BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN015B23

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAW55668.1|  caffeoyl CoA 3-O-methyltransferase                      346   2e-117   Betula platyphylla [Asian white birch]
gb|AAT37172.1|  caffeoyl-CoA-O-methyltransferase                        345   4e-117   Broussonetia papyrifera [aka]
gb|ACF17646.1|  putative caffeoyl-CoA 3-O-methyltransferase             345   4e-117   Capsicum annuum
ref|XP_009600093.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 6      345   8e-117   Nicotiana tomentosiformis
dbj|BAK74806.1|  hypothetical protein                                   344   1e-116   Cyclamen persicum x Cyclamen purpurascens
ref|XP_010526962.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      345   1e-116   Tarenaya hassleriana [spider flower]
ref|XP_010270267.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    344   1e-116   Nelumbo nucifera [Indian lotus]
gb|ACJ38669.1|  caffeoyl-CoA O-methyltransferase                        344   1e-116   Betula luminifera [liang ye hua]
ref|XP_010263488.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        344   2e-116   Nelumbo nucifera [Indian lotus]
gb|AAS91565.1|  caffeoyl-CoA O-methyltransferase                        344   2e-116   Broussonetia papyrifera [aka]
sp|O04899.1|CAMT5_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    343   2e-116   Nicotiana tabacum [American tobacco]
gb|AFG17073.1|  caffeoyl-CoA O-methyltransferase                        343   2e-116   Paeonia lactiflora [common garden peony]
ref|XP_009776913.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      343   2e-116   Nicotiana sylvestris
ref|XP_010548003.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      344   2e-116   Tarenaya hassleriana [spider flower]
ref|XP_007201237.1|  hypothetical protein PRUPE_ppa010497mg             343   2e-116   Prunus persica
ref|XP_009622008.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      343   3e-116   Nicotiana tomentosiformis
ref|XP_006284297.1|  hypothetical protein CARUB_v10005466mg             344   3e-116   
ref|XP_008236475.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        343   3e-116   
ref|XP_006412281.1|  hypothetical protein EUTSA_v10026028mg             343   5e-116   Eutrema salsugineum [saltwater cress]
gb|KDP25013.1|  hypothetical protein JCGZ_23996                         343   5e-116   Jatropha curcas
ref|XP_004290595.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        342   5e-116   Fragaria vesca subsp. vesca
ref|XP_002282867.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        342   6e-116   Vitis vinifera
sp|Q8H9B6.1|CAMT_SOLTU  RecName: Full=Caffeoyl-CoA O-methyltransf...    342   7e-116   Solanum tuberosum [potatoes]
gb|AAT75320.2|  caffeoyl-CoA 3-O-methyltransferase                      342   7e-116   Boehmeria nivea [Chinese silk-plant]
ref|XP_004231857.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    342   7e-116   Solanum lycopersicum
ref|XP_009108759.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    342   8e-116   Brassica rapa
gb|AAT40111.1|  caffeoyl-CoA O-methyltransferase                        342   8e-116   Ammi majus [ameo mayor]
emb|CAN72492.1|  hypothetical protein VITISV_037012                     342   8e-116   Vitis vinifera
gb|EYU37656.1|  hypothetical protein MIMGU_mgv1a012535mg                342   8e-116   Erythranthe guttata [common monkey flower]
gb|ABZ89569.1|  O-methyltransferase 5                                   342   1e-115   Humulus lupulus [common hop]
gb|AAZ95245.1|  putative caffeoyl-CoA O-methyltransferase protein       342   1e-115   Isatis tinctoria [woad]
gb|ABE41833.1|  caffeoyl-CoA 3-O-methyltransferase                      342   1e-115   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_006487045.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    341   1e-115   Citrus sinensis [apfelsine]
ref|XP_011088234.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        341   2e-115   Sesamum indicum [beniseed]
ref|XP_009760383.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 6      341   2e-115   Nicotiana sylvestris
ref|XP_009138259.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      341   2e-115   Brassica rapa
sp|Q42945.1|CAMT6_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    341   2e-115   Nicotiana tabacum [American tobacco]
ref|XP_010107916.1|  Caffeoyl-CoA O-methyltransferase                   341   2e-115   Morus notabilis
sp|Q9SWB8.1|CAMT2_EUCGL  RecName: Full=Caffeoyl-CoA O-methyltrans...    341   3e-115   Eucalyptus globulus [blue gum]
ref|XP_006339881.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    340   3e-115   
ref|XP_006339879.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    340   3e-115   Solanum tuberosum [potatoes]
gb|ACF48821.1|  caffeoyl-CoA-O-methyltransferase                        340   3e-115   Gossypium hirsutum [American cotton]
ref|XP_006339880.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    340   3e-115   Solanum tuberosum [potatoes]
ref|XP_010447157.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    341   4e-115   Camelina sativa [gold-of-pleasure]
ref|XP_009341967.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    340   4e-115   Pyrus x bretschneideri [bai li]
dbj|BAG71890.1|  caffeoyl CoA O-methyltransferase                       340   4e-115   Carthamus tinctorius
gb|AFZ76980.1|  caffeoyl-CoA O-methyltransferase                        340   4e-115   Eriobotrya japonica [loquat]
ref|XP_008385739.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        340   4e-115   Malus domestica [apple tree]
ref|XP_003529403.2|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    341   5e-115   
sp|P28034.1|CAMT_PETCR  RecName: Full=Caffeoyl-CoA O-methyltransf...    340   5e-115   Petroselinum crispum
gb|AFU54611.1|  caffeoyl-CoA O-methyltransferase                        340   6e-115   Pyrus x bretschneideri [bai li]
gb|ACY66929.1|  caffeoyl-CoA O-methyltransferase 2                      340   7e-115   Eucalyptus camaldulensis
dbj|BAE48788.1|  caffeoyl-CoA-O-methyltransferase                       340   7e-115   Codonopsis lanceolata
gb|KHF99603.1|  Caffeoyl-CoA O-methyltransferase 1                      342   7e-115   Gossypium arboreum [tree cotton]
gb|ACX37696.1|  caffeoyl-CoA O-methyltransferase 2                      340   8e-115   Eucalyptus camaldulensis
gb|KFK30033.1|  hypothetical protein AALP_AA7G208900                    340   8e-115   Arabis alpina [alpine rockcress]
ref|NP_001268047.1|  caffeoyl-CoA O-methyltransferase                   339   8e-115   Vitis vinifera
emb|CDY49272.1|  BnaA03g50850D                                          340   9e-115   Brassica napus [oilseed rape]
ref|XP_004248757.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      339   9e-115   Solanum lycopersicum
emb|CDX72447.1|  BnaC07g44690D                                          340   9e-115   
ref|XP_010437675.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    340   1e-114   Camelina sativa [gold-of-pleasure]
gb|ABF74683.1|  caffeoyl-CoA-O-methyltransferase                        339   1e-114   Leucaena leucocephala [cassie]
gb|AEK52482.1|  caffeoyl-CoA 3-O-methyltransferase                      339   1e-114   Dimocarpus longan [longan]
ref|XP_010432473.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      340   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_004231856.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        339   1e-114   Solanum lycopersicum
gb|AFN85667.1|  putative caffeoyl-coenzyme A 3-O-methyltransferase      339   1e-114   Hibiscus cannabinus [bimli-jute]
gb|AFX98065.1|  caffeoyl-CoA O-methyltransferase                        339   1e-114   Cunninghamia lanceolata [China fir]
ref|XP_010066009.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 2      338   2e-114   Eucalyptus grandis [rose gum]
dbj|BAM05558.1|  caffeoyl-CoA O-methyltransferase                       338   2e-114   Eucalyptus pilularis
ref|XP_006856484.1|  hypothetical protein AMTR_s00046p00069700          338   2e-114   Amborella trichopoda
ref|XP_011000746.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      338   2e-114   Populus euphratica
ref|XP_009345067.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        338   3e-114   Pyrus x bretschneideri [bai li]
ref|NP_195131.1|  putative caffeoyl-CoA O-methyltransferase             338   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|ACQ59095.1|  caffeoyl CoA O-methyltransferase 1                      338   3e-114   Gossypium hirsutum [American cotton]
gb|ACZ06244.1|  caffeoyl-CoA O-methyltransferase 1                      338   3e-114   Gossypium hirsutum [American cotton]
ref|XP_011092559.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    338   3e-114   Sesamum indicum [beniseed]
ref|XP_002313125.1|  caffeoyl-CoA O-methyltransferase family protein    338   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_007042461.1|  S-adenosyl-L-methionine-dependent methyltran...    340   4e-114   
gb|ABB89956.1|  caffeoyl-CoA O-methyltransferase                        338   4e-114   Chamaecyparis formosensis [Formosan false cypress]
ref|XP_006356576.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    337   4e-114   Solanum tuberosum [potatoes]
ref|XP_009604110.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 2      337   5e-114   Nicotiana tomentosiformis
sp|Q43095.1|CAMT_POPTM  RecName: Full=Caffeoyl-CoA O-methyltransf...    337   6e-114   Populus tremuloides
gb|AFY97679.1|  caffeoyl-CoA-O-methyltransferase                        337   6e-114   Camellia sinensis [black tea]
gb|AAF44689.1|  caffeoyl-CoA O-methyltransferase                        337   6e-114   Populus tomentosa [Chinese white poplar]
ref|XP_003518701.2|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    340   7e-114   Glycine max [soybeans]
gb|ABB87184.1|  caffeoyl-CoA O-methyltransferase                        337   7e-114   Taiwania cryptomerioides
ref|XP_004231855.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    337   8e-114   
gb|AGR51164.1|  catechol-O-methyltransferase                            337   8e-114   Camellia sinensis [black tea]
