03                   103   2e-25   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              110   2e-25   
gb|AAK93670.1|  putative nucleotide sugar epimerase                     110   2e-25   
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    110   3e-25   
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       110   3e-25   
emb|CDX94504.1|  BnaC09g23320D                                          110   3e-25   
emb|CDX86716.1|  BnaA09g21060D                                          110   3e-25   
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    110   3e-25   
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    109   4e-25   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             109   6e-25   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      108   7e-25   
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      108   8e-25   
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      108   1e-24   
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    108   1e-24   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    108   1e-24   
dbj|BAD43886.1|  putative nucleotide sugar epimerase                    100   3e-24   
ref|XP_001416501.1|  predicted protein                                  104   3e-23   
gb|ACF83801.1|  unknown                                               98.6    4e-23   
ref|XP_001422311.1|  predicted protein                                  102   1e-22   
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)          100   8e-22   
emb|CEG01274.1|  Nucleotide sugar epimerase                             100   9e-22   
ref|XP_007512695.1|  predicted protein                                  101   1e-21   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938            99.0    2e-21   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183            99.0    2e-21   
ref|XP_002504144.1|  predicted protein                                98.2    5e-21   
ref|XP_003060215.1|  protein arginine methyltransferase               94.7    5e-20   
ref|XP_009590502.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    82.8    2e-17   
gb|KDD76295.1|  hypothetical protein H632_c279p0                      84.0    6e-17   
ref|WP_006619621.1|  NAD-dependent epimerase                          85.5    8e-17   
ref|WP_008048763.1|  NAD-dependent epimerase                          85.5    9e-17   
ref|WP_006668268.1|  NAD-dependent epimerase                          85.5    9e-17   
gb|AFK37408.1|  unknown                                               80.5    1e-16   
gb|ACU24168.1|  unknown                                               79.7    2e-16   
ref|WP_017366130.1|  NAD dependent epimerase/dehydratase              83.6    4e-16   
ref|WP_010961674.1|  capsular polysaccharide biosynthesis protein I   83.6    4e-16   
ref|WP_006624959.1|  NAD-dependent epimerase                          83.2    6e-16   
ref|WP_027720591.1|  capsular biosynthesis protein CpsI               82.8    7e-16   
gb|KJB27036.1|  hypothetical protein B456_004G273500                  83.6    9e-16   
ref|WP_044606580.1|  capsular biosynthesis protein CpsI               82.4    1e-15   
ref|WP_037224794.1|  capsular biosynthesis protein CpsI               82.4    1e-15   
ref|WP_028382493.1|  capsular biosynthesis protein CpsI               82.4    1e-15   
ref|XP_728710.1|  NAD dependent epimerase/dehydratase                 83.6    1e-15   
ref|WP_019572150.1|  hypothetical protein                             80.5    2e-15   
ref|WP_040484163.1|  capsular biosynthesis protein CpsI               81.6    2e-15   
ref|WP_018867984.1|  hypothetical protein                             80.5    2e-15   
gb|ERT06558.1|  polysaccharide biosynthesis family protein            81.6    2e-15   
ref|WP_015188623.1|  UDP-glucuronate 5'-epimerase                     81.6    2e-15   
ref|WP_029408437.1|  hypothetical protein                             81.6    2e-15   
ref|WP_034407515.1|  capsular biosynthesis protein CpsI               81.6    2e-15   
ref|WP_039231487.1|  hypothetical protein                             81.3    2e-15   
ref|WP_011737215.1|  NAD-dependent epimerase/dehydratase              81.6    3e-15   
ref|WP_026609545.1|  capsular biosynthesis protein CpsI               81.3    3e-15   
ref|WP_037033802.1|  protein CapI                                     81.3    3e-15   
dbj|BAC42820.1|  putative nucleotide sugar epimerase                  76.6    3e-15   
ref|WP_027403384.1|  capsular biosynthesis protein CpsI               80.9    4e-15   
ref|WP_038033003.1|  capsular biosynthesis protein CpsI               77.4    4e-15   
ref|WP_034409299.1|  capsular biosynthesis protein CpsI               80.9    4e-15   
ref|WP_006509051.1|  nucleoside-diphosphate-sugar epimerase           80.5    5e-15   
ref|WP_020847554.1|  NAD-dependent epimerase/dehydratase family p...  80.5    5e-15   
ref|WP_040054469.1|  capsular biosynthesis protein CpsI               80.5    5e-15   
ref|WP_024775448.1|  capsule biosynthesis protein CapI                80.5    6e-15   
ref|WP_025209442.1|  capsule biosynthesis protein CapI                80.5    6e-15   
ref|WP_012954589.1|  NAD-dependent epimerase                          80.1    7e-15   
ref|WP_017714779.1|  hypothetical protein                             79.7    9e-15   
ref|WP_018137556.1|  hypothetical protein                             77.0    9e-15   
ref|WP_026280413.1|  hypothetical protein                             76.3    1e-14   
ref|WP_031482267.1|  capsular biosynthesis protein CpsI               79.7    1e-14   
ref|WP_011713745.1|  NAD-dependent epimerase/dehydratase              79.7    1e-14   
ref|WP_022953707.1|  NAD-dependent epimerase                          79.7    1e-14   
ref|WP_015335618.1|  Protein CapI                                     79.7    1e-14   
ref|WP_007639465.1|  NAD dependent epimerase/dehydratase family s...  79.7    1e-14   
ref|WP_012489003.1|  NAD dependent epimerase/dehydratase family s...  79.7    1e-14   
ref|WP_013111978.1|  NAD-dependent epimerase/dehydratase              79.7    1e-14   
ref|WP_015784959.1|  NAD-dependent epimerase                          79.3    1e-14   
ref|WP_015222004.1|  NAD-dependent epimerase/dehydratase              79.0    2e-14   
ref|WP_020879618.1|  NAD-dependent epimerase/dehydratase              79.3    2e-14   
ref|WP_038056960.1|  capsular biosynthesis protein CpsI               76.6    2e-14   
ref|WP_040536407.1|  capsular biosynthesis protein CpsI               79.0    2e-14   
ref|WP_019571808.1|  hypothetical protein                             77.0    2e-14   
gb|EHL29262.1|  nucleoside-diphosphate-sugar epimerase                79.0    2e-14   
ref|WP_011398658.1|  nucleoside-diphosphate-sugar epimerase           79.0    2e-14   
ref|WP_015853695.1|  NAD-dependent epimerase/dehydratase              79.0    2e-14   
emb|CAJ74935.1|  strongly similar to UDP-glucuronate 5'-epimerase     79.0    2e-14   
ref|WP_002484373.1|  NAD-dependent epimerase                          78.6    2e-14   
ref|WP_009015640.1|  MULTISPECIES: NAD-dependent epimerase            78.6    2e-14   
ref|WP_007817296.1|  UDP-glucuronate 5-epimerase                      78.6    2e-14   
ref|WP_027071813.1|  capsular biosynthesis protein CpsI               78.6    2e-14   
ref|WP_006508258.1|  nucleoside-diphosphate-sugar epimerase           78.6    2e-14   
ref|WP_009787825.1|  NAD-dependent epimerase                          78.6    3e-14   
ref|WP_029681351.1|  capsular biosynthesis protein CpsI               76.6    3e-14   
ref|WP_019531065.1|  hypothetical protein                             78.6    3e-14   
ref|WP_014128012.1|  NAD-dependent epimerase                          78.6    3e-14   
ref|WP_013250660.1|  UDP-glucuronate 5'-epimerase                     78.6    3e-14   
ref|WP_027083114.1|  capsular biosynthesis protein CpsI               78.6    3e-14   
ref|WP_018950679.1|  NAD dependent epimerase/dehydratase              78.2    3e-14   
ref|WP_011745567.1|  NAD-dependent epimerase/dehydratase              78.6    3e-14   
ref|WP_009631239.1|  nucleoside-diphosphate-sugar epimerase           78.6    3e-14   
ref|XP_010087859.1|  UDP-glucuronate 4-epimerase 3                    77.4    3e-14   
ref|WP_028579847.1|  capsular biosynthesis protein CpsI               78.6    3e-14   
ref|WP_042673135.1|  capsular biosynthesis protein CpsI               76.3    3e-14   
ref|WP_021339702.1|  NAD-dependent epimerase                          78.2    4e-14   
ref|WP_019025240.1|  MULTISPECIES: hypothetical protein               76.3    4e-14   
ref|WP_034264117.1|  hypothetical protein                             78.2    4e-14   
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase              78.2    4e-14   
ref|WP_019563259.1|  hypothetical protein                             76.3    4e-14   
ref|WP_024299561.1|  capsular biosynthesis protein CpsI               78.2    4e-14   
ref|WP_019023983.1|  MULTISPECIES: hypothetical protein               76.3    4e-14   



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 109/117 (93%), Gaps = 3/117 (3%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVRKLVSILENLLS+KAKKNVVKMPRNG
Sbjct  337  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVRKLVSILENLLSVKAKKNVVKMPRNG  396

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  352
            DVPFTHANVSLA +DFGYKPTTDLS GLRKFVKWYVSYYGIQSRVK E     +SDD
Sbjct  397  DVPFTHANVSLALRDFGYKPTTDLSIGLRKFVKWYVSYYGIQSRVKKE---NDRSDD  450



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNG
Sbjct  336  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNG  395

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH-PTHQSDD  352
            DVPFTHANVSLAY+DFGYKPTTDLSSGLRKFVKWY+SYYGIQS+V  EL+ P   S+D
Sbjct  396  DVPFTHANVSLAYRDFGYKPTTDLSSGLRKFVKWYLSYYGIQSKVNKELNSPNDHSED  453



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNG
Sbjct  336  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNG  395

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL-HPTHQSDD  352
            DVPFTHANVSLAY+DFGYKPTTDLSSGLRKFVKWY+SYYGIQS+V  EL  P   S+D
Sbjct  396  DVPFTHANVSLAYRDFGYKPTTDLSSGLRKFVKWYLSYYGIQSKVNKELDSPNDHSED  453



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 106/117 (91%), Gaps = 3/117 (3%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVRKLV ILENLL+IKAKKNVVKMPRNG
Sbjct  337  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVRKLVVILENLLNIKAKKNVVKMPRNG  396

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  352
            DVPFTHANVSLA +DFGYKPTTDLS GLRKFVKWYVSYYGIQ RVK E      SDD
Sbjct  397  DVPFTHANVSLALRDFGYKPTTDLSIGLRKFVKWYVSYYGIQPRVKKE---NDHSDD  450



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+ PAQLRVYNLGNTSPVSV KLVSILE LL++KAKK+V+KMPRNG
Sbjct  335  ALDTAEKSTGSGGKKRAPAQLRVYNLGNTSPVSVGKLVSILEGLLNVKAKKHVIKMPRNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  343
            DVP+THANVSLAYKDFGY+PTTDLS+GLRKFVKWY+SYYGIQS+VK E+  T++
Sbjct  395  DVPYTHANVSLAYKDFGYQPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATNE  448



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V KLVSILENLL+ KAKK+V+KMPRNG
Sbjct  284  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVSILENLLNTKAKKHVIKMPRNG  343

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDLSSGLRKFVKWYV YYGIQ++VKT+
Sbjct  344  DVPYTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVGYYGIQTKVKTQ  391



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 104/106 (98%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPVSV+KLV+ILENLL++KAKKNV+KMPRNG
Sbjct  336  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNLKAKKNVIKMPRNG  395

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVPFTHANVSLA +DFGYKPTTDLSSGLRKFVKWYVSYYGIQ RVK
Sbjct  396  DVPFTHANVSLALRDFGYKPTTDLSSGLRKFVKWYVSYYGIQPRVK  441



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPVSV+KLV+ILENLL++KAKK  +KMPRNG
Sbjct  340  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNLKAKKFFIKMPRNG  399

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVPFTHANVSLA +DFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK E
Sbjct  400  DVPFTHANVSLALRDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKKE  447



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            A+DTAEKSTGSGGKK+GPAQLRVYNLGNTSPVSV+KLV+ILENLL+IKAKKN+++MPRNG
Sbjct  328  AIDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVPFTHANVSLAY+DFGYKPTT+LSSGLRKFVKWY+SYYGIQ+R+K
Sbjct  388  DVPFTHANVSLAYRDFGYKPTTNLSSGLRKFVKWYLSYYGIQARIK  433



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V KLVSILE LLS KAKK+V+KMPRNG
Sbjct  343  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNG  402

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVP+THANV+LAYKDFGYKPTTDL+SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  403  DVPYTHANVTLAYKDFGYKPTTDLASGLRKFVKWYVSYYGIESRVKKEM  451



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPV V KLVSILENLLS KAKK+++KMPRNG
Sbjct  332  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  331
            DVP+THANV+LAYKDFGYKPTTDL++GLRKFVKWYV YYGIQSR+K E H
Sbjct  392  DVPYTHANVTLAYKDFGYKPTTDLATGLRKFVKWYVRYYGIQSRLKKENH  441



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 2/119 (2%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+ PAQLRVYNLGNT+PV+V KLV ILE+LL++KAKK+V+KMPRNG
Sbjct  341  ALDTAEKSTGSGGKKRAPAQLRVYNLGNTAPVTVGKLVGILESLLNVKAKKHVIKMPRNG  400

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPT--HQSDD  352
            DVPFTHANVSLAY+DFGYKPTTDL++GLRKFVKWYVSYYGI+SR K   H +    SDD
Sbjct  401  DVPFTHANVSLAYRDFGYKPTTDLAAGLRKFVKWYVSYYGIESRAKKGFHSSTNEHSDD  459



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V KLV+ILE+LL+ KAKK+++KMPRNG
Sbjct  340  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVAILESLLNTKAKKHIIKMPRNG  399

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQ+RVK E
Sbjct  400  DVPYTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQTRVKKE  447



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLR+YNLGNTSPV V KLVSILE LLS KAKK+V+KMPRNG
Sbjct  343  ALDTAQKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNG  402

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVP+THANV+LAYKDFGYKPTTDL+SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  403  DVPYTHANVTLAYKDFGYKPTTDLASGLRKFVKWYVSYYGIESRVKKEM  451



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPVSV KLVSILE LL++ AKKN++KMPRNG
Sbjct  334  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVSVGKLVSILEGLLNVNAKKNILKMPRNG  393

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVPFTHANVSLAY+DFGYKPTTDL++GLRKFVKWYVSYYGIQSR   E
Sbjct  394  DVPFTHANVSLAYRDFGYKPTTDLATGLRKFVKWYVSYYGIQSRANKE  441



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V KLVSILE LL  KAKK+V+KMPRNG
Sbjct  339  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPRNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVP+THANVSLAYKDFGYKPTTDL+SGLRKFVKWYVSYYGI +RVK E+
Sbjct  399  DVPYTHANVSLAYKDFGYKPTTDLASGLRKFVKWYVSYYGIDTRVKREM  447



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSV KLV+ILENLL++KAKKNV+KMPRNG
Sbjct  340  SLDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVNKLVTILENLLNVKAKKNVIKMPRNG  399

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN++LA KDFGYKPTTDLSSGLRKFVKWYVSYYGIQS+
Sbjct  400  DVPFTHANITLAKKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSK  443



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPVSV KLVSILE  LS+KAKKNVVKMPRNG
Sbjct  335  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVSVGKLVSILEGHLSMKAKKNVVKMPRNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVPFTHANVSLAY+DFGYKPTTDLS+GLRKFVKWYV YYGI S+   E
Sbjct  395  DVPFTHANVSLAYRDFGYKPTTDLSTGLRKFVKWYVGYYGIHSKANKE  442



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            A+DTAEKSTGSGGKK+GPAQLRVYNLGNTSPVSV+KLV+ILENLL+IKAKKN+++MP+NG
Sbjct  329  AIDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPQNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVPFTHANVSLAY+DFGY+PTT+LSSGLRKFVKWY+SYYG+Q+R K
Sbjct  389  DVPFTHANVSLAYRDFGYRPTTNLSSGLRKFVKWYLSYYGMQARTK  434



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V KLVSILENLLS KAKK+++KMPRNG
Sbjct  332  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANV++AYKDF YKPTTDL++GLRKFVKWYV YYGIQSR+K E
Sbjct  392  DVPYTHANVTMAYKDFAYKPTTDLATGLRKFVKWYVRYYGIQSRLKKE  439



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V KLVSILENLLS KAKK+++KMPRNG
Sbjct  332  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANV++AYKDF YKPTTDL++GLRKFVKWYV YYGIQSR+K E
Sbjct  392  DVPYTHANVTMAYKDFAYKPTTDLATGLRKFVKWYVRYYGIQSRLKKE  439



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  339  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAY+DFGYKPTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  399  DVPYTHANVSLAYRDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE  446



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  338  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  397

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAY+DFGYKPTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  398  DVPYTHANVSLAYRDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE  445



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  341  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  400

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAY+DFGYKPTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  401  DVPYTHANVSLAYRDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE  448



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA KSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNG
Sbjct  352  ALDTAGKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNG  411

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  412  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE  459



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA KSTGS GKK+GPAQLRVYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNG
Sbjct  352  ALDTAGKSTGSRGKKRGPAQLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNG  411

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  412  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE  459



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KA+K+++KMPRNG
Sbjct  343  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKARKHLIKMPRNG  402

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  346
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYVSYYG+Q RVK E     +S
Sbjct  403  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVSYYGVQPRVKKETSHAEES  457



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V +LVSILE LL+ KAKK+V+KMPRNG
Sbjct  341  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGRLVSILEALLNSKAKKHVIKMPRNG  400

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLA  DFGYKPTTDL+SGLRKFVKWYVSYYGI+SRVKTE
Sbjct  401  DVPYTHANVSLALHDFGYKPTTDLASGLRKFVKWYVSYYGIESRVKTE  448



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPV V +LV ILE LL++KAKK+V+KMPRNG
Sbjct  332  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAY+DFGYKP+TDL++GLR+FVKWYVSYYGIQ+RVK E
Sbjct  392  DVPYTHANVSLAYRDFGYKPSTDLATGLRRFVKWYVSYYGIQTRVKKE  439



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  345  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNG  404

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  405  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKRE  452



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  345  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNG  404

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  405  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKRE  452



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  341  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  400

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAY+DFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  401  DVPYTHANVSLAYRDFGYKPTTDLATGLRKFVKWYVGYYGIQPRVKKE  448



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSG KK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  340  ALDTAEKSTGSGRKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  399

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAY+DFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  400  DVPYTHANVSLAYRDFGYKPTTDLATGLRKFVKWYVGYYGIQPRVKKE  447



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LV ILE LL  KAKK+V+KMPRNG
Sbjct  345  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVGILEGLLGTKAKKHVIKMPRNG  404

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVP+THANVSLAY+DFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E+
Sbjct  405  DVPYTHANVSLAYRDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKREI  453



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGS GKKKGPAQLRVYNLGNTSPV V KLVSILE LLS KA+K+V+KMPRNG
Sbjct  337  ALDTAEKSTGSSGKKKGPAQLRVYNLGNTSPVPVGKLVSILEGLLSTKARKHVIKMPRNG  396

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVP+THANV+LAY+DFGYKPTTDL++GLRKFVKWYV YYGIQ+RVK
Sbjct  397  DVPYTHANVTLAYRDFGYKPTTDLATGLRKFVKWYVDYYGIQTRVK  442



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  345  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNG  404

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  405  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKRE  452



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNG
Sbjct  343  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNG  402

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVPFTHANVSLA KDFGYKPTTDL +GLRKFVKWYV YYGIQSRV+ E
Sbjct  403  DVPFTHANVSLALKDFGYKPTTDLPTGLRKFVKWYVGYYGIQSRVRKE  450



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSG KKKG AQLRVYNLGNTSPV V +LVSILE LLS KAKK+V+ MPRNG
Sbjct  339  ALDTAEKSTGSGEKKKGAAQLRVYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  346
            DVPFTHANV+LA+KDFGYKPTTDLS+GLRKFVKWY+SYYGIQS+ + E   T +S
Sbjct  399  DVPFTHANVTLAFKDFGYKPTTDLSTGLRKFVKWYISYYGIQSKTRKESQATGES  453



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  341  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  400

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVPFTHANVSLAY+DFGYKPTTDL++GLRKFVKWYV YYGIQ R K E
Sbjct  401  DVPFTHANVSLAYRDFGYKPTTDLATGLRKFVKWYVGYYGIQPRGKKE  448



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNG
Sbjct  343  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNG  402

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVPFTHANVSLA KDFGYKPTTDL +GLRKFVKWYV YYGIQSRVK ++
Sbjct  403  DVPFTHANVSLALKDFGYKPTTDLPTGLRKFVKWYVGYYGIQSRVKRKV  451



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR+YNLGNTSPV V KLV+ILENLL+ KAKK+V+KMPRNG
Sbjct  332  ALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVTILENLLTTKAKKHVIKMPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANV+LAY+DFGYKP TDLS+GLRKFVKWYV YYGIQ R+K E
Sbjct  392  DVPYTHANVTLAYRDFGYKPVTDLSTGLRKFVKWYVRYYGIQPRLKKE  439



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKG AQLRVYNLGNTSPV V +LVSILE LLS KAKK+V+ MPRNG
Sbjct  339  ALDTAEKSTGSGGKKKGAAQLRVYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  346
            DVPFTHANV+LA+KDFGYKPTTDLS+GLRKFVKWY+SYYGIQS+   E   T +S
Sbjct  399  DVPFTHANVTLAFKDFGYKPTTDLSTGLRKFVKWYISYYGIQSKTGKESQATGES  453



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LLS KAKK+V+KMPRNG
Sbjct  337  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGNLVSILEGLLSTKAKKHVIKMPRNG  396

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVP+THANV+LA+KDFGYKPTTDL++GLRKFVKWYV+YYGIQ+RVK
Sbjct  397  DVPYTHANVTLAFKDFGYKPTTDLATGLRKFVKWYVNYYGIQTRVK  442



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPV V KLV ILE+LL+ KAKK+V++MPRNG
Sbjct  338  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGKLVGILESLLTTKAKKHVIRMPRNG  397

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLA +DFGYKPTTDLS+GLRKFV+WYVSYYGIQ+RVK E
Sbjct  398  DVPYTHANVSLANRDFGYKPTTDLSTGLRKFVRWYVSYYGIQTRVKKE  445



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  345  ALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  404

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  349
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  405  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA KSTGSGGKKKGPAQLRVYNLGNTSPV V +LVSILE LL+ KAKK+V+ MPRNG
Sbjct  338  ALDTAGKSTGSGGKKKGPAQLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVITMPRNG  397

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  346
            DVPFTHANV+LAYKDFGYKPTTDL++GLRKFVKWYVSY+GIQ RVK E     +S
Sbjct  398  DVPFTHANVTLAYKDFGYKPTTDLATGLRKFVKWYVSYFGIQRRVKKETQHADES  452