gb|ABE60812.1|  caffeoyl coenzyme A 3-O-methyltransferase 2             337   8e-114   Leucaena leucocephala [cassie]
emb|CBI32387.3|  unnamed protein product                                337   8e-114   Vitis vinifera
ref|XP_011000123.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 2      337   8e-114   Populus euphratica
gb|KGN43930.1|  Caffeoyl-CoA O-methyltransferase                        338   9e-114   Cucumis sativus [cucumbers]
ref|XP_010690616.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        337   1e-113   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB47341.1|  hypothetical protein B456_008G024000                    339   1e-113   Gossypium raimondii
dbj|BAG71889.1|  caffeoyl CoA O-methyltransferase                       337   1e-113   Carthamus tinctorius
gb|KHN05829.1|  Caffeoyl-CoA O-methyltransferase                        337   1e-113   Glycine soja [wild soybean]
gb|KHG18720.1|  Caffeoyl-CoA O-methyltransferase 1                      337   1e-113   Gossypium arboreum [tree cotton]
sp|O24150.2|CAMT3_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    336   2e-113   Nicotiana tabacum [American tobacco]
ref|XP_007047308.1|  Caffeoyl-CoA O-methyltransferase 1                 336   2e-113   Theobroma cacao [chocolate]
gb|KHN43056.1|  Caffeoyl-CoA O-methyltransferase                        336   2e-113   Glycine soja [wild soybean]
sp|O24144.1|CAMT1_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    336   2e-113   Nicotiana tabacum [American tobacco]
gb|KJB77663.1|  hypothetical protein B456_012G149800                    336   2e-113   Gossypium raimondii
dbj|BAG71891.1|  caffeoyl CoA O-methyltransferase                       336   2e-113   Carthamus tinctorius
sp|O24151.1|CAMT4_TOBAC  RecName: Full=Caffeoyl-CoA O-methyltrans...    336   2e-113   Nicotiana tabacum [American tobacco]
ref|XP_009604111.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 3      336   2e-113   Nicotiana tomentosiformis
ref|XP_008454948.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 5      335   3e-113   Cucumis melo [Oriental melon]
gb|AAM66108.1|  caffeoyl-CoA O-methyltransferase-like protein           336   3e-113   Arabidopsis thaliana [mouse-ear cress]
gb|ABK94003.1|  unknown                                                 335   3e-113   Populus trichocarpa [western balsam poplar]
ref|XP_009407208.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        335   3e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG16338.1|  Caffeoyl-CoA O-methyltransferase 1                      335   4e-113   Gossypium arboreum [tree cotton]
gb|AFY97680.1|  caffeoyl-CoA-O-methyltransferase                        335   4e-113   Camellia sinensis [black tea]
gb|AII00961.1|  coffee acyl coenzyme A-3-O-methyl transferase           335   5e-113   Curcuma longa
gb|AFZ78548.1|  caffeoyl-CoA O-methyltransferase                        335   6e-113   Populus tomentosa [Chinese white poplar]
ref|XP_002518739.1|  o-methyltransferase, putative                      335   6e-113   Ricinus communis
ref|XP_006346396.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    335   7e-113   Solanum tuberosum [potatoes]
ref|XP_009784107.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      334   8e-113   Nicotiana sylvestris
ref|XP_004230766.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 6      334   8e-113   Solanum lycopersicum
gb|ACH47151.1|  caffeoyl-CoA 3-O-methyltransferase                      334   9e-113   Linum usitatissimum
ref|XP_009784105.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    334   9e-113   Nicotiana sylvestris
dbj|BAG71892.1|  caffeoyl CoA O-methyltransferase                       334   1e-112   Carthamus tinctorius
dbj|BAG71894.1|  caffeoyl CoA O-methyltransferase                       334   1e-112   Carthamus tinctorius
ref|XP_004136981.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    334   1e-112   Cucumis sativus [cucumbers]
ref|XP_004505242.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    334   1e-112   
gb|ACJ84500.1|  unknown                                                 334   1e-112   Medicago truncatula
dbj|BAM05559.1|  caffeoyl-CoA O-methyltransferase                       334   1e-112   Eucalyptus globulus subsp. globulus
ref|XP_003607927.1|  Caffeoyl-CoA O-methyltransferase                   334   1e-112   Medicago truncatula
gb|AAY89237.1|  caffeoyl-CoA 3-O-methyltransferase                      334   1e-112   Linum usitatissimum
sp|Q40313.1|CAMT_MEDSA  RecName: Full=Caffeoyl-CoA O-methyltransf...    334   1e-112   Medicago sativa [alfalfa]
ref|NP_001234801.1|  caffeoyl-CoA O-methyltransferase                   333   1e-112   Solanum lycopersicum
ref|XP_007042462.1|  S-adenosyl-L-methionine-dependent methyltran...    333   2e-112   
gb|AFD23679.1|  caffeoyl CoA O-methyltransferase                        333   2e-112   Salvia miltiorrhiza [Chinese salvia]
gb|AEV93479.1|  cinnamoyl-CoA O-methyltransferase                       333   2e-112   Caragana korshinskii
gb|AEW26089.1|  caffeoyl-CoA 3-o-methyltransferase                      333   2e-112   Medicago sativa subsp. x varia
gb|AEW26107.1|  caffeoyl-CoA 3-o-methyltransferase                      332   3e-112   Medicago sativa subsp. caerulea
gb|AEW26132.1|  caffeoyl-CoA 3-o-methyltransferase                      333   3e-112   Medicago sativa subsp. caerulea
gb|AEW26103.1|  caffeoyl-CoA 3-o-methyltransferase                      332   3e-112   Medicago sativa subsp. x varia
ref|XP_006422984.1|  hypothetical protein CICLE_v10029158mg             333   4e-112   Citrus clementina [clementine]
gb|ACQ59096.1|  caffeoyl CoA O-methyltransferase 2                      333   4e-112   Gossypium hirsutum [American cotton]
gb|AEM45654.1|  caffeoyl-CoA O-methyltransferase 3                      333   4e-112   Gerbera jamesonii [Transvaal daisy]
sp|O04854.1|CAMT_EUCGU  RecName: Full=Caffeoyl-CoA O-methyltransf...    332   5e-112   Eucalyptus gunnii
gb|ABO77959.1|  caffeoyl-CoA 3-O methyltransferase                      332   5e-112   Coffea canephora [robusta coffee]
ref|XP_002298729.1|  caffeoyl-CoA O-methyltransferase family protein    332   6e-112   Populus trichocarpa [western balsam poplar]
ref|XP_008799011.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        333   6e-112   Phoenix dactylifera
gb|KJB79353.1|  hypothetical protein B456_013G045300                    332   7e-112   Gossypium raimondii
ref|XP_009413346.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    332   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACE95173.1|  caffeoyl-CoA-3-O-methyltransferase                      332   1e-111   Populus tomentosa [Chinese white poplar]
gb|ABK21526.1|  unknown                                                 332   1e-111   Picea sitchensis
ref|XP_007153585.1|  hypothetical protein PHAVU_003G047900g             331   1e-111   Phaseolus vulgaris [French bean]
gb|AEM45655.1|  caffeoyl-CoA O-methyltransferase 3                      331   1e-111   Petunia x hybrida [garden petunia]
gb|ABX75853.1|  caffeoyl-CoA-O-methyltransferase                        331   2e-111   Acacia auriculiformis x Acacia mangium
gb|AEW26114.1|  caffeoyl-CoA 3-o-methyltransferase                      331   2e-111   Medicago falcata [sickle alfalfa]
sp|Q41720.1|CAMT_ZINVI  RecName: Full=Caffeoyl-CoA O-methyltransf...    331   2e-111   Zinnia elegans [garden zinnia]
gb|ADI43381.1|  caffeoyl-CoA O-methyltransferase                        331   2e-111   Eucalyptus camaldulensis
gb|ACV50428.1|  caffeoyl-CoA O-methyltransferase                        331   2e-111   Jatropha curcas
gb|ABL86148.1|  caffeoyl CoAO-methyltransferase                         330   3e-111   Populus deltoides
ref|XP_010028437.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        330   3e-111   Eucalyptus grandis [rose gum]
gb|AEW26126.1|  caffeoyl-CoA 3-o-methyltransferase                      330   3e-111   Medicago falcata [sickle alfalfa]
gb|KDP31954.1|  hypothetical protein JCGZ_12415                         332   3e-111   Jatropha curcas
gb|AFZ15799.1|  caffeoyl-CoA O-methyltransferase                        330   3e-111   Lonicera japonica [Japanese honeysuckle]
emb|CAK18782.1|  caffeoyl CoA O-methyltransferase                       330   5e-111   Picea abies
gb|AAK16714.1|  caffeoyl-CoA 3-O-methyltransferase                      330   5e-111   Populus alba x Populus glandulosa
sp|O81185.1|CAMT1_EUCGL  RecName: Full=Caffeoyl-CoA O-methyltrans...    330   6e-111   Eucalyptus globulus [blue gum]
gb|AEW26143.1|  caffeoyl-CoA 3-o-methyltransferase                      327   8e-111   Medicago falcata [sickle alfalfa]
ref|XP_002523619.1|  o-methyltransferase, putative                      331   9e-111   
gb|AFL65039.1|  caffeoyl-CoA-O-methyltransferase                        330   9e-111   Pinus pinaster [cluster pine]
gb|AHL67654.1|  caffeoyl-CoA 3-O-methyltransferase                      330   9e-111   Pinus massoniana [Chinese red pine]
emb|CBL95257.2|  caffeoyl CoA O-methyltransferase                       330   9e-111   Pinus pinaster [cluster pine]
sp|O65162.1|CAMT_MESCR  RecName: Full=Caffeoyl-CoA O-methyltransf...    329   1e-110   Mesembryanthemum crystallinum
gb|ABR17605.1|  unknown                                                 328   3e-110   Picea sitchensis
gb|ACN40635.1|  unknown                                                 328   4e-110   Picea sitchensis
gb|AEW26090.1|  caffeoyl-CoA 3-o-methyltransferase                      324   6e-110   Medicago sativa subsp. caerulea
dbj|BAM05557.1|  caffeoyl-CoA O-methyltransferase                       326   2e-109   Eucalyptus globulus subsp. globulus
gb|ADV40957.1|  caffeoyl-CoA O-methyltransferase                        327   2e-109   Pinus radiata
gb|AFK44432.1|  unknown                                                 326   2e-109   Lotus japonicus
ref|XP_008366398.1|  PREDICTED: caffeoyl-CoA O-methyltransferase        325   2e-109   Malus domestica [apple tree]
gb|ABK22164.1|  unknown                                                 326   3e-109   Picea sitchensis
gb|AFD53035.1|  caffeoyl-CoA O-methyltransferase                        325   7e-109   Bambusa emeiensis
gb|ABB87185.1|  caffeoyl-CoA O-methyltransferase                        325   1e-108   Chamaecyparis obtusa var. formosana [arisan hinoki]
gb|AAR91504.1|  caffeoyl-CoA-O-methyltransferase                        323   2e-108   Corchorus capsularis [jute]
gb|ABO26812.1|  caffeoyl-CoA O-methyltransferase                        323   2e-108   Bambusa oldhamii
gb|EPS69718.1|  hypothetical protein M569_05045                         323   3e-108   Genlisea aurea
dbj|BAK01687.1|  predicted protein                                      322   8e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q9ZTT5.1|CAMT_PINTA  RecName: Full=Caffeoyl-CoA O-methyltransf...    322   8e-108   Pinus taeda
dbj|BAG71893.1|  caffeoyl CoA O-methyltransferase                       319   1e-106   Carthamus tinctorius
gb|AIN39535.1|  caffeoyl-CoA-3-O-methyl transferase                     319   2e-106   Cenchrus purpureus [elephant grass]
ref|XP_009413345.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    319   3e-106   
gb|ABR16981.1|  unknown                                                 317   7e-106   Picea sitchensis
ref|NP_001056910.1|  Os06g0165800                                       316   2e-105   
gb|EAY99818.1|  hypothetical protein OsI_21809                          316   2e-105   Oryza sativa Indica Group [Indian rice]
gb|ADC84472.1|  caffeoyl CoA O-methyltransferase                        312   2e-105   Salix sachalinensis
sp|Q9SLP8.1|CAMT_CITNA  RecName: Full=Caffeoyl-CoA O-methyltransf...    315   2e-105   Citrus natsudaidai
gb|ABM79759.1|  caffeoyl-CoA O-methyltransferase                        314   4e-105   Vitis vinifera
ref|XP_006655824.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    315   4e-105   Oryza brachyantha
ref|XP_009764364.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    314   7e-105   Nicotiana sylvestris
gb|ADC84473.1|  caffeoyl CoA O-methyltransferase                        309   4e-104   Salix miyabeana
gb|AAP37885.1|  caffeoyl CoA 3-O-methyltransferase                      312   1e-103   Zea mays [maize]
gb|AAP37884.1|  caffeoyl CoA 3-O-methyltransferase                      311   2e-103   Zea mays [maize]
sp|Q9XGD5.1|CAMT2_MAIZE  RecName: Full=Caffeoyl-CoA O-methyltrans...    311   2e-103   Zea mays [maize]
gb|AAP37876.1|  caffeoyl CoA 3-O-methyltransferase                      309   1e-102   Zea mays [maize]
gb|AAP37882.1|  caffeoyl CoA 3-O-methyltransferase                      309   1e-102   Zea mays [maize]
gb|AAP37881.1|  caffeoyl CoA 3-O-methyltransferase                      309   1e-102   Zea mays [maize]
gb|AAP37879.1|  caffeoyl CoA 3-O-methyltransferase                      309   1e-102   Zea mays [maize]
gb|AAP37878.1|  caffeoyl CoA 3-O-methyltransferase                      309   1e-102   Zea mays [maize]
gb|EMS59880.1|  Caffeoyl-CoA O-methyltransferase 2                      308   8e-102   Triticum urartu
gb|ACF79629.1|  unknown                                                 311   1e-101   Zea mays [maize]
gb|AAP33129.1|  caffeoyl CoA 3-O-methyltransferase                      306   1e-101   Zea mays [maize]
dbj|BAO20881.1|  caffeoyl CoA O-methyltransferase 1                     304   9e-101   Panicum virgatum
ref|XP_002436550.1|  hypothetical protein SORBIDRAFT_10g004540          304   1e-100   Sorghum bicolor [broomcorn]
gb|ABQ45355.1|  caffeoyl-CoA 3-O-methyltransferase                      302   1e-100   Amorpha fruticosa [bastard indigo]
gb|KHN42093.1|  Caffeoyl-CoA O-methyltransferase 2                      303   2e-100   Glycine soja [wild soybean]
gb|ACG38343.1|  caffeoyl-CoA O-methyltransferase 1                      303   3e-100   Zea mays [maize]
gb|KHN36241.1|  Caffeoyl-CoA O-methyltransferase 2                      302   3e-100   Glycine soja [wild soybean]
gb|AFY17068.1|  caffeoyl-coenzymeA O-methyltransferase 1b               302   6e-100   Panicum virgatum
sp|Q9XGD6.1|CAMT1_MAIZE  RecName: Full=Caffeoyl-CoA O-methyltrans...    302   8e-100   Zea mays [maize]
ref|NP_001242163.1|  uncharacterized protein LOC100799303               301   1e-99    
gb|AAQ89900.1|  caffeoyl-CoA 3-O-methyltransferase 1                    301   1e-99    Zea mays [maize]
ref|XP_003564267.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      301   2e-99    Brachypodium distachyon [annual false brome]
ref|XP_007156786.1|  hypothetical protein PHAVU_002G017500g             300   3e-99    Phaseolus vulgaris [French bean]
gb|AAV68503.1|  putative caffeoyl-CoA 3-O-methyltransferase             296   3e-99    Brassica napus [oilseed rape]
gb|AEJ83060.1|  caffeoyl CoA 3-O-methyltransferase                      298   3e-98    Miscanthus lutarioriparius
ref|XP_002523618.1|  o-methyltransferase, putative                      299   5e-98    
gb|AAV65754.1|  caffeoyl-CoA O-methyltransferase                        293   7e-98    Boehmeria nivea [Chinese silk-plant]
gb|AAV80203.1|  caffeoyl-CoA 3-O-methyltransferase                      293   1e-97    Brassica napus [oilseed rape]
gb|AAV80200.1|  caffeoyl-CoA 3-O-methyltransferase                      293   1e-97    Boehmeria nivea [Chinese silk-plant]
gb|ACX37697.1|  caffeoyl-CoA O-methyltransferase 1                      294   3e-97    Eucalyptus camaldulensis
gb|AHX74224.1|  caffeoyl-CoA O-methyltransferase                        295   3e-97    
ref|XP_009418796.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    295   3e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAV80199.1|  caffeoyl-CoA 3-O-methyltransferase                      290   1e-96    Boehmeria nivea [Chinese silk-plant]
ref|XP_006466586.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    292   4e-96    Citrus sinensis [apfelsine]
ref|XP_010928606.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    291   1e-95    Elaeis guineensis
ref|XP_006425921.1|  hypothetical protein CICLE_v10026344mg             291   1e-95    Citrus clementina [clementine]
gb|ACL54796.1|  unknown                                                 291   4e-95    Zea mays [maize]
ref|XP_002963752.1|  hypothetical protein SELMODRAFT_266699             290   8e-95    Selaginella moellendorffii
ref|XP_002974834.1|  hypothetical protein SELMODRAFT_101771             289   2e-94    
gb|AGV54319.1|  caffeoyl CoA O-methyltransferase                        286   4e-94    Phaseolus vulgaris [French bean]
ref|XP_006427260.1|  hypothetical protein CICLE_v10026347mg             286   5e-94    Citrus clementina [clementine]
ref|XP_006465346.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    286   5e-94    Citrus sinensis [apfelsine]
gb|ACJ84250.1|  unknown                                                 286   1e-93    Medicago truncatula
ref|XP_007155910.1|  hypothetical protein PHAVU_003G242400g             285   2e-93    Phaseolus vulgaris [French bean]
ref|XP_002976256.1|  hypothetical protein SELMODRAFT_271191             286   2e-93    Selaginella moellendorffii
ref|XP_002987152.1|  hypothetical protein SELMODRAFT_158563             286   2e-93    Selaginella moellendorffii
gb|AFK40182.1|  unknown                                                 284   5e-93    Medicago truncatula
gb|AFK31247.1|  caffeoyl-CoA O-methyltransferase                        280   2e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_006428886.1|  hypothetical protein CICLE_v10012561mg             282   2e-92    Citrus clementina [clementine]
ref|XP_006480587.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    282   2e-92    Citrus sinensis [apfelsine]
gb|KDP31955.1|  hypothetical protein JCGZ_12416                         281   3e-92    Jatropha curcas
gb|EMT14560.1|  Caffeoyl-CoA O-methyltransferase 2                      282   3e-92    
ref|XP_002523620.1|  o-methyltransferase, putative                      281   5e-92    
gb|AFK31263.1|  caffeoyl-CoA O-methyltransferase                        278   1e-91    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31258.1|  caffeoyl-CoA O-methyltransferase                        278   1e-91    Oryza sativa Japonica Group [Japonica rice]
gb|AFK31264.1|  caffeoyl-CoA O-methyltransferase                        278   1e-91    Oryza rufipogon [common wild rice]
gb|AFK31265.1|  caffeoyl-CoA O-methyltransferase                        278   2e-91    Oryza rufipogon [common wild rice]
gb|ACY66930.1|  caffeoyl-CoA O-methyltransferase 1                      279   2e-91    Eucalyptus camaldulensis
gb|AFK31250.1|  caffeoyl-CoA O-methyltransferase                        277   4e-91    Oryza sativa Indica Group [Indian rice]
gb|AAU95084.1|  caffeoyl-CoA 3-0-methyltransferase                      277   5e-91    Apium graveolens Dulce Group [celery]
ref|NP_001236240.1|  uncharacterized protein LOC100305498               279   6e-91    Glycine max [soybeans]
gb|ABB04868.1|  caffeoyl-CoA O-methyltransferase                        277   8e-91    Leucaena leucocephala [cassie]
ref|XP_009414015.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    277   3e-90    
gb|ABK23571.1|  unknown                                                 276   5e-90    Picea sitchensis
gb|KJB47340.1|  hypothetical protein B456_008G024000                    276   9e-90    Gossypium raimondii
ref|XP_008793869.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    275   2e-89    Phoenix dactylifera
gb|ABC42571.1|  caffeoyl-CoA 3-O-methyltransferase                      273   2e-89    Leucaena leucocephala [cassie]
gb|ADE77434.1|  unknown                                                 275   2e-89    Picea sitchensis
gb|KJB32361.1|  hypothetical protein B456_005G237100                    274   3e-89    Gossypium raimondii
gb|ABK23448.1|  unknown                                                 273   4e-89    Picea sitchensis
gb|ADX42663.1|  caffeoyl-CoA O-methyltransferase 1                      270   6e-89    Eucalyptus pellita
ref|XP_006425919.1|  hypothetical protein CICLE_v10026344mg             273   1e-88    
gb|EYU42680.1|  hypothetical protein MIMGU_mgv1a020383mg                269   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_009784106.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    270   3e-88    Nicotiana sylvestris
ref|XP_004159925.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    266   5e-87    