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  345  ALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  404

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  349
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  405  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LLS KAKK+V+KMPRNG
Sbjct  338  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVANLVSILEGLLSTKAKKHVIKMPRNG  397

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVP+THANV+LA+KDFGYKP+TDL++GLRKFVKWYV+YYGIQ+RVK
Sbjct  398  DVPYTHANVTLAFKDFGYKPSTDLATGLRKFVKWYVNYYGIQTRVK  443



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  347  ALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  406

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  349
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  407  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKKET--SHAED  460



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  346  ALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  405

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  406  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKKE  453



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  347  ALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  406

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  407  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKKE  454



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPA LRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  346  ALDTAEKSTGSGGKKRGPAMLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  405

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVSLAY+DFGYKPTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  406  DVPYTHANVSLAYRDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKRE  453



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V KLV ILE LL  KAKK+V+KMPRNG
Sbjct  342  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVGILEGLLGTKAKKHVIKMPRNG  401

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVP+THANVSLAY+DFGYKP TDL++GLRKFVKWYV YYGI  RVK E+
Sbjct  402  DVPYTHANVSLAYRDFGYKPATDLAAGLRKFVKWYVGYYGIHPRVKREI  450



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  53   PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFG  232
            PAQLRVYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFG
Sbjct  362  PAQLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFG  421

Query  233  YKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            YKPTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  422  YKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE  452



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNG
Sbjct  347  ALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNG  406

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVP+THANVSLAYKDFGYKPTTDL++GLRKFVKWYV YYGIQ RVK
Sbjct  407  DVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVK  452



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPV V +LV ILE LL++KAKK+V+KMPRNG
Sbjct  332  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVP+THANVSLAY+DFGYKP+TDL++GLR+FVKWYVSYYGIQ+R+
Sbjct  392  DVPYTHANVSLAYRDFGYKPSTDLATGLRRFVKWYVSYYGIQTRL  436



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V +LVSILE LL+ KAKK+VV +PRNG
Sbjct  294  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPRNG  353

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANV+LAYKDFGYKPTTDLSSGLRKFVKWYV+Y+GI+S+   E
Sbjct  354  DVPYTHANVTLAYKDFGYKPTTDLSSGLRKFVKWYVNYFGIESKHSKE  401



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LLS KAKK+V+KMP NG
Sbjct  349  ALDTAQKSTGSGGKKKGPAQLRVYNLGNTSPVPVGTLVSILEGLLSTKAKKHVIKMPSNG  408

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  331
            DVPFTHANVSLAY+DF Y PTTDL++GLRKFVKWY+ YYG+Q R+K E H
Sbjct  409  DVPFTHANVSLAYRDFSYNPTTDLATGLRKFVKWYLGYYGLQQRLKKEYH  458



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V +LVSILE LL+ KAKK+VV +PRNG
Sbjct  338  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPRNG  397

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANV+LAYKDFGYKPTTDLSSGLRKFVKWYV+Y+GI+S+   E
Sbjct  398  DVPYTHANVTLAYKDFGYKPTTDLSSGLRKFVKWYVNYFGIESKHSKE  445



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRVYNLGNTSPV V +LVSILE LL++KAKK+++ MPRNG
Sbjct  335  ALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVARLVSILEGLLNVKAKKHLITMPRNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANV+LA KDF YKPTTDL++GLRKFVKWYV YYG+Q  VK E
Sbjct  395  DVPYTHANVTLARKDFAYKPTTDLATGLRKFVKWYVGYYGVQPSVKKE  442



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG GGKK G AQLRVYNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNG
Sbjct  304  ALDTAEKSTGGGGKKHGAAQLRVYNLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNG  363

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVPFTHANVSLA++DFGYKPTTDL++GLRKFV+WYV YYG++  V+ E
Sbjct  364  DVPFTHANVSLAWRDFGYKPTTDLATGLRKFVQWYVGYYGVRLGVEKE  411



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGG+KK PAQLRVYNLGNTSPV V +LV ILE+LL  KAK++V+ MPRNG
Sbjct  335  ALDTAQKSTGSGGRKKAPAQLRVYNLGNTSPVPVGRLVGILESLLGTKAKRHVITMPRNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVPFTHANV+LA +DFGYKPTTDL++GLRKFVKWYVSYYG++ R K +
Sbjct  395  DVPFTHANVTLAGRDFGYKPTTDLATGLRKFVKWYVSYYGVEPRSKKD  442



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkg-PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRN  178
            ALDTAEKSTG    KK  PAQLRVYNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRN
Sbjct  379  ALDTAEKSTGGVVGKKRGPAQLRVYNLGNTSPVPVGKLVSVLETLLGVKAKKHVIKMPRN  438

Query  179  GDVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  331
            GDVPFTHANVSLA++D GYKPTTDL++GLRKFV+WYV YYG++  V+ E H
Sbjct  439  GDVPFTHANVSLAWRDLGYKPTTDLAAGLRKFVQWYVGYYGVRLGVEKEKH  489



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPV V  LVSILENLL+ KAK++V+KMP NG
Sbjct  325  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVS A++DF YKPTTDL SGLRKFVKWYV YYG Q R K E
Sbjct  385  DVPYTHANVSQAFRDFSYKPTTDLPSGLRKFVKWYVGYYGPQLRPKKE  432



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR+YNLGNTSPV V  LVSILENLL+ KAK++V+KMP NG
Sbjct  325  ALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVP+THANVS A++DF YKPTTDL SGLRKFVKWYV YYG Q R K E 
Sbjct  385  DVPYTHANVSQAFRDFFYKPTTDLPSGLRKFVKWYVGYYGPQLRPKKEF  433



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQ R+YNLGNTSPV V  LVSILENLL+ KAK++V+KMP NG
Sbjct  325  ALDTAEKSTGSGGKKRGPAQFRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTE  325
            DVP+THANVS A++DF YKPTTDL SGLRKFVKWYV YYG Q R K E
Sbjct  385  DVPYTHANVSQAFRDFSYKPTTDLPSGLRKFVKWYVGYYGPQLRPKKE  432



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA++STGSGG+K+GPAQLRVYNLGNTSPV+V+ LV ILE LL + AKKNVV+MP NG
Sbjct  328  ALDTAQRSTGSGGRKRGPAQLRVYNLGNTSPVTVKGLVGILEGLLGLTAKKNVVRMPGNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQ  307
            DVPFTHANVS + +DFGY+PTTDL++GLRKFVKWYV+YYGI+
Sbjct  388  DVPFTHANVSSSVRDFGYRPTTDLATGLRKFVKWYVNYYGIK  429



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSG KKKGPAQLR+YNLGNTSPVSV +LV ILE LL +KAKKNV++MP NG
Sbjct  323  ALDTAEKSTGSGEKKKGPAQLRIYNLGNTSPVSVPELVRILEELLKVKAKKNVLRMPSNG  382

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVPFTHANV+LA  + GYKPTTDL++GL+KFVKWY+SYYG+  R+
Sbjct  383  DVPFTHANVTLASMELGYKPTTDLATGLKKFVKWYLSYYGVPGRI  427



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V KLVSILE LL  KA+K+V+KMPRNG
Sbjct  337  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVSILEGLLRTKARKHVIKMPRNG  396

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVP+THANV+LAY+DFGYKPTTDL++GLRKFVKWY+  +
Sbjct  397  DVPYTHANVTLAYRDFGYKPTTDLATGLRKFVKWYIKLW  435



>ref|XP_002511693.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF50362.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=152

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  44   ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNG  103

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DV FTHAN+SLA  + GYKPTTDL +GL+KFV+WY+SYY +  +
Sbjct  104  DVQFTHANISLAQMELGYKPTTDLQTGLKKFVRWYLSYYHVGGK  147



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+ STGSG KK+GPAQLRVYNLGNTSPV V K+V ILE LL  KAKKNVV +P+NG
Sbjct  341  ALDTAKPSTGSGSKKRGPAQLRVYNLGNTSPVPVAKMVGILEELLGKKAKKNVVTLPQNG  400

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            DVP+THANVSLA KDFGY+PTTDL++GL+KFVKWYV YYG+++
Sbjct  401  DVPYTHANVSLAEKDFGYRPTTDLATGLKKFVKWYVEYYGVKT  443



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLR+YNLGNTSPVSV  LV+ILE LL +KAKKN++ MP NG
Sbjct  330  ALDTAKKSTGSGGKKKGPAQLRIYNLGNTSPVSVPDLVNILERLLKVKAKKNIISMPSNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVPFTHANVSLA+ + GY+PTTDL +GL+KFVKWY+SYYG+  R+
Sbjct  390  DVPFTHANVSLAHTELGYQPTTDLQTGLKKFVKWYLSYYGVPGRI  434



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 93/108 (86%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkg-PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRN  178
            ALDTA+KSTGS G KK  PAQLRVYNLGNTSPVSV K+V+ILE LL  KAKKNVV MPRN
Sbjct  335  ALDTAQKSTGSRGGKKHGPAQLRVYNLGNTSPVSVGKMVAILEELLGKKAKKNVVTMPRN  394

Query  179  GDVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQ-SRVK  319
            GDVP+THANVSLA KDFGY+PTTDL++GLR+FVKWYV Y G+  SR K
Sbjct  395  GDVPYTHANVSLAEKDFGYRPTTDLATGLRRFVKWYVEYNGVAVSRAK  442



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA KSTG+GGKK+GPAQLRVYNLGNTSPV V K+V+ILE LL  KAKKNVV MPRNG
Sbjct  337  ALDTAGKSTGTGGKKRGPAQLRVYNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPRNG  396

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            DVP+THANV+LA KDF Y+PTTDL++GLR+FVKWYV YYG+ +
Sbjct  397  DVPYTHANVTLAQKDFKYRPTTDLATGLRRFVKWYVEYYGVAA  439



>ref|XP_006386474.1| hypothetical protein POPTR_0002s11750g [Populus trichocarpa]
 gb|ERP64271.1| hypothetical protein POPTR_0002s11750g [Populus trichocarpa]
Length=193

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTS V V  LVSILE LL +KAK+NV+K PRNG
Sbjct  87   SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSSVPVTDLVSILERLLKVKAKRNVMKFPRNG  146

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVP+THAN+S A K+FGYKPTTDL +GL+KFV WY+SYYG +  V
Sbjct  147  DVPYTHANISYAQKEFGYKPTTDLQTGLKKFVPWYLSYYGDKKAV  191



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG+GGKK+GPAQLRV+NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNG
Sbjct  328  ALDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  388  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  426



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG+GGKK+GPAQLRV+NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNG
Sbjct  328  ALDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  388  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  426



>emb|CAN73017.1| hypothetical protein VITISV_004389 [Vitis vinifera]
Length=149

 Score =   140 bits (354),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR++NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNG
Sbjct  44   ALDTAEKSTGSGGKKKGPAQLRIFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNG  103

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+ YY
Sbjct  104  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLKYY  142



>emb|CAN83831.1| hypothetical protein VITISV_003974 [Vitis vinifera]
Length=150

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+ ++KMPRNG
Sbjct  44   ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNG  103

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFVKWY++YY
Sbjct  104  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVKWYLNYY  142



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkg-PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRN  178
            ALDTAEKSTGS G K+   AQLRVYNLGNTSPV V K+V+ILE LL  KAKKNVV MPRN
Sbjct  338  ALDTAEKSTGSRGGKRRGAAQLRVYNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPRN  397