gb|AFK36713.1|  unknown                                                 264   4e-86    Lotus japonicus
gb|AAQ89932.1|  caffeoyl-CoA 3-O-methyltransferase 1                    264   2e-85    Zea mays [maize]
gb|AAQ89929.1|  caffeoyl-CoA 3-O-methyltransferase 1                    264   4e-85    Zea mays [maize]
ref|XP_008780757.1|  PREDICTED: caffeoyl-CoA O-methyltransferase 1      256   2e-83    Phoenix dactylifera
gb|AFW75632.1|  hypothetical protein ZEAMMB73_253085                    257   2e-83    
ref|XP_009794693.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    256   3e-83    Nicotiana sylvestris
gb|AEW26101.1|  caffeoyl-CoA 3-o-methyltransferase                      257   4e-83    Medicago falcata [sickle alfalfa]
gb|KEH31482.1|  caffeoyl-CoA 3-O-methyltransferase                      258   9e-83    Medicago truncatula
ref|XP_001755011.1|  predicted protein                                  256   4e-82    
gb|ACB45436.1|  caffeoyl-coenzyme A 3-O-methyltransferase               251   2e-81    
emb|CAM58807.1|  Caffeoyl-CoA-O-methyltransferase                       250   4e-81    
ref|XP_009391260.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    254   5e-81    
ref|XP_009386481.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    253   5e-81    
gb|KEH31473.1|  caffeoyl-CoA 3-O-methyltransferase                      251   3e-80    
gb|AFW85673.1|  hypothetical protein ZEAMMB73_482080                    248   2e-79    
gb|KEH31446.1|  caffeoyl-CoA 3-O-methyltransferase                      247   1e-78    
gb|AFX98064.1|  caffeoyl-CoA O-methyltransferase                        246   2e-78    
ref|XP_009386482.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    246   3e-78    
gb|KJB47338.1|  hypothetical protein B456_008G024000                    245   6e-78    
gb|AFK39179.1|  unknown                                                 245   7e-78    
emb|CAA04769.1|  caffeoyl-CoA 3-O-methyltransferase                     241   5e-77    
ref|XP_006422983.1|  hypothetical protein CICLE_v10029158mg             239   2e-76    
ref|XP_006413213.1|  hypothetical protein EUTSA_v10026121mg             240   7e-76    
gb|AAD50442.1|AF168779_1  caffeoyl-CoA O-methyltransferase              238   7e-76    
ref|XP_006475391.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    238   3e-75    
ref|XP_002514166.1|  o-methyltransferase, putative                      237   6e-75    
ref|XP_006451397.1|  hypothetical protein CICLE_v10009335mg             236   1e-74    
gb|AFS33547.1|  caffeoyl-CoA O-methyltransferase                        234   2e-74    
ref|XP_010905196.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    236   3e-74    
ref|XP_008387602.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    236   3e-74    
ref|XP_011077939.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    235   4e-74    
ref|XP_008362967.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    235   4e-74    
gb|KJB27192.1|  hypothetical protein B456_004G283700                    235   6e-74    
gb|KDO59273.1|  hypothetical protein CISIN_1g026457mg                   235   7e-74    
gb|KCW55184.1|  hypothetical protein EUGRSUZ_I01134                     233   8e-74    
ref|XP_008344013.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    233   2e-73    
ref|XP_004287520.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    234   4e-73    
ref|XP_006451395.1|  hypothetical protein CICLE_v10009342mg             233   4e-73    
ref|XP_002275207.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    233   5e-73    
ref|XP_009786206.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    234   5e-73    
ref|XP_008337636.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    233   5e-73    
gb|KHG02594.1|  hypothetical protein F383_24485                         233   7e-73    
emb|CBI21900.3|  unnamed protein product                                234   8e-73    
ref|XP_002869621.1|  hypothetical protein ARALYDRAFT_913940             232   8e-73    
gb|AAD50441.1|AF168778_1  caffeoyl-CoA O-methyltransferase              230   9e-73    
ref|XP_004973808.1|  PREDICTED: tricin synthase 1-like                  232   9e-73    
ref|XP_010656230.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    232   1e-72    
emb|CBI27951.3|  unnamed protein product                                233   1e-72    
dbj|BAK74805.1|  hypothetical protein                                   231   1e-72    
ref|XP_002279936.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    231   2e-72    
ref|XP_007012915.1|  S-adenosyl-L-methionine-dependent methyltran...    231   2e-72    
ref|XP_011077938.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    231   2e-72    
emb|CAA10217.1|  caffeoyl-CoA 3-O-methyltransferase                     229   3e-72    
ref|XP_008242435.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    231   3e-72    
ref|XP_010656229.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    231   3e-72    
emb|CAN62003.1|  hypothetical protein VITISV_007881                     232   3e-72    
ref|XP_010656228.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    231   3e-72    
ref|XP_009598639.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    230   5e-72    
ref|XP_002444818.1|  hypothetical protein SORBIDRAFT_07g028530          230   6e-72    
ref|XP_010438785.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    229   7e-72    
gb|KDP33749.1|  hypothetical protein JCGZ_07320                         229   8e-72    
ref|XP_008337635.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    229   9e-72    
ref|XP_010536849.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    230   1e-71    
ref|XP_009142090.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    230   1e-71    
ref|XP_010536850.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    229   1e-71    
emb|CDX89352.1|  BnaA01g15410D                                          234   1e-71    
ref|XP_009413347.1|  PREDICTED: caffeoyl-CoA O-methyltransferase ...    228   2e-71    
gb|ABA18712.1|  caffeoyl CoA 3-O-methyltransferase                      224   2e-71    
ref|XP_009619045.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    230   3e-71    
ref|XP_009619044.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    231   3e-71    
dbj|BAO20882.1|  caffeoyl CoA O-methyltransferase 2                     228   3e-71    
emb|CDY60872.1|  BnaC03g77610D                                          228   4e-71    
ref|XP_003532460.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    228   5e-71    
ref|XP_011077954.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    228   5e-71    
gb|ABN09207.1|  caffeoyl-CoA 3-O-methyltransferase                      224   5e-71    
ref|NP_001152511.1|  caffeoyl-CoA O-methyltransferase 1                 228   6e-71    
ref|XP_003574709.1|  PREDICTED: tricin synthase 1-like                  227   8e-71    
ref|XP_010448306.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    227   9e-71    
ref|XP_009780390.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    227   1e-70    
ref|XP_002462549.1|  hypothetical protein SORBIDRAFT_02g027930          227   1e-70    
ref|XP_006427259.1|  hypothetical protein CICLE_v10026347mg             224   1e-70    
ref|XP_011459652.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    228   1e-70    
ref|XP_007012916.1|  S-adenosyl-L-methionine-dependent methyltran...    226   2e-70    
ref|XP_006343340.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    226   2e-70    
gb|AFK44743.1|  unknown                                                 224   2e-70    
ref|NP_567739.1|  putative caffeoyl-CoA O-methyltransferase             226   2e-70    
ref|XP_002514167.1|  o-methyltransferase, putative                      226   2e-70    
ref|XP_008242438.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    226   3e-70    
gb|ABN09208.1|  caffeoyl-CoA 3-O-methyltransferase                      223   3e-70    
ref|XP_007202498.1|  hypothetical protein PRUPE_ppa010674mg             226   3e-70    
ref|XP_006371951.1|  hypothetical protein POPTR_0018s06630g             226   3e-70    
gb|AIL54541.1|  norbelladine 4'-O-methyltransferase                     225   4e-70    
dbj|BAK74804.1|  anthocyanin O-methyltransferase                        225   4e-70    
gb|AFK47350.1|  unknown                                                 225   4e-70    
ref|XP_004957144.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    225   4e-70    
gb|KDO55251.1|  hypothetical protein CISIN_1g029536mg                   223   4e-70    
ref|XP_004237700.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    227   4e-70    
ref|XP_006660250.1|  PREDICTED: LOW QUALITY PROTEIN: tricin synth...    228   5e-70    
ref|XP_010905194.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    225   5e-70    
ref|XP_009142098.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    225   5e-70    
emb|CDX94354.1|  BnaC01g18300D                                          226   5e-70    
ref|XP_004237699.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    227   5e-70    
ref|XP_004300604.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    225   6e-70    
ref|XP_006282704.1|  hypothetical protein CARUB_v10005649mg             224   6e-70    
ref|XP_006425920.1|  hypothetical protein CICLE_v10026344mg             223   9e-70    
ref|XP_004234518.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    224   1e-69    
gb|AIL54542.1|  norbelladine 4'-O-methyltransferase                     224   2e-69    
gb|AFK39727.1|  unknown                                                 223   2e-69    
gb|AIL54545.1|  norbelladine 4'-O-methyltransferase                     223   2e-69    
ref|XP_010047610.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    223   3e-69    
ref|XP_008387566.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    223   3e-69    
gb|ABB04870.1|  caffeoyl-CoA O-methyltransferase                        219   3e-69    
gb|AIL54543.1|  norbelladine 4'-O-methyltransferase                     223   4e-69    
ref|NP_001063495.1|  Os09g0481400                                       223   4e-69    
gb|EAZ09516.1|  hypothetical protein OsI_31791                          223   4e-69    
ref|XP_004288912.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    222   5e-69    
gb|AIL54544.1|  norbelladine 4'-O-methyltransferase                     222   6e-69    
ref|XP_011008887.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    222   6e-69    
ref|XP_010047611.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    222   6e-69    
ref|XP_004287517.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    222   6e-69    
dbj|BAK74803.1|  hypothetical protein                                   222   1e-68    
ref|XP_004503528.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    221   1e-68    
ref|XP_006660748.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    221   2e-68    
gb|KHN16673.1|  Putative caffeoyl-CoA O-methyltransferase               226   2e-68    
gb|KJB65098.1|  hypothetical protein B456_010G081000                    222   2e-68    
ref|XP_010047614.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    221   2e-68    
ref|XP_003574707.1|  PREDICTED: tricin synthase 2-like                  221   2e-68    
gb|AGQ21571.1|  cation-dependent phenylpropanoid and flavonoid O-...    220   3e-68    
gb|AAM64800.1|  caffeoyl-CoA O-methyltransferase-like protein           220   4e-68    
gb|EYU30663.1|  hypothetical protein MIMGU_mgv1a012878mg                220   4e-68    
ref|XP_007012912.1|  S-adenosyl-L-methionine-dependent methyltran...    220   6e-68    
gb|KDO55250.1|  hypothetical protein CISIN_1g029536mg                   218   6e-68    
gb|ABB04869.1|  caffeoyl-CoA O-methyltransferase                        215   7e-68    
ref|XP_010317684.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    219   7e-68    
ref|XP_008811374.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    219   7e-68    
gb|AFA42329.2|  CCoAoMT protein                                         214   1e-67    
ref|XP_010433534.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    219   1e-67    
ref|XP_007012914.1|  S-adenosyl-L-methionine-dependent methyltran...    219   2e-67    
emb|CAJ26379.1|  putative caffeoyl-CoA O-methyltransferase              218   3e-67    
ref|XP_010050460.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    218   4e-67    
emb|CAB38951.1|  caffeoyl-CoA O-methyltransferase-like protein          218   4e-67    
ref|XP_004287518.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    218   4e-67    
ref|XP_004973810.1|  PREDICTED: tricin synthase 2-like isoform X1       220   4e-67    
gb|KJB32362.1|  hypothetical protein B456_005G237100                    215   5e-67    
dbj|BAJ99310.1|  predicted protein                                      218   6e-67    
gb|ACU23135.1|  unknown                                                 216   8e-67    
gb|KHM99836.1|  Putative caffeoyl-CoA O-methyltransferase               217   9e-67    
gb|AIE77044.1|  anthocyanin methyltransferase                           216   1e-66    
gb|AIE77050.1|  anthocyanin methyltransferase                           216   1e-66    
gb|AIE77049.1|  anthocyanin methyltransferase                           216   1e-66    
ref|XP_006853987.1|  hypothetical protein AMTR_s00036p00228690          216   1e-66    
ref|NP_001242455.1|  probable caffeoyl-CoA O-methyltransferase At...    216   1e-66    
gb|AIE77046.1|  anthocyanin methyltransferase                           216   2e-66    
ref|XP_003530533.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    215   3e-66    
ref|XP_009604811.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    214   5e-66    
emb|CDP03202.1|  unnamed protein product                                214   9e-66    
ref|XP_003620871.1|  Caffeoyl-CoA O-methyltransferase                   214   9e-66    
ref|XP_004973812.1|  PREDICTED: tricin synthase 2-like isoform X3       216   1e-65    
ref|XP_004973811.1|  PREDICTED: tricin synthase 2-like isoform X2       216   1e-65    
ref|XP_009780087.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    213   2e-65    
ref|XP_006659540.1|  PREDICTED: tricin synthase 1-like                  214   2e-65    
gb|ABB55463.1|  caffeoyl CoA O-methyl transferase                       209   2e-65    
ref|XP_003517937.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    213   3e-65    
gb|ACU19602.1|  unknown                                                 213   3e-65    
ref|XP_006363473.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    213   3e-65    
ref|XP_010682786.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    213   3e-65    
ref|NP_001274974.1|  flavonoid 3',5'-methyltransferase-like             213   4e-65    
dbj|BAK01719.1|  predicted protein                                      213   4e-65    
ref|NP_001062142.1|  Os08g0498100                                       213   6e-65    
tpg|DAA40360.1|  TPA: caffeoyl-CoA O-methyltransferase 1                213   7e-65    
ref|XP_003578304.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    212   1e-64    
gb|AIE77047.1|  anthocyanin methyltransferase                           211   1e-64    
gb|ACG36166.1|  caffeoyl-CoA O-methyltransferase 1                      212   1e-64    
ref|XP_010655817.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    211   1e-64    
gb|AIE77045.1|  anthocyanin methyltransferase                           211   1e-64    
ref|XP_004973809.1|  PREDICTED: tricin synthase 1-like                  211   1e-64    
dbj|BAJ90386.1|  predicted protein                                      211   1e-64    
ref|XP_007152933.1|  hypothetical protein PHAVU_004G172600g             211   1e-64    
ref|XP_007152934.1|  hypothetical protein PHAVU_004G172600g             211   2e-64    
ref|XP_008344119.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    214   2e-64    
ref|NP_001289828.1|  flavonoid 3',5'-methyltransferase                  210   4e-64    
ref|NP_001062144.1|  Os08g0498600                                       209   5e-64    
gb|AIE77048.1|  anthocyanin methyltransferase                           209   7e-64    
dbj|BAK07710.1|  predicted protein                                      209   9e-64    
gb|EEE68939.1|  hypothetical protein OsJ_27816                          209   2e-63    
gb|EYU36922.1|  hypothetical protein MIMGU_mgv1a012975mg                208   2e-63    
emb|CAN75051.1|  hypothetical protein VITISV_020117                     224   2e-63    
sp|Q43161.1|CAMT_STELP  RecName: Full=Caffeoyl-CoA O-methyltransf...    208   3e-63    
ref|XP_007160247.1|  hypothetical protein PHAVU_002G305200g             207   3e-63    
gb|EMT01826.1|  Putative caffeoyl-CoA O-methyltransferase               208   3e-63    
ref|XP_011459662.1|  PREDICTED: probable caffeoyl-CoA O-methyltra...    207   3e-63    
ref|NP_001062143.1|  Os08g0498400                                       209   3e-63    
gb|AFY17069.1|  caffeoyl-coenzymeA O-methyltransferase 2b               207   4e-63    
gb|ACU23729.1|  unknown                                                 206   4e-63    
ref|XP_010929781.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    207   4e-63    
pdb|3C3Y|A  Chain A, Crystal Structure Of Pfomt, Phenylpropanoid ...    207   4e-63    
gb|EMS62351.1|  Caffeoyl-CoA O-methyltransferase 2                      207   5e-63    
ref|XP_010929792.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    210   6e-63    
dbj|BAD06321.1|  putative caffeoyl CoA O-methyltransferase              208   6e-63    
gb|EYU36932.1|  hypothetical protein MIMGU_mgv1a012974mg                207   6e-63    
ref|XP_011086776.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    206   8e-63    
ref|XP_008781889.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    206   8e-63    
gb|AFW65160.1|  caffeoyl-CoA O-methyltransferase 1                      208   8e-63    
emb|CAN83622.1|  hypothetical protein VITISV_007919                     222   8e-63    
ref|NP_001152451.1|  LOC100286091                                       207   9e-63    
gb|EYU42096.1|  hypothetical protein MIMGU_mgv1a012979mg                206   9e-63    
ref|XP_011086775.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    206   1e-62    
gb|EYU25907.1|  hypothetical protein MIMGU_mgv1a012985mg                206   2e-62    
sp|C7AE94.1|FAOMT_VITVI  RecName: Full=Flavonoid 3',5'-methyltran...    206   2e-62    
gb|ADA72016.1|  anthocyanin-O-methyltransferase                         206   2e-62    
dbj|BAP74301.1|  S-adenosylmethionine: anthocyanin 3'5'-methyltra...    206   2e-62    
ref|XP_011086773.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    205   2e-62    
ref|XP_008781890.1|  PREDICTED: caffeoyl-CoA O-methyltransferase-...    204   4e-62    
dbj|BAF46297.1|  caffeoyl-CoA O-methyltransferase                       204   5e-62    
ref|XP_003630654.1|  Caffeoyl-CoA O-methyltransferase                   204   6e-62    
gb|KEH31483.1|  caffeoyl-CoA 3-O-methyltransferase                      203   7e-62    
ref|XP_004299737.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    204   8e-62    
ref|NP_001290011.1|  flavonoid 3',5'-methyltransferase                  204   9e-62    
gb|AAV80204.1|  caffeoyl-CoA 3-O-methyltransferase                      200   2e-61    
ref|XP_011071221.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    203   2e-61    
gb|EYU18063.1|  hypothetical protein MIMGU_mgv1a022049mg                203   2e-61    
ref|XP_010531628.1|  PREDICTED: putative caffeoyl-CoA O-methyltra...    202   6e-61    
ref|XP_010025314.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    202   6e-61    
ref|XP_010251337.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    201   8e-61    
emb|CAJ43712.1|  caffeoyl-CoA O-methyltransferase                       202   9e-61    
ref|XP_010531620.1|  PREDICTED: putative caffeoyl-CoA O-methyltra...    201   1e-60    
ref|XP_002278678.2|  PREDICTED: flavonoid 3',5'-methyltransferase...    201   1e-60    
ref|XP_002888647.1|  hypothetical protein ARALYDRAFT_475925             201   1e-60    
ref|XP_003574706.1|  PREDICTED: tricin synthase 1-like                  201   1e-60    
ref|XP_009337489.1|  PREDICTED: flavonoid 3',5'-methyltransferase...    200   3e-60    