Query  179  GDVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            GDVP+THANVSLA KDFGY+PTTDL++GLR+FVKWYV YYG+ +
Sbjct  398  GDVPYTHANVSLAEKDFGYRPTTDLTAGLRRFVKWYVEYYGVTA  441



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  53   PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFG  232
            PAQLRVYNLGNTSPV V ++VSILE+L+  KAKKNVV +P+NGDVPFTHANVSLA  DFG
Sbjct  359  PAQLRVYNLGNTSPVPVAEMVSILEHLIGKKAKKNVVTLPQNGDVPFTHANVSLAKTDFG  418

Query  233  YKPTTDLSSGLRKFVKWYVSYYGIQS  310
            Y+PTTDL++GLRKFVKWYV YYG+Q+
Sbjct  419  YRPTTDLATGLRKFVKWYVEYYGVQT  444



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG+GGKK+GPAQLRV+NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNG
Sbjct  328  ALDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  388  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  426



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    ALDTAEkstgsgg--kkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPR  175
            ALDTA+KSTG  G  KK+GPAQLR+YNLGNTSPV V K+VSILE+LL  KAKKNVV +P+
Sbjct  340  ALDTAKKSTGVAGGGKKRGPAQLRIYNLGNTSPVPVAKMVSILEDLLRKKAKKNVVTLPQ  399

Query  176  NGDVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQ  307
            NGDVPFTHANVSLA +DFGY+PTTDL++GL+KFVKWYV YYG++
Sbjct  400  NGDVPFTHANVSLAERDFGYRPTTDLATGLKKFVKWYVEYYGVE  443



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNG
Sbjct  329  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVP+THAN+S A K+FGYKPTTDL +GL+KFV+WY+SYYG +  V
Sbjct  389  DVPYTHANISYAQKEFGYKPTTDLQTGLKKFVRWYLSYYGDKKAV  433



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  325  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNIMKLPRNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVP+THAN+S A K+FGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  385  DVPYTHANISYAQKEFGYKPTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_006837081.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
 gb|ERM99934.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
Length=434

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTG+GGKK+GPAQLR++NLGNTSPV V+ LVSILE LL +KAKK ++KMPRNG
Sbjct  327  SLDTAEKSTGTGGKKRGPAQLRIFNLGNTSPVPVKDLVSILERLLKVKAKKTIIKMPRNG  386

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFVKWY+ YY
Sbjct  387  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVKWYLGYY  425



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRV+NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNG
Sbjct  328  ALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA  + GYKPTTDL +GL+KFV+WY+SYY
Sbjct  388  DVPFTHANISLAQHELGYKPTTDLQTGLKKFVRWYLSYY  426



>ref|XP_006295696.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
 gb|EOA28594.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
Length=436

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTG+GGKK+GPAQLRV+NLGNTSPV V  LVSILE  L +KAKKN++KMPRNG
Sbjct  329  SLDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNLIKMPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVP+THAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY  Q + 
Sbjct  389  DVPYTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYSGQKKA  433



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTG+GGKK+GPAQLRV+NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNG
Sbjct  335  SLDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  395  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  433



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRV+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNG
Sbjct  330  ALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  390  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  428



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKK+G AQ R+YNLGNT+PV + +LVSILE LL +KAKK V++MPRNG
Sbjct  348  ALDTAKKSTGSGGKKRGAAQFRIYNLGNTTPVPIGRLVSILEKLLRVKAKKKVIQMPRNG  407

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA+K+ GYKPTTDL +GL+KFVKWYV YYG + +
Sbjct  408  DVPFTHANISLAHKELGYKPTTDLEAGLKKFVKWYVGYYGSKKK  451



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTG+GGKK+GPAQLRV+NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNG
Sbjct  333  SLDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNG  392

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  393  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  431



>ref|NP_182056.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
 sp|O22141.1|GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4; AltName: Full=UDP-glucuronic 
acid epimerase 4; Short=AtUGlcAE1 [Arabidopsis 
thaliana]
 gb|AAB82632.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO42241.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO64072.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAT06796.1| UDP-glucuronic acid epimerase 1 [Arabidopsis thaliana]
 gb|AEC10537.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
Length=437

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRV+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNG
Sbjct  330  ALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  390  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  428



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA KSTGSGGKK+GPAQLRVYNLGN SPV V K+V+ILE LL  KAKKNVV MP NG
Sbjct  335  ALDTAGKSTGSGGKKRGPAQLRVYNLGNKSPVPVSKMVAILEELLGKKAKKNVVTMPMNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGI  304
            DVP+THANVS A KDFGY+PTTDL++GLR+FVKWYV YYG+
Sbjct  395  DVPYTHANVSSAEKDFGYRPTTDLATGLRRFVKWYVEYYGV  435



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LL +KAK+ ++K+PRNG
Sbjct  331  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKVKAKRTIMKLPRNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  391  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYG  430



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNG
Sbjct  325  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRKIMKLPRNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVP+THAN+S A K+FGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  385  DVPYTHANISYAQKEFGYKPTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKK PAQLRV+NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNG
Sbjct  329  SLDTAEKSTGSGGKKKRPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVP+THAN+S A K+FGYK TTDL +GL+KFV+WY+SYYG +  V
Sbjct  389  DVPYTHANISYAQKEFGYKATTDLQTGLKKFVRWYLSYYGDKKAV  433



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRV+NLGNTSPV V +LVSILE LL +KAK+NV+KMPRNG
Sbjct  321  ALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVTELVSILERLLKVKAKRNVMKMPRNG  380

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            DV FTHAN+S A K+FGYKPTTDL +GL+ FV+WY++YY + +
Sbjct  381  DVQFTHANISYAKKEFGYKPTTDLETGLKNFVRWYLNYYSVAA  423



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNG
Sbjct  329  ALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+SLA K+FGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  389  DVQFTHANISLAQKEFGYKPTTDLQTGLKKFVRWYLSYYG  428



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNG
Sbjct  329  ALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+SLA K+FGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  389  DVQFTHANISLAQKEFGYKPTTDLQTGLKKFVRWYLSYYG  428



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK++V+K+PRNG
Sbjct  330  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYYG +++
Sbjct  390  DVQFTHANISFAKRELGYKPTTDLHTGLKKFVRWYLSYYGDETK  433



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGS GKKKGPAQLRV+NLGNTSPV V  LV ILE LL +KAK+N++KMPRNG
Sbjct  327  ALDTAEKSTGSRGKKKGPAQLRVFNLGNTSPVPVSDLVGILERLLKVKAKRNIMKMPRNG  386

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A  + GYKP+TDL +GL+KFV+WYVSYY
Sbjct  387  DVPFTHANISSAQHELGYKPSTDLQTGLKKFVRWYVSYY  425



>gb|KHN25558.1| UDP-glucuronate 4-epimerase 3 [Glycine soja]
Length=261

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR++NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  155  ALDTAEKSTGSGGKKRGPAQLRIFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNG  214

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A  + GYKPTTDL SGL+KFV+WY++YY
Sbjct  215  DVQFTHANISYAQSELGYKPTTDLQSGLKKFVRWYLNYY  253



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  329  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRNIMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFV+WYVSYY
Sbjct  389  DVPFTHANISSAQRELGYKPTTDLQTGLKKFVRWYVSYY  427



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  333  ALDTAEKSTGSGGKKRGRAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNG  392

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  393  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  431



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAE STGSGG+K+ PAQ R+YNLGNTSPV+V  LV ILE  L +KAKKNV +MP NG
Sbjct  326  ALDTAEASTGSGGRKRSPAQYRIYNLGNTSPVTVPALVGILERHLKMKAKKNVAEMPGNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRV  316
            DVPFTHAN+SLA  + GYKPTT+L +GL+KFVKWY+SYYG   RV
Sbjct  386  DVPFTHANISLARAELGYKPTTNLETGLKKFVKWYLSYYGYSRRV  430



>gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata]
Length=261

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKG AQLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNG
Sbjct  155  ALDTAEKSTGSGGKKKGAAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLIMKLPRNG  214

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYYG + +
Sbjct  215  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYGNEKK  258



>dbj|BAF00333.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=292

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  183  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNG  242

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++FGYKP+TDL +GL+KFV+WY+ YY
Sbjct  243  DVPFTHANISSAQREFGYKPSTDLQTGLKKFVRWYLGYY  281



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LL + AK+N++K+PRNG
Sbjct  331  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  391  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  429



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LVSILE LL +KAK+NV+KMPRNG
Sbjct  315  ALDTAEKSTGSGGKKRGTAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKMPRNG  374

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A K+FGYKPTTDL +GL+KFV+WYV+YY
Sbjct  375  DVQFTHANISYAKKEFGYKPTTDLQTGLKKFVRWYVNYY  413



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+ V+K+PRNG
Sbjct  329  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRAVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  389  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYG  428



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG+GGKKKGPAQLRVYNLGNTSPV V  LVSILE LL +K K+N++K+PRNG
Sbjct  329  ALDTAEKSTGTGGKKKGPAQLRVYNLGNTSPVPVSTLVSILERLLKVKVKRNIMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHANVSLA ++ GYKPTTDL +GL+KFVKWY S+Y
Sbjct  389  DVQFTHANVSLAQRELGYKPTTDLQTGLKKFVKWYTSFY  427



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  326  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRNIMKLPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY++YY
Sbjct  386  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLNYY  424



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTG+GGKK+GPA LRV+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNG
Sbjct  334  SLDTAEKSTGTGGKKRGPAMLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNG  393

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY    + K
Sbjct  394  DVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYSSSGQSK  439



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  332  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY++YY
Sbjct  392  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYMNYY  430



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  326  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY++YY
Sbjct  386  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYMNYY  424



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNG
Sbjct  327  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNG  386

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+ YY
Sbjct  387  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYIKYY  425



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNG
Sbjct  321  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNG  380

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+ YY
Sbjct  381  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYIKYY  419



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGG+K  PAQ R+YNLGNTSPV+V  LV ILE  L +KAKKNVV+MP NG
Sbjct  325  SLDTAEKSTGSGGRKGSPAQYRIYNLGNTSPVTVPALVGILERHLKVKAKKNVVEMPGNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA  + GYKPTT+L +GL+KFV+WY+SYYG   R
Sbjct  385  DVPFTHANISLARAELGYKPTTNLETGLKKFVRWYLSYYGYSPR  428



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDT EKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK++V+K+PRNG
Sbjct  330  ALDTGEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  390  DVQFTHANISFAKRELGYKPTTDLQTGLKKFVRWYLSYYG  429



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAE STG G +K+ PAQ R+YNLGNTSPV+V  LV ILE  L +KA+KN+V+MP NG
Sbjct  326  ALDTAEASTGIGKQKRRPAQYRIYNLGNTSPVTVPALVRILERYLKVKARKNMVEMPGNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA  + GYKPTT+L +GL+KFVKWY+SYYG   R
Sbjct  386  DVPFTHANISLARAELGYKPTTNLETGLKKFVKWYLSYYGYSRR  429



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKK+ PAQ R+YNLGNTSPV+V  LVSILE  L +KAK+NVV+MP NG
Sbjct  324  SLDTAEKSTGSGGKKRRPAQYRIYNLGNTSPVTVPTLVSILERYLKVKAKRNVVEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA  + GYKPTT+L +GL+KFVKWY+ YYG + R
Sbjct  384  DVPFTHANISLARAELGYKPTTNLETGLKKFVKWYLHYYGYRPR  427



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+ ++KMPRNG
Sbjct  327  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNG  386

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFVKWY++YY
Sbjct  387  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVKWYLNYY  425