>gb|AAW55668.1| caffeoyl CoA 3-O-methyltransferase [Betula platyphylla]
Length=247

 Score =   346 bits (888),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ +RHQEVGHKSLLQSDALYQYILETSVYP+EPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQVSRHQEVGHKSLLQSDALYQYILETSVYPKEPEPMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQL+ D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  129  VAHKIDFREGPALPLLDQLIADEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  187



>gb|AAT37172.1| caffeoyl-CoA-O-methyltransferase [Broussonetia papyrifera]
Length=247

 Score =   345 bits (886),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N+  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>gb|ACF17646.1| putative caffeoyl-CoA 3-O-methyltransferase [Capsicum annuum]
Length=247

 Score =   345 bits (885),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ  +HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVAKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDG+ILAMDINRENYELGLP+I+
Sbjct  66   DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGQILAMDINRENYELGLPIIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD+LVED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDRLVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IG  623
            IG
Sbjct  186  IG  187



>ref|XP_009600093.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Nicotiana tomentosiformis]
Length=247

 Score =   345 bits (884),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ T+HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVTKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+
Sbjct  66   DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD ++ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDLMIEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IG  623
            IG
Sbjct  186  IG  187



>dbj|BAK74806.1| hypothetical protein [Cyclamen persicum x Cyclamen purpurascens]
Length=245

 Score =   344 bits (883),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ+ RHQEVGHKSLLQ+DALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  7    ENQSLRHQEVGHKSLLQTDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  66

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+ELGLP IEKAG
Sbjct  67   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFELGLPSIEKAG  126

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  127  VAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  185



>ref|XP_010526962.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Tarenaya hassleriana]
Length=260

 Score =   345 bits (884),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  22   QSQALRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  81

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP+I+KAG
Sbjct  82   QFLNMLIKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPIIQKAG  141

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP LDQLV D K HG+YDFIFVDADKDNY NYHKRLIDLVKVGGVIG
Sbjct  142  VAHKIDFREGPALPFLDQLVADEKNHGSYDFIFVDADKDNYWNYHKRLIDLVKVGGVIG  200



>ref|XP_010270267.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Nelumbo nucifera]
Length=248

 Score =   344 bits (883),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A K +    NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN
Sbjct  1    MATKQEEQQNNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL++LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   IMTTSADEGQFLNILLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGVAHKIDF+EGPALP+LDQ++ED K HGT+DFIFVDADKDNYLNYHKRLI+L
Sbjct  121  GLPVIQKAGVAHKIDFQEGPALPVLDQMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIEL  180

Query  600  VKVGGVIG  623
            VKVGGVIG
Sbjct  181  VKVGGVIG  188



>gb|ACJ38669.1| caffeoyl-CoA O-methyltransferase [Betula luminifera]
Length=247

 Score =   344 bits (882),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ +RHQEVGHKSLLQSDALYQYILETSVYP+EPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQASRHQEVGHKSLLQSDALYQYILETSVYPKEPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD L+ D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  VAHKIDFREGPALPLLDHLIADEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>ref|XP_010263488.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Nelumbo nucifera]
Length=248

 Score =   344 bits (882),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A K +    NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN
Sbjct  1    MATKQEEQQNNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   IMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGVAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+L
Sbjct  121  GLPVIQKAGVAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIEL  180

Query  600  VKVGGVIG  623
            VK+GG+IG
Sbjct  181  VKLGGLIG  188



>gb|AAS91565.1| caffeoyl-CoA O-methyltransferase [Broussonetia papyrifera]
Length=247

 Score =   344 bits (882),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N+  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLAT LALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATGLALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>sp|O04899.1|CAMT5_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 5; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 5; Short=CCoAMT-5; 
Short=CCoAOMT-5 [Nicotiana tabacum]
 emb|CAB05369.1| caffeoyl-CoA O-methyltransferase 5 [Nicotiana tabacum]
Length=240

 Score =   343 bits (881),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 1/181 (1%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MAEN   +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSAD
Sbjct  1    MAEN-GIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSAD  59

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYE+GLP+IEK
Sbjct  60   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEK  119

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVAHKI+FREGPALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+I
Sbjct  120  AGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLI  179

Query  621  G  623
            G
Sbjct  180  G  180



>gb|AFG17073.1| caffeoyl-CoA O-methyltransferase [Paeonia lactiflora]
Length=247

 Score =   343 bits (881),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 176/187 (94%), Gaps = 6/187 (3%)
 Frame = +3

Query  81   MAENQTT------RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNL  242
            MA NQT       RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+
Sbjct  1    MASNQTEQGSQGGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNI  60

Query  243  MTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELG  422
            MTTSADEGQFL+ML+KLINAKNTMEIGVYTGYSLLATALALPDDGK+LAMDINRENYELG
Sbjct  61   MTTSADEGQFLNMLIKLINAKNTMEIGVYTGYSLLATALALPDDGKVLAMDINRENYELG  120

Query  423  LPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLV  602
            LP+IEKAGVAHKIDFREGPALP+LDQ+++D K HGT+DFIFVDADKDNY+NYHKRLIDLV
Sbjct  121  LPIIEKAGVAHKIDFREGPALPVLDQMIQDGKYHGTFDFIFVDADKDNYINYHKRLIDLV  180

Query  603  KVGGVIG  623
            KVGGVIG
Sbjct  181  KVGGVIG  187



>ref|XP_009776913.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Nicotiana sylvestris]
Length=240

 Score =   343 bits (880),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 1/181 (1%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MAEN   +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSAD
Sbjct  1    MAEN-GIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSAD  59

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYE+GLP+IEK
Sbjct  60   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEK  119

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVAHKI+FREGPALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+I
Sbjct  120  AGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLI  179

Query  621  G  623
            G
Sbjct  180  G  180



>ref|XP_010548003.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Tarenaya hassleriana]
Length=270

 Score =   344 bits (883),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 182/206 (88%), Gaps = 8/206 (4%)
 Frame = +3

Query  6    TTKSA*KKLRPETSVKGSLAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPR  185
            TT  A KK   ETS  G      +   ++Q  RHQEVGHKSLLQSD LYQYILETSVYPR
Sbjct  13   TTVEATKK---ETSTNGD-----EQQQQSQALRHQEVGHKSLLQSDDLYQYILETSVYPR  64

Query  186  EPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAL  365
            EPE+MKELREVTAKHPWN+MTTSADEGQFL+ML+KL+NAKNTMEIGVYTGYSLLATALAL
Sbjct  65   EPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALAL  124

Query  366  PDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIF  545
            PDDGKILAMDINRENYELGLP+I+KAGVAHKIDFREGPALP+LDQLV D K  G++DFIF
Sbjct  125  PDDGKILAMDINRENYELGLPIIQKAGVAHKIDFREGPALPVLDQLVADEKNRGSFDFIF  184

Query  546  VDADKDNYLNYHKRLIDLVKVGGVIG  623
            VDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  185  VDADKDNYLNYHKRLIDLVKVGGVIG  210



>ref|XP_007201237.1| hypothetical protein PRUPE_ppa010497mg [Prunus persica]
 gb|EMJ02436.1| hypothetical protein PRUPE_ppa010497mg [Prunus persica]
Length=247

 Score =   343 bits (880),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILAMDINRENY+LG P+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILAMDINRENYDLGRPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQLVED K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  VAHKIDFREGPALPVLDQLVEDEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>ref|XP_009622008.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Nicotiana tomentosiformis]
 gb|AAB80931.1| caffeoyl-CoA 3-O-methyltransferase 5 [Nicotiana tabacum]
Length=240

 Score =   343 bits (880),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 1/181 (1%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MAEN   +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSAD
Sbjct  1    MAEN-GIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSAD  59

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYE+GLP+IEK
Sbjct  60   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEK  119

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVAHKI+FREGPALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+I
Sbjct  120  AGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLI  179

Query  621  G  623
            G
Sbjct  180  G  180



>ref|XP_006284297.1| hypothetical protein CARUB_v10005466mg, partial [Capsella rubella]
 gb|EOA17195.1| hypothetical protein CARUB_v10005466mg, partial [Capsella rubella]
Length=276

 Score =   344 bits (883),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  38   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  97

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  98   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  157

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  158  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  216



>ref|XP_008236475.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Prunus mume]
Length=247

 Score =   343 bits (880),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILAMDINRENY+LG P+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILAMDINRENYDLGRPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQL+ED K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  VAHKIDFREGPALPVLDQLIEDEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>ref|XP_006412281.1| hypothetical protein EUTSA_v10026028mg [Eutrema salsugineum]
 gb|ESQ53734.1| hypothetical protein EUTSA_v10026028mg [Eutrema salsugineum]
Length=258

 Score =   343 bits (880),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>gb|KDP25013.1| hypothetical protein JCGZ_23996 [Jatropha curcas]
Length=246

 Score =   343 bits (879),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  8    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMD+NRENYELGLP+I+KAG
Sbjct  68   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDVNRENYELGLPIIQKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V D K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  128  VAHKIDFREGPALPVLDEMVADEKNHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  186



>ref|XP_004290595.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Fragaria vesca subsp. 
vesca]
Length=244

 Score =   342 bits (878),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 177/184 (96%), Gaps = 3/184 (2%)
 Frame = +3

Query  81   MAEN---QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTT  251
            MAEN   Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTT
Sbjct  1    MAENGEEQKSRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTT  60

Query  252  SADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPV  431
            SADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPV
Sbjct  61   SADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPV  120

Query  432  IEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVG  611
            IEKAGVAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLIDLVKVG
Sbjct  121  IEKAGVAHKIDFREGPALPVLDQMIEDEKNHGSFDFIFVDADKDNYINYHKRLIDLVKVG  180

Query  612  GVIG  623
            G+IG
Sbjct  181  GLIG  184



>ref|XP_002282867.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Vitis vinifera]
 emb|CBI21401.3| unnamed protein product [Vitis vinifera]
Length=247

 Score =   342 bits (878),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREP+ MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPKPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQ++ED K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGG+IG
Sbjct  129  LAHKIDFREGPALPVLDQMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGLIG  187



>sp|Q8H9B6.1|CAMT_SOLTU RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Solanum tuberosum]
 dbj|BAC23054.1| caffeoyl-CoA O-methyltransferase [Solanum tuberosum]
Length=242

 Score =   342 bits (877),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKIDFREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIDFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>gb|AAT75320.2| caffeoyl-CoA 3-O-methyltransferase [Boehmeria nivea]
Length=247

 Score =   342 bits (877),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N+ +RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QNEVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGV+TGYSLLATALALP+DGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLSMLLKLINAKNTMEIGVFTGYSLLATALALPEDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  LAHKIDFREGPALPALDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>ref|XP_004231857.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum lycopersicum]
Length=242