>gb|AFK41785.1| unknown [Medicago truncatula]
Length=154

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKG AQ RV+NLGNTSPV V KLV+ILE LL + AKK V+ MPRNG
Sbjct  44   ALDTAKKSTGSGGKKKGSAQFRVFNLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNG  103

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++FGYKPT DL +GLRKFVKWY+ +Y
Sbjct  104  DVKFTHANISLAQREFGYKPTIDLETGLRKFVKWYLEFY  142



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLR++NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNG
Sbjct  321  ALDTAEKSTGSGGKKKGPAQLRIFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNG  380

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+ YY
Sbjct  381  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLKYY  419



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKG AQLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNG
Sbjct  329  ALDTAEKSTGSGGKKKGAAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A+K+ GYKPTTDL +GL+KFV+WY++YYG
Sbjct  389  DVPFTHANISSAHKELGYKPTTDLQTGLKKFVRWYLNYYG  428



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL  KAK+N++K+PRNG
Sbjct  328  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKAKAKRNIMKLPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DV FTHAN+SLA ++ GYKP+TDL +GL+KFV+WY+SYY +  +
Sbjct  388  DVQFTHANISLAQRELGYKPSTDLQTGLKKFVRWYLSYYRVGGK  431



>ref|XP_001761086.1| predicted protein [Physcomitrella patens]
 gb|EDQ74153.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK GPAQLRV+NLGNTSPV+V  LV ILE  L  KAK+N++KMPRNG
Sbjct  335  ALDTAEKSTGSGGKKTGPAQLRVFNLGNTSPVTVPTLVDILEKYLKQKAKRNIIKMPRNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  343
            DVPFTHAN+S A   F Y PTT+L +GL+KFVKWY+SYYG+ +  K  L    Q
Sbjct  395  DVPFTHANISYAQSQFNYHPTTNLDTGLKKFVKWYLSYYGVGTDHKLWLGDHEQ  448



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LL +KAK+N++++PRNG
Sbjct  330  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKLKAKRNILRLPRNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV +THAN+SLA ++ GYKPTTDL SGL+KFV+WY+ +Y
Sbjct  390  DVQYTHANISLAQRELGYKPTTDLQSGLKKFVRWYLRFY  428



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  310  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNG  369

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++FGYKP+TDL +GL+KFV+WY+ YY
Sbjct  370  DVPFTHANISSAQREFGYKPSTDLQTGLKKFVRWYLGYY  408



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL + AK+N++K+PRNG
Sbjct  331  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKP+TDL +GL+KFV+WY+SYY
Sbjct  391  DVQFTHANISLAQRELGYKPSTDLQTGLKKFVRWYLSYY  429



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNG
Sbjct  329  ALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+S A+K+ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  389  DVQFTHANISSAHKELGYKPTTDLQTGLKKFVRWYLSYYG  428



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  325  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++FGYKP+TDL +GL+KFV+WY+ YY
Sbjct  385  DVPFTHANISSAQREFGYKPSTDLQTGLKKFVRWYLGYY  423



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNG
Sbjct  329  ALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+S A+K+ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  389  DVQFTHANISSAHKELGYKPTTDLQTGLKKFVRWYLSYYG  428



>emb|CBI24539.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK  PAQLRVYNLGNTSPV V  LVSILE LL +KA++    MPRNG
Sbjct  209  ALDTAEKSTGSGGKKMRPAQLRVYNLGNTSPVEVGSLVSILERLLKVKARRVATPMPRNG  268

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV +THAN+SLA K+ GYKPTTDL SGL KFVKWY++YY
Sbjct  269  DVMYTHANISLAEKELGYKPTTDLRSGLEKFVKWYLTYY  307



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAE+STGSGGKK+GPAQLRVYNLGNTSPV V K+V ILE LL  KAKK+VV +P+NG
Sbjct  339  ALDTAERSTGSGGKKRGPAQLRVYNLGNTSPVPVAKMVGILEELLGKKAKKHVVTLPQNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVP+THANVS+A +D GY+ TTDL++GL+KFV+WYV YY  +S+
Sbjct  399  DVPYTHANVSMAERDLGYRATTDLATGLKKFVRWYVEYYDRKSK  442



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA  STG+GGKK+GPAQLRVYNLGNTSPV+V +LVSILE  L +KAKKN VKMPRNG
Sbjct  329  ALDTALLSTGTGGKKRGPAQLRVYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            DVPFTHANV+LA  +  Y P+TDL +GL+KFVKWY SYYG+ S
Sbjct  389  DVPFTHANVTLARNELRYNPSTDLYTGLKKFVKWYESYYGLTS  431



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNG
Sbjct  324  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPTTDL +GL+KF +WY+ YY
Sbjct  384  DVPFTHANISSAQRELGYKPTTDLQTGLKKFARWYLGYY  422



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRV+NLGNTSPV V  LV ILE LL IKAK+N++K+PRNG
Sbjct  326  ALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVGILERLLKIKAKRNIMKLPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL SGL+KFV+WY++YY
Sbjct  386  DVQFTHANISYAQRELGYKPTTDLHSGLKKFVRWYLNYY  424



>gb|EMT26004.1| UDP-glucuronate 4-epimerase 4 [Aegilops tauschii]
Length=176

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA +STGSGGKK+GPA  R YNLGNTSPV V +LV +LE +L +KA + VVKMPRNG
Sbjct  48   ALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPRNG  107

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  331
            DVP+THAN+SLA ++ GY+P+TDL +GL+KFV+WY+ YY  +  VK + H
Sbjct  108  DVPYTHANISLAQRELGYRPSTDLQTGLKKFVRWYLEYYNPELAVKQKQH  157



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG GGKK G AQLRVYNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNG
Sbjct  304  ALDTAEKSTGGGGKKHGAAQLRVYNLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNG  363

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVK  280
            DVPFTHANVSLA++DFGYKPTTDL++GLRKFV+
Sbjct  364  DVPFTHANVSLAWRDFGYKPTTDLATGLRKFVQ  396



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK++++K+PRNG
Sbjct  339  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRHIMKLPRNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  399  DVQFTHANISWAQRELGYKPTTDLQTGLKKFVRWYLSYY  437



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNG
Sbjct  324  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPTTDL +GL+KF +WY+ YY
Sbjct  384  DVPFTHANISSAQRELGYKPTTDLQTGLKKFARWYLGYY  422



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA  STG+GGKK+GPAQLRVYNLGNTSPV+V +LVSILE  L +KAKKN VKMPRNG
Sbjct  334  ALDTALLSTGTGGKKRGPAQLRVYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNG  393

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            DVPFTHANV+LA  +  Y P+TDL +GL+KFVKWY SYYG+ S
Sbjct  394  DVPFTHANVTLARNELRYNPSTDLYTGLKKFVKWYESYYGLTS  436



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKG AQLRV+NLGNTSPV V KLVSILE LL +KAKKNV+ +PRNG
Sbjct  300  ALDTAEKSTGSGGKKKGNAQLRVFNLGNTSPVPVTKLVSILEKLLKVKAKKNVLPLPRNG  359

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKT  322
            DV FTHAN+S A+K+FGYKPTT+L  GL+KFV WY+ YY +  + K+
Sbjct  360  DVMFTHANISYAHKEFGYKPTTNLQMGLQKFVNWYLDYYSVSEKKKS  406



>gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas]
Length=436

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKK+GPAQ RV+NLGNTSPV V +LV ILE+LL +KAKK V+ +PRNG
Sbjct  328  ALDTAKKSTGSGGKKRGPAQFRVFNLGNTSPVPVSRLVGILESLLQVKAKKKVLPLPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA KD GYKPTTDL +GL+KFV+WY+SYY
Sbjct  388  DVEFTHANISLAQKDLGYKPTTDLETGLKKFVRWYLSYY  426



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LVSILE LL +KAKKN++K+PRNG
Sbjct  330  ALDTAEKSTGSGGKKRGQAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFV+WY+ YY
Sbjct  390  DVPFTHANISSAQRELGYKPTTDLQTGLKKFVRWYLGYY  428



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  332  ALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A  + GYKPTTDL SGL+KFV+WY++YY
Sbjct  392  DVQFTHANISYAQSELGYKPTTDLQSGLKKFVRWYLNYY  430



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKG AQLRV+NLGNTSPV V  LV ILE LL +KAK+ V+K+PRNG
Sbjct  329  ALDTAEKSTGSGGKKKGAAQLRVFNLGNTSPVPVSDLVGILERLLKVKAKRLVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A+K+ GYKPTTDL +GL+KFV+WY++YYG
Sbjct  389  DVPFTHANISSAHKELGYKPTTDLQTGLKKFVRWYLNYYG  428



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLR++NLGNTSPV V  LVSILE LL +KAK+N++K+PRNG
Sbjct  332  ALDTAEKSTGSGGKKRGPAQLRIFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A  + GYKPTTDL SGL+KFV+WY++YY
Sbjct  392  DVQFTHANISYAQMELGYKPTTDLQSGLKKFVRWYLNYY  430



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LL  KAK+ V+K+PRNG
Sbjct  326  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKTKAKRLVMKLPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY++YY
Sbjct  386  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLNYY  424



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V +LVSILE LL +KAK+N++K+PRNG
Sbjct  325  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTELVSILERLLKVKAKRNMMKLPRNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            DV FTHAN+S A ++FGYKP+TDL +GL+KFV+WY+ YY  Q+
Sbjct  385  DVAFTHANISWAEREFGYKPSTDLQTGLKKFVRWYLGYYKQQA  427



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  332  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVMDLVTILERLLKVKAKRNIMKLPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  392  DVQFTHANISSAQRELGYKPTTDLQTGLKKFVRWYLSYY  430



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  326  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  386  DVQFTHANISSAQRELGYKPTTDLQTGLKKFVRWYLSYY  424



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  332  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  392  DVQFTHANISSAQRELGYKPTTDLQTGLKKFVRWYLSYY  430



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+ + K+PRNG
Sbjct  332  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRKITKLPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYY
Sbjct  392  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYY  430



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LL + AK++++K+PRNG
Sbjct  331  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKVNAKRDIMKLPRNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKP+TDL +GL+KFV+WY+ YY
Sbjct  391  DVQFTHANISLAQRELGYKPSTDLQTGLKKFVRWYLGYY  429



>gb|EYU31498.1| hypothetical protein MIMGU_mgv1a008581mg [Erythranthe guttata]
Length=369

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +2

Query  80   GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  259
            G   P     LV ILE LL  KAKK VVKMPRNGDVP+THANVSLAYKDFGYKPTTDL++
Sbjct  277  GTPPPSPSESLVGILETLLGTKAKKRVVKMPRNGDVPYTHANVSLAYKDFGYKPTTDLAT  336

Query  260  GLRKFVKWYVSYYGIQSRVKTELHP--THQSDD  352
            GLRKFVKWYVSYYGI+SRVK E  P     +DD
Sbjct  337  GLRKFVKWYVSYYGIESRVKKENEPNTNDHTDD  369



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKK  AQLRV+NLGNTSPV V KLVSILE LL +KAK+NV+ +PRNG
Sbjct  300  ALDTAEKSTGSGGKKKKNAQLRVFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPRNG  359

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGI  304
            DV FTHAN+S A K+FGYKPTTDL  GL+KFV WY+ YY I
Sbjct  360  DVMFTHANISYAQKEFGYKPTTDLQMGLQKFVNWYLDYYSI  400



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LVSILE LL +KAKKN++K+PRNG
Sbjct  326  ALDTAEKSTGSGGKKRGQAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPTTDL +GL+KF +WY+ YY
Sbjct  386  DVPFTHANISSAQRELGYKPTTDLQTGLKKFARWYLGYY  424



>emb|CBI22155.3| unnamed protein product [Vitis vinifera]
Length=234

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTG+GGKKKG AQ R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNG
Sbjct  66   SLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNG  125

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSY  295
            DV +THAN+SLA ++ GYKPTTDL SGL+KFV+WY++Y
Sbjct  126  DVQYTHANISLAQRELGYKPTTDLESGLKKFVRWYITY  163



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+ PAQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  331  ALDTAEKSTGSGGKKRRPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL SGL+KF +WY+ YY
Sbjct  391  DVQFTHANISSAQRELGYKPTTDLQSGLKKFARWYLGYY  429



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQ RVYNLGNTSPV V  LVSILE LL + AK+NV+K+P+NG
Sbjct  327  ALDTAEKSTGSGGKKKGPAQFRVYNLGNTSPVPVSDLVSILERLLKVDAKRNVMKLPQNG  386

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKP+TDL +G++KFV+WY+SYY
Sbjct  387  DVRFTHANISLAQRELGYKPSTDLQTGMKKFVRWYLSYY  425



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKK+GPAQ R+YNLGNTSPV+V  LVSILE  L  KAK+NVV MP NG
Sbjct  324  SLDTAEKSTGSGGKKRGPAQYRIYNLGNTSPVTVPMLVSILERHLKAKAKRNVVAMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA  + GYKPTT+L +GL+KFVKWY+ YYG   R
Sbjct  384  DVPFTHANISLARAELGYKPTTNLETGLKKFVKWYLHYYGYSPR  427



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKK  AQLRV+NLGNTSPV V KLVSILE LL +KAK+NV+ +P NG
Sbjct  300  ALDTAEKSTGSGGKKKKNAQLRVFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPTNG  359

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DV FTHAN+S A+K+FGYKPTTDL +GL KFV WY+ YY +  +
Sbjct  360  DVMFTHANISYAHKEFGYKPTTDLQTGLHKFVNWYLDYYSVSEK  403



>ref|XP_002266529.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Vitis vinifera]
Length=408

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK  PAQLRVYNLGNTSPV V  LVSILE LL +KA++    MPRNG
Sbjct  304  ALDTAEKSTGSGGKKMRPAQLRVYNLGNTSPVEVGSLVSILERLLKVKARRVATPMPRNG  363

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV +THAN+SLA K+ GYKPTTDL SGL KFVKWY++YY
Sbjct  364  DVMYTHANISLAEKELGYKPTTDLRSGLEKFVKWYLTYY  402



>ref|XP_010540291.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Tarenaya hassleriana]
Length=393

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V +LVSILE  L +KAK+NV+K+PRNG
Sbjct  287  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVSELVSILERHLKVKAKRNVMKLPRNG  346

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S+A ++ GYKPTTDL +GL+KFV+WY+ YY
Sbjct  347  DVQFTHANISMAQRELGYKPTTDLQTGLKKFVRWYMGYY  385



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTG+GG+K+GPAQ R+YNLGNTSPV+V  LV ILE+ L +KAK+NVV+MP NG
Sbjct  324  SLDTAEKSTGTGGRKRGPAQYRIYNLGNTSPVTVPALVGILEHHLKMKAKRNVVEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA  + GYKPTT+L +GL++FV+WY+ YYG  +R
Sbjct  384  DVPFTHANISLARAELGYKPTTNLETGLKRFVRWYLLYYGYNTR  427



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LVSILE LL +KAK+ V+K+PRNG
Sbjct  328  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY+ YY
Sbjct  388  DVQFTHANISSAQRELGYKPTTDLKTGLKKFVEWYLGYY  426



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTGSGGKK+GPAQ R+YNLGNTSPV+V  LVSILE  L +KAK+NV++MP NG
Sbjct  324  SLDTAKKSTGSGGKKRGPAQYRIYNLGNTSPVTVPMLVSILERHLKVKAKRNVMEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA  + GYKPTT+L +GL+KFVKWY+ YYG   R
Sbjct  384  DVPFTHANISLARAELGYKPTTNLETGLKKFVKWYLQYYGYSRR  427



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALD++ KSTGSGGKK+GPA  R+YNLGNT PV+V  LVSILE  L +KAKKNVV+MP NG
Sbjct  327  ALDSSGKSTGSGGKKRGPAPYRIYNLGNTQPVTVPTLVSILEKSLKVKAKKNVVEMPGNG  386

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA +DFGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  387  DVPFTHANISLARRDFGYKPTTDLQTGLKKFVRWYLSYYG  426



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTGSGGKK+GPAQ R++NLGNTSP++V  +V ILE  L +KAKKNV++MP NG
Sbjct  325  SLDTAKKSTGSGGKKRGPAQYRIFNLGNTSPITVPMMVGILEKHLKVKAKKNVIEMPGNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A ++ GYKPTTDL +GLRKFVKWY+SYYG
Sbjct  385  DVPFTHANISSARRELGYKPTTDLQTGLRKFVKWYLSYYG  424



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V +LVSILE  L +KAK+N++K+PRNG
Sbjct  329  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVSELVSILERHLKVKAKRNIMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGI  304
            DV FTHAN+SLA  + GYKPTTDL +GL+KFVKWY+ YY +
Sbjct  389  DVQFTHANISLAQGELGYKPTTDLHTGLKKFVKWYLGYYNV  429



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNG
Sbjct  329  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DV FTHAN+S A ++ GYKP+TDL +GL+KFV+WY++YYG
Sbjct  389  DVQFTHANISSAQRELGYKPSTDLQTGLKKFVRWYLNYYG  428



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG+GGKK+G AQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  322  ALDTAEKSTGTGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNG  381

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPTTDL +GL+KF +WY+ YY
Sbjct  382  DVPFTHANISSAQRELGYKPTTDLQTGLKKFARWYLGYY  420



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKK+ PAQ R+YNLGNTSPV+V  LVSILE  L +KAK+NVV+MP NG
Sbjct  324  SLDTAEKSTGSGGKKRRPAQYRIYNLGNTSPVTVPTLVSILERHLKVKAKRNVVEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA  +  YKPTT+L +GL+KFVKWY+ YYG   R
Sbjct  384  DVPFTHANISLARAELRYKPTTNLETGLKKFVKWYLRYYGYSPR  427



>emb|CBI18845.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTG+GGKKKG AQ R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNG
Sbjct  148  SLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNG  207

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSY  295
            DV +THAN+SLA ++ GYKPTTDL SGL+KFV+WY++Y
Sbjct  208  DVQYTHANISLAQRELGYKPTTDLESGLKKFVRWYITY  245



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE LL  KAK+NV+K+PRNG
Sbjct  334  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKTKAKRNVMKLPRNG  393

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A  + GYKP TDL +GL+KFV+WY++YY
Sbjct  394  DVQFTHANISYAQTELGYKPVTDLQTGLKKFVRWYLNYY  432



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA  STG+GGKK+GPAQLRVYNLGNTSPV+V  LV+ILE  L +KAK+NVV+MPRNG
Sbjct  339  ALDTATPSTGTGGKKRGPAQLRVYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHANV+LA  + GY PTTDL +GL+KFVKWY  YY
Sbjct  399  DVPFTHANVTLARVELGYNPTTDLQTGLKKFVKWYQLYY  437



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA  STG+GGKK+GPAQLRVYNLGNTSPV+V  LV+ILE  L +KAK+NVV+MPRNG
Sbjct  339  ALDTATPSTGTGGKKRGPAQLRVYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNG  398

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHANV+LA  + GY PTTDL +GL+KFVKWY  YY
Sbjct  399  DVPFTHANVTLARVELGYNPTTDLQTGLKKFVKWYQLYY  437



>ref|XP_004306933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Fragaria vesca subsp. 
vesca]
Length=434

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK++++K+PRNG
Sbjct  328  SLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRSILKLPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL +GL+KFV+WY++YY
Sbjct  388  DVQFTHANISSAQRELGYKPTTDLQTGLKKFVRWYLTYY  426



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKK+ PAQ R++NLGNTSPV+V  +VSILE  L +KAKKNVV MP NG
Sbjct  323  SLDTAEKSTGSGGKKRRPAQYRIFNLGNTSPVTVPMMVSILEKHLKVKAKKNVVDMPGNG  382

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN++ A ++  YKPTTDL +GL+KFV+WY+SYYG
Sbjct  383  DVPFTHANITAARRELAYKPTTDLQTGLKKFVRWYLSYYG  422



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LV+ILE LL +KAK+N +K+PRNG
Sbjct  320  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNTMKLPRNG  379

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPTTDL +GL+KF +WY+ YY
Sbjct  380  DVPFTHANISSAQRELGYKPTTDLQTGLKKFARWYLGYY  418



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NG
Sbjct  324  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A K+FGY+PTTDL +GL+KFV+WY+SYYG
Sbjct  384  DVPFTHANISSAQKEFGYRPTTDLQTGLKKFVRWYLSYYG  423



>ref|XP_009621323.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=408

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKG AQLRV+NLGNTSPV V KLVS+LE LL +KA+KNV+ +PRNG
Sbjct  300  ALDTAEKSTGSGGKKKGNAQLRVFNLGNTSPVPVTKLVSLLEKLLKVKARKNVLPLPRNG  359

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKT  322
            DV FTHAN+S A K+FGYKP+TDL  G++KF+ WY+ YY I  + K+
Sbjct  360  DVMFTHANISYAQKEFGYKPSTDLQMGIQKFLNWYLDYYSISEKKKS  406



>ref|XP_008776445.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Phoenix 
dactylifera]
Length=150

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            AL+TA KSTG GGKK+GPA LRVYNLGNTSPV V  LVSILE LL +KA + VVKMPRNG
Sbjct  35   ALNTAGKSTGRGGKKRGPAPLRVYNLGNTSPVPVADLVSILEKLLGVKAVRKVVKMPRNG  94

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN++LA ++ GY PTTDL +GL++FV+WY+ YY
Sbjct  95   DVQFTHANITLARRELGYHPTTDLRTGLKRFVRWYLQYY  133



>ref|XP_008234372.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Prunus mume]
Length=409

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGG+ +GPAQLRV+NLGNTSPV V ++VSI+E LL +KAKK VV MPRNG
Sbjct  304  ALDTAEKSTGSGGRVEGPAQLRVFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNG  363

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DV FTHAN+SLA ++ GY PTTDL +GLRKF+ WY+ YY    R
Sbjct  364  DVLFTHANISLARRELGYMPTTDLKTGLRKFLNWYLDYYSESKR  407



>gb|KGN57287.1| hypothetical protein Csa_3G176330 [Cucumis sativus]
Length=262

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGG+KKG AQLRV+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNG
Sbjct  155  ALDTAEKSTGSGGRKKGKAQLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNG  214

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA K+ GYKPTTDL +GL++FV WY  YY   S+
Sbjct  215  DVPFTHANISLAQKELGYKPTTDLKTGLKEFVDWYRLYYSNSSK  258



>ref|XP_007221187.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
 gb|EMJ22386.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
Length=410

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGG+ +GPAQLRV+NLGNTSPV V ++VSI+E LL +KAKK VV MPRNG
Sbjct  304  ALDTAEKSTGSGGRVEGPAQLRVFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNG  363

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DV FTHAN+SLA ++ GY PTTDL +GLRKF+ WY+ YY    R
Sbjct  364  DVLFTHANISLARRELGYMPTTDLKTGLRKFLNWYLDYYSESKR  407



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+GPAQLRV+NLGNTSPV V  LV ILE LL  KAK+N++K+PRNG
Sbjct  334  ALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVGILERLLKTKAKRNIMKLPRNG  393

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKP TDL +GL+KFV+WY++YY
Sbjct  394  DVQFTHANISYAQRELGYKPVTDLQAGLKKFVRWYLNYY  432



>ref|XP_010662214.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Vitis vinifera]
Length=341

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTG+GGKKKG AQ R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNG
Sbjct  234  SLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNG  293

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSY  295
            DV +THAN+SLA ++ GYKPTTDL SGL+KFV+WY++Y
Sbjct  294  DVQYTHANISLAQRELGYKPTTDLESGLKKFVRWYITY  331



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTGSGGKK+GPAQ R++NLGNTSPV+V  +V ILE  L +KAKKN V MP NG
Sbjct  325  SLDTAKKSTGSGGKKRGPAQYRIFNLGNTSPVTVPMMVGILERHLKVKAKKNYVDMPGNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFVKWY++YYG
Sbjct  385  DVPFTHANISLARRELGYKPTTDLQTGLKKFVKWYLAYYG  424



>gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=262

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NG
Sbjct  155  SLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNG  214

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFVKWY+SYYG
Sbjct  215  DVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYG  254



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+ STGSGG+K+G AQ R+YNLGNT+P+SV +LVSILE  L +KA +NVV+MP NG
Sbjct  331  ALDTAQPSTGSGGRKRGSAQYRIYNLGNTTPLSVPQLVSILERHLRVKATRNVVEMPGNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DVPFTHANV++A  + GYKPTTDL +GL+KFVKWY++YYG +   K ++
Sbjct  391  DVPFTHANVTMARLELGYKPTTDLQAGLKKFVKWYLNYYGYEHNGKGKI  439



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAKKN V MP NG
Sbjct  325  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA ++FGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  385  DVPFTHANISLARREFGYKPTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_009370520.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Pyrus 
x bretschneideri]
Length=370

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            A+DTAEKSTGSGGK + PAQLRV+NLGNTSPV V ++V ILE LL +KAKK VV MPRNG
Sbjct  263  AVDTAEKSTGSGGKVERPAQLRVFNLGNTSPVPVNEVVGILERLLGVKAKKVVVPMPRNG  322

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHANVSLA ++ GY PTTDL +GLRKFV WY+ YY
Sbjct  323  DVLFTHANVSLARRELGYVPTTDLKTGLRKFVDWYLDYY  361



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAKKN V MP NG
Sbjct  325  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA ++FGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  385  DVPFTHANISLARREFGYKPTTDLQTGLKKFVRWYLSYYG  424



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPV V  LV+ILE LL  KA + V+K+PRNG
Sbjct  326  ALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVTILEKLLKKKANRMVMKLPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQS  310
            DV FTHAN+SLA ++  YKPTTDL +GL+KFV+WY+ YY + +
Sbjct  386  DVQFTHANISLAQRELDYKPTTDLQTGLKKFVRWYLDYYAVDA  428



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLRV+NLGNTSPV V  LVSILE+LL +KAK+ V+K+PRNG
Sbjct  343  ALDTAQKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILESLLKVKAKRTVMKLPRNG  402

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV +THAN+S A ++ GYKPTTDL  GL+KFV+WY++YY
Sbjct  403  DVQYTHANISYAKRELGYKPTTDLQGGLKKFVRWYLNYY  441



>ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=433

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAK+NVV MP NG
Sbjct  326  SLDTAGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILEKHLKMKAKRNVVDMPGNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  386  DVPFTHANISLARRELGYKPTTDLQTGLKKFVRWYLSYYG  425



>ref|XP_001759693.1| predicted protein [Physcomitrella patens]
 gb|EDQ75605.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTAEKSTGSGGKK GPA LRV+NLGNTSPV+V  LV ILE  L+ KAK+ ++KMPRNG
Sbjct  326  SLDTAEKSTGSGGKKTGPAMLRVFNLGNTSPVTVPTLVDILEKHLNTKAKRQIIKMPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A    GY+PTT+L +GL+KFVKWY+SYYG
Sbjct  386  DVPFTHANISSAQAQLGYRPTTNLDTGLKKFVKWYLSYYG  425



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG+GGKK+G AQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  322  ALDTAEKSTGTGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNG  381

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DVPFTHAN+S A ++ GYKPT DL +GL+KF +WY+ YY
Sbjct  382  DVPFTHANISSAQRELGYKPTIDLQTGLKKFARWYLGYY  420



>ref|XP_006845469.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
 gb|ERN07144.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
Length=432

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKKKGPA  R++NLGNTSPV+V  LV ILE  L +KAK+NVV+MP NG
Sbjct  324  SLDTSGKSTGSGGKKKGPAPYRIFNLGNTSPVTVPDLVGILEKHLKVKAKRNVVEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA K+ GYKPTTDL +GL+KFVKWY SYYG
Sbjct  384  DVPFTHANISLAQKELGYKPTTDLQTGLKKFVKWYQSYYG  423



>ref|XP_008238641.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Prunus mume]
Length=434

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLR++NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNG
Sbjct  327  ALDTAKKSTGSGGKKKGPAQLRIFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNG  386

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA+K+  YKP TDL +GL+KFV+WY+SYY
Sbjct  387  DVKFTHANISLAHKELKYKPGTDLETGLKKFVRWYLSYY  425



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKGPAQLRV+NLGNTSPV V  LV+ILE LL +KAK+ ++K+PRNG
Sbjct  329  ALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRALMKLPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTT L +GL+KFV+WY+SYY
Sbjct  389  DVQFTHANISFAQRELGYKPTTYLQTGLKKFVRWYLSYY  427



>ref|XP_007209167.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
 gb|EMJ10366.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
Length=425

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKGPAQLR++NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNG
Sbjct  318  ALDTAKKSTGSGGKKKGPAQLRIFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNG  377

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA+K+  YKP TDL +GL+KFV+WY+SYY
Sbjct  378  DVKFTHANISLAHKELRYKPGTDLETGLKKFVRWYLSYY  416



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  324  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTTDL +GL+KF +WY+ YY
Sbjct  384  DVQFTHANISSAQRELGYKPTTDLQTGLKKFARWYLGYY  422



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NG
Sbjct  326  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+S A ++FGYKPTTDL +GL+KFV+WY+SYYG  +R
Sbjct  386  DVPFTHANISSAQREFGYKPTTDLQTGLKKFVRWYLSYYGYNNR  429



>ref|XP_001777338.1| predicted protein [Physcomitrella patens]
 gb|EDQ57868.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK GPAQLRV+NLGNTSPV+V  LV ILE  L  KA +N+VKMPRNG
Sbjct  335  ALDTAEKSTGSGGKKTGPAQLRVFNLGNTSPVTVPILVDILEKHLKQKAIRNIVKMPRNG  394

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGI  304
            DVPFTHAN S A     Y PTT+L +GLRKFVKWY+SYYG+
Sbjct  395  DVPFTHANTSSAQSQLNYHPTTNLDTGLRKFVKWYLSYYGV  435



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LVS+LE  L +KAK+N V MP NG
Sbjct  324  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA+++ GYKPTTDL++GL+KFVKWY+SYYG
Sbjct  384  DVPFTHANISLAHRELGYKPTTDLATGLKKFVKWYLSYYG  423



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  53   PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFG  232
            PA  R++NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NGDVPFTHAN+S A K+FG
Sbjct  331  PAPYRIFNLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNGDVPFTHANISSAQKEFG  390

Query  233  YKPTTDLSSGLRKFVKWYVSYYG  301
            Y+PTTDL +GL+KFV+WY+SYYG
Sbjct  391  YRPTTDLQTGLKKFVRWYLSYYG  413



>gb|KEH31675.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=436

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKG AQ RV+NLGNTSPV V KLV+ILE LL + AKK V+ MPRNG
Sbjct  326  ALDTAKKSTGSGGKKKGSAQFRVFNLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNG  385

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++FGYKPT DL +GLRKFVKWY+ +Y
Sbjct  386  DVKFTHANISLAQREFGYKPTIDLETGLRKFVKWYLEFY  424



>gb|EMT33438.1| UDP-glucuronate 4-epimerase 6 [Aegilops tauschii]
Length=250

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +2

Query  2    ALDTA-EkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRN  178
            ALDTA + +    GKK+GPA LRVYNLGNTSPV+V ++V+ILE LL  KA K VV MP N
Sbjct  121  ALDTAGKSTGSKSGKKRGPAPLRVYNLGNTSPVAVTRMVAILEKLLGKKANKRVVTMPSN  180

Query  179  GDVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGI  304
            GDVPFTHANVS A +DFGY PTT L +GLRKFV+W++ YY I
Sbjct  181  GDVPFTHANVSHAARDFGYHPTTSLDAGLRKFVEWFLQYYKI  222



>gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata]
Length=438

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKKKG AQLRV+NLGNTSPV V  LV ILE LL +KAK+ V+K+PRNG
Sbjct  332  ALDTAEKSTGSGGKKKGVAQLRVFNLGNTSPVPVSDLVGILEKLLKVKAKRLVMKLPRNG  391

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GYKP+TDL +GL+KFV+WY+SYY
Sbjct  392  DVQFTHANISLAEREIGYKPSTDLQTGLKKFVQWYLSYY  430



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA +STG+GGKK+GPAQ R++NLGNTSPV+V  LV+ILE  L +KAKKNVV+MP NG
Sbjct  330  SLDTAGRSTGTGGKKRGPAQYRIFNLGNTSPVTVPTLVAILERYLRVKAKKNVVEMPGNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVP+THAN+SLA ++ GYKPTT L  GL+KFV+WY+SYYG
Sbjct  390  DVPYTHANISLAREELGYKPTTSLEMGLKKFVRWYLSYYG  429



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA KSTGSGGKK+GPA  R++NLGNTSPV+V  LV ILE  L +KAKKN+V MP NG
Sbjct  324  SLDTAGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVGILERHLKMKAKKNIVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA  +FGYKPTTDL +GL+KFV+WY++YYG
Sbjct  384  DVPFTHANISLARMEFGYKPTTDLQTGLKKFVRWYLNYYG  423



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA KSTG+GGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NG
Sbjct  330  SLDTAGKSTGTGGKKRGPAPYRIFNLGNTSPVTVPSLVSILEKHLRVKAKKNVVEMPGNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA +  GYKPTT+L  GL+KFVKWY+SYYG
Sbjct  390  DVPFTHANISLARQQLGYKPTTNLDVGLKKFVKWYLSYYG  429



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KS GSGGKK+GPA  R++NLGNTSPV+V  LVS+LE  L +KAK+N V MP NG
Sbjct  324  SLDTSGKSPGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA+++ GYKPTTDL++GL+KFVKWY+SYYG
Sbjct  384  DVPFTHANISLAHRELGYKPTTDLATGLKKFVKWYLSYYG  423



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA KSTG+GGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NG
Sbjct  330  SLDTAGKSTGTGGKKRGPAPYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA +  GYKPTT+L  GL+KFVKWY+SYYG
Sbjct  390  DVPFTHANISLARQQLGYKPTTNLDVGLKKFVKWYLSYYG  429



>dbj|BAJ88176.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA +STGSGGKK+GPA  R YNLGNTSPV V +LV +LE +L +KA + VVKMPRNG
Sbjct  355  ALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPRNG  414

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  331
            DVP+THAN+SLA ++ GY+P+TDL +GL+KFV+WY+ YY  +  VK + H
Sbjct  415  DVPYTHANISLAQRELGYRPSTDLQTGLKKFVRWYLEYYNPELVVKQKQH  464



>ref|XP_004515772.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Cicer arietinum]
Length=438

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKKKG AQ RV+NLGNTSPV V  LV+ILE LL + AKK V+ MPRNG
Sbjct  329  ALDTAKKSTGSGGKKKGSAQFRVFNLGNTSPVPVSDLVAILERLLKVTAKKKVLPMPRNG  388

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVK  319
            DV FTHAN+SLA+KD GY+PT DL +GLRKFVKWY+ +Y   S  K
Sbjct  389  DVKFTHANISLAHKDLGYRPTIDLETGLRKFVKWYLEFYSSGSNYK  434



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTG GGKKKGPAQLRV+NLGNTSPV V +LVSILE LL +KA + ++KMPRNG
Sbjct  331  ALDTAEKSTGRGGKKKGPAQLRVFNLGNTSPVPVTELVSILERLLKVKANRLMLKMPRNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYV  289
            DV FTHAN+SLA ++ GYKPTTDL +GL+KFV+WY+
Sbjct  391  DVQFTHANISLAQRELGYKPTTDLQTGLKKFVRWYL  426



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKKKG A  R++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NG
Sbjct  324  SLDTSGKSTGSGGKKKGNAPYRIFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA ++FGYKPTTDL +GL+KFV+WY+SYYG  +R
Sbjct  384  DVPFTHANISLAQREFGYKPTTDLQTGLKKFVRWYLSYYGYNNR  427



>ref|XP_009372935.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Pyrus 
x bretschneideri]
Length=370

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            A+D AEKSTGSGGK + PAQLRV+NLGNTSPV V ++V ILE LL +KAKK VV MPRNG
Sbjct  263  AVDAAEKSTGSGGKVERPAQLRVFNLGNTSPVPVNEVVGILERLLGVKAKKVVVPMPRNG  322

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHANVSLA ++ GY PTTDL +GLRKFV WY+ YY
Sbjct  323  DVLFTHANVSLARRELGYVPTTDLKTGLRKFVDWYLDYY  361



>ref|XP_010676680.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTG+GGKKKGPAQ R++NLGNTSPVSV +LVSILE LL +K+ K V+ +PRNG
Sbjct  342  ALDTAKKSTGTGGKKKGPAQFRIFNLGNTSPVSVNQLVSILEKLLKVKSNKKVLPLPRNG  401

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  328
            DV FTHAN++LA ++  YKPTTDL +GL+KFV+WY+SYY    R  T +
Sbjct  402  DVQFTHANITLAQRELRYKPTTDLQTGLKKFVRWYLSYYSGTKRKTTSV  450



>ref|XP_008376451.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 4-like 
[Malus domestica]
Length=407

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            A+DTAEKSTGSGGK + PAQLRV+NLGNTSPV V ++V +LE LL +KAKK VV MPRNG
Sbjct  300  AVDTAEKSTGSGGKVERPAQLRVFNLGNTSPVPVNEVVGLLERLLGVKAKKVVVPMPRNG  359

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHANVSLA ++ GY PTTDL +GLRKFV WY+ YY
Sbjct  360  DVLFTHANVSLARRELGYVPTTDLKTGLRKFVDWYLDYY  398



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  +V ILE  L +KAKKN V+MP NG
Sbjct  319  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNG  378

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A K+FGYKPTTDL +GL+KFVKWY+SYYG
Sbjct  379  DVPFTHANISSARKEFGYKPTTDLQTGLKKFVKWYLSYYG  418



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA KSTG+GGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NG
Sbjct  330  SLDTAGKSTGTGGKKRGPAPYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNG  389

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA +  GYKPTT+L  GL+KFVKWY+SYYG
Sbjct  390  DVPFTHANISLAREQLGYKPTTNLDVGLKKFVKWYLSYYG  429



>gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=341

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NG
Sbjct  234  SLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNG  293

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFVKWY+SYYG
Sbjct  294  DVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYG  333



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+G A  R++NLGNTSPV+V  LVSILE LL +KAKKN+V MP NG
Sbjct  328  SLDTSGKSTGSGGKKRGAAPYRIFNLGNTSPVTVPTLVSILERLLKVKAKKNIVDMPGNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN++ A ++FGYKPTTD+ +GL+KFVKWY+SYYG
Sbjct  388  DVPFTHANITSARREFGYKPTTDIQTGLKKFVKWYLSYYG  427



>ref|XP_003558346.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Brachypodium distachyon]
Length=481

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA +STGSGGKK+GPA  R YNLGNTSPV V +LV +LE +L +KA + VVKMPRNG
Sbjct  353  ALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPRNG  412

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  346
            DVP+THAN+SLA ++ GY+P+TDL +GL+KFV+WY+ YY  +  VK + H +  S
Sbjct  413  DVPYTHANISLAQRELGYQPSTDLQTGLKKFVRWYLEYYMPELAVKLKQHGSSNS  467



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK GPA  R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NG
Sbjct  324  SLDTSGKSTGSGGKKTGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKKNVVEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  384  DVPFTHANISSARRELGYKPTTDLQTGLKKFVRWYLSYYG  423



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA +STG+GGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAKK+VV+MP NG
Sbjct  331  SLDTAGRSTGTGGKKRGPAPYRIFNLGNTSPVTVPTLVSILEKHLRVKAKKHVVEMPGNG  390

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA +  GYKPTT+L +GL+KFVKWY+SYYG
Sbjct  391  DVPFTHANISLARQQLGYKPTTNLDAGLKKFVKWYLSYYG  430



>ref|XP_010108144.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXC17876.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=444

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA+KSTGSGGKK+G AQLRV+NLGNTSPV V +LV ILE LL +KAK  V+ +PRNG
Sbjct  338  ALDTAKKSTGSGGKKRGNAQLRVFNLGNTSPVPVTQLVRILEKLLKVKAKTKVLPLPRNG  397

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLAY++ GYKPTTDL +GL+KFV+WY++YY
Sbjct  398  DVKFTHANISLAYRELGYKPTTDLETGLKKFVRWYLNYY  436



>ref|XP_004171294.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGG+KKG AQLRV+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNG
Sbjct  301  ALDTAEKSTGSGGRKKGKAQLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNG  360

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA K+ GYKPTTDL +GL++FV WY  YY   S+
Sbjct  361  DVPFTHANISLAQKELGYKPTTDLKTGLKEFVDWYRLYYSNSSK  404



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA +STG+GGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAKK+V++MP NG
Sbjct  334  SLDTAGRSTGTGGKKRGPAPYRIFNLGNTSPVTVPTLVSILEKHLRVKAKKHVIEMPGNG  393

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA +  GYKPTT+L +GL+KFVKWY+SYYG
Sbjct  394  DVPFTHANISLARQQLGYKPTTNLDAGLKKFVKWYLSYYG  433



>ref|XP_004148129.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGG+KKG AQLRV+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNG
Sbjct  301  ALDTAEKSTGSGGRKKGKAQLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNG  360

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+SLA K+ GYKPTTDL +GL++FV WY  YY   S+
Sbjct  361  DVPFTHANISLAQKELGYKPTTDLKTGLKEFVDWYRLYYSNSSK  404



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NG
Sbjct  324  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVNILERHLKVKAKRNIVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFVKWY++YYG
Sbjct  384  DVPFTHANISLAQRELGYKPTTDLETGLKKFVKWYLTYYG  423



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NG
Sbjct  324  SLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFVKWY+SYYG
Sbjct  384  DVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYG  423



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA++STGSGGKK+GPAQ R++NLGNTSPV+V  +V ILE  L  KA KNVV+MP NG
Sbjct  325  SLDTAKRSTGSGGKKRGPAQFRIFNLGNTSPVTVPMMVGILEKQLKTKAHKNVVEMPGNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A  + GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  385  DVPFTHANISSARIELGYKPTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  +V ILE  L +KAKKN V+MP NG
Sbjct  319  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNG  378

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A K+FGYKPTTDL +GL+KFV+WY+SYYG
Sbjct  379  DVPFTHANISSARKEFGYKPTTDLQTGLKKFVRWYLSYYG  418



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTAEKSTGSGGKK+G AQLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNG
Sbjct  323  ALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNG  382

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+S A ++ GYKPTT+L +GL+KF +WY+ YY
Sbjct  383  DVQFTHANISSAQRELGYKPTTNLQTGLKKFARWYLGYY  421



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NG
Sbjct  324  SLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVNILERHLRVKAKRNIVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+SLA ++ GYKPTTDL +GL+KFVKWY++YYG
Sbjct  384  DVPFTHANISLAQRELGYKPTTDLETGLKKFVKWYLTYYG  423



>emb|CAN60968.1| hypothetical protein VITISV_008097 [Vitis vinifera]
Length=435

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTG+GGKKKG AQ R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNG
Sbjct  328  SLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSY  295
            DV +THAN+SLA ++ GYKPTTDL SGL+KFV+WY++Y
Sbjct  388  DVQYTHANISLAQRELGYKPTTDLESGLKKFVRWYITY  425



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDT+ KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NG
Sbjct  324  SLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFVKWY+SYYG
Sbjct  384  DVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYG  423



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA KSTGSGGKK+GPA  R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NG
Sbjct  324  SLDTAGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A  + GYKPTTDL +GL+KFVKWY+SYYG
Sbjct  384  DVPFTHANISSARAELGYKPTTDLQTGLKKFVKWYLSYYG  423



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTGSGGKK+ PAQ R++NLGNTSPV+V  +V ILE  L +KA+K +V+MP NG
Sbjct  325  SLDTAKKSTGSGGKKRRPAQYRIFNLGNTSPVTVPMMVGILEKQLKVKARKKMVEMPGNG  384

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYG  301
            DVPFTHAN+S A ++ GYKPTTDL +GL+KFV+WY+SYYG
Sbjct  385  DVPFTHANISSARRELGYKPTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_008794557.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Phoenix dactylifera]
Length=462

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            ALDTA KSTGSGGKK+GPA LRVYNLGNTSPV V  LVSILENLL +KA +  VKMPRNG
Sbjct  347  ALDTAGKSTGSGGKKRGPAPLRVYNLGNTSPVPVADLVSILENLLGVKAVRKAVKMPRNG  406

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYY  298
            DV FTHAN+SLA ++ GY PTT+L +GL++FV+WY+ YY
Sbjct  407  DVQFTHANISLAQRELGYHPTTNLHTGLKRFVRWYLQYY  445



>ref|XP_003635586.2| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=435

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTG+GGKKKG AQ R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNG
Sbjct  328  SLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNG  387

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSY  295
            DV +THAN+SLA ++ GYKPTTDL SGL+KFV+WY++Y
Sbjct  388  DVQYTHANISLAQRELGYKPTTDLESGLKKFVRWYITY  425



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALDTAEkstgsggkkkgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNG  181
            +LDTA+KSTGSGG+K+GPAQ R++NLGNTSPV+V  LV ILE  L +KAK++VV+MP NG
Sbjct  324  SLDTAQKSTGSGGRKRGPAQYRIFNLGNTSPVTVPALVGILERHLKVKAKRHVVEMPGNG  383

Query  182  DVPFTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQSR  313
            DVPFTHAN+S A  + GY PTT+L +GL+KFVKWY+SYYG   R
Sbjct  384  DVPFTHANISSARTELGYNPTTNLEAGLKKFVKWYLSYYGYNPR  427



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720