 Score =   342 bits (877),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            M+  + +RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSAD
Sbjct  2    MSNGENSRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSAD  61

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIEK
Sbjct  62   EGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIEK  121

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AG+AHKI+FREGPALP+LDQ++ED + HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVI
Sbjct  122  AGLAHKIEFREGPALPVLDQMIEDGQYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  181

Query  621  G  623
            G
Sbjct  182  G  182



>ref|XP_009108759.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Brassica 
rapa]
Length=258

 Score =   342 bits (878),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>gb|AAT40111.1| caffeoyl-CoA O-methyltransferase [Ammi majus]
Length=241

 Score =   342 bits (877),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N  ++H EVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD
Sbjct  1    MASNGESKHSEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  60

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLP+IEK
Sbjct  61   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPIIEK  120

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LDQ +ED K HGT+DF+FVDADKDNY+NYHKRLIDLVKVGG+I
Sbjct  121  AGVGHKIDFREGPALPVLDQTLEDGKYHGTFDFVFVDADKDNYINYHKRLIDLVKVGGLI  180

Query  621  G  623
            G
Sbjct  181  G  181



>emb|CAN72492.1| hypothetical protein VITISV_037012 [Vitis vinifera]
Length=247

 Score =   342 bits (877),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREP+ MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPKPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQ++ED K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGG+IG
Sbjct  129  LAHKIDFREGPALPVLDQMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGLIG  187



>gb|EYU37656.1| hypothetical protein MIMGU_mgv1a012535mg [Erythranthe guttata]
Length=247

 Score =   342 bits (877),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            AENQ  RHQEVGHKSLLQSDALYQYILETSVYP+EPE+MKELRE+TAKHPWN+MTTSADE
Sbjct  8    AENQAGRHQEVGHKSLLQSDALYQYILETSVYPKEPESMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDIN+ENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINKENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++ D K HGT+DFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  128  GVAHKIDFREGPALPVLDQMIADGKYHGTFDFIFVDADKDNYINYHKRLIDLVKVGGVIG  187



>gb|ABZ89569.1| O-methyltransferase 5 [Humulus lupulus]
Length=247

 Score =   342 bits (877),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QXQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+ DQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVXDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  187



>gb|AAZ95245.1| putative caffeoyl-CoA O-methyltransferase protein [Isatis tinctoria]
Length=257

 Score =   342 bits (877),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  19   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  78

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KLINAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  79   QFLNMLIKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  138

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  139  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  197



>gb|ABE41833.1| caffeoyl-CoA 3-O-methyltransferase [Brassica rapa subsp. pekinensis]
 emb|CDY51954.1| BnaA08g11640D [Brassica napus]
 emb|CDY51865.1| BnaC03g77170D [Brassica napus]
Length=258

 Score =   342 bits (877),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>ref|XP_006487045.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
 gb|KDO59750.1| hypothetical protein CISIN_1g025824mg [Citrus sinensis]
Length=247

 Score =   341 bits (875),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQQGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD L++D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDLLIQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>ref|XP_011088234.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Sesamum indicum]
Length=244

 Score =   341 bits (874),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             EN   RHQEVGHKSLLQSDALYQYILETSVYP+EPE MKELRE+TAKHPWN+MTTSADE
Sbjct  5    GENNAGRHQEVGHKSLLQSDALYQYILETSVYPKEPEPMKELREITAKHPWNIMTTSADE  64

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  65   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIKKA  124

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++ D K HGT+DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  125  GVAHKIDFREGPALPVLDQMIADGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  184



>ref|XP_009760383.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Nicotiana sylvestris]
Length=247

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ  +HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVAKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYE+GLPVI+
Sbjct  66   DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINRENYEIGLPVIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD +VED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDLMVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IG  623
            IG
Sbjct  186  IG  187



>ref|XP_009138259.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Brassica rapa]
Length=258

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQLV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>sp|Q42945.1|CAMT6_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 6; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 6; Short=CCoAMT-6; 
Short=CCoAOMT-6 [Nicotiana tabacum]
 emb|CAA91228.1| caffeoyl-CoA O-methyltransferase [Nicotiana tabacum]
Length=247

 Score =   341 bits (874),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ T+HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    AAQENQVTKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLI AKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+
Sbjct  66   DEGQFLSMLLKLIIAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQ  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD ++ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGV
Sbjct  126  KAGVAHKIDFREGPALPVLDLMIEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGV  185

Query  618  IG  623
            IG
Sbjct  186  IG  187



>ref|XP_010107916.1| Caffeoyl-CoA O-methyltransferase [Morus notabilis]
 gb|EXC17316.1| Caffeoyl-CoA O-methyltransferase [Morus notabilis]
Length=247

 Score =   341 bits (874),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + + +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QQEVSRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD ++ED K HGT+DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDHMIEDGKYHGTFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>sp|Q9SWB8.1|CAMT2_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Eucalyptus globulus]
 gb|AAD50443.1|AF168780_1 caffeoyl-CoA O-methyltransferase [Eucalyptus globulus]
Length=247

 Score =   341 bits (874),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>ref|XP_006339881.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum tuberosum]
Length=242

 Score =   340 bits (873),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>ref|XP_006339879.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum tuberosum]
Length=242

 Score =   340 bits (873),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +  + +RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSADE
Sbjct  3    SNGENSRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSADE  62

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIEKA
Sbjct  63   GQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIEKA  122

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            G+AHKI+FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  123  GLAHKIEFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  182



>gb|ACF48821.1| caffeoyl-CoA-O-methyltransferase [Gossypium hirsutum]
Length=247

 Score =   340 bits (873),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMD+NRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDVNRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQLVED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  129  VAHKIDFKEGPALPVLDQLVEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  187



>ref|XP_006339880.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum tuberosum]
Length=242

 Score =   340 bits (872),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGV
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGV  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>ref|XP_010447157.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Camelina 
sativa]
Length=258

 Score =   341 bits (874),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>ref|XP_009341967.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Pyrus x bretschneideri]
Length=247

 Score =   340 bits (873),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD L+ED K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  VAHKIDFREGPALPMLDLLIEDKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>dbj|BAG71890.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=244

 Score =   340 bits (872),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSA
Sbjct  3    ATGETQPAKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSA  62

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL++LLKLINAKNTMEIGVYTGYSLL+TALALP+DGKILA+DINRENYE+GLP+IE
Sbjct  63   DEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIE  122

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LDQ+V+D K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGV
Sbjct  123  KAGVAHKIDFREGPALPLLDQMVDDEKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGV  182

Query  618  IG  623
            IG
Sbjct  183  IG  184



>gb|AFZ76980.1| caffeoyl-CoA O-methyltransferase [Eriobotrya japonica]
Length=247

 Score =   340 bits (873),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD LVED K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  VAHKIDFREGPALPVLDLLVEDKKNHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>ref|XP_008385739.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Malus domestica]
Length=247

 Score =   340 bits (872),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD LVED K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  VAHKIDFREGPALPVLDLLVEDKKNHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>ref|XP_003529403.2| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Glycine max]
Length=275

 Score =   341 bits (874),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 188/212 (89%), Gaps = 6/212 (3%)
 Frame = +3

Query  6    TTKSA*KKLRPETSVKGSLAGKFKAMAE---NQTT---RHQEVGHKSLLQSDALYQYILE  167
            T+ S+ +  + E   K +      AMAE   NQTT   RHQEVGHKSLLQSDALYQYILE
Sbjct  4    TSSSSNQLFKREKKRKENSQKTIIAMAEQNQNQTTEAGRHQEVGHKSLLQSDALYQYILE  63

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE+MKELRE+TAKHPWN+MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLL
Sbjct  64   TSVYPREPESMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLL  123

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            ATALALP+DGKILAMDINRENYELGLPVI+KAGV HKI+FREGPALP+LD++++D K HG
Sbjct  124  ATALALPEDGKILAMDINRENYELGLPVIKKAGVDHKIEFREGPALPVLDEMIKDEKNHG  183

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +YDFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  184  SYDFIFVDADKDNYLNYHKRLIELVKVGGVIG  215



>sp|P28034.1|CAMT_PETCR RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Petroselinum crispum]
 gb|AAA33851.1| caffeoyl-CoA 3-O-methyltransferase [Petroselinum crispum]
 emb|CAA83943.1| caffeoyl-CoA 3-O-methyltransferase [Petroselinum crispum]
 emb|CAA90894.1| CCoAOMT [Petroselinum crispum]
Length=241

 Score =   340 bits (871),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N  ++H EVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD
Sbjct  1    MASNGESKHSEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  60

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLP+IEK
Sbjct  61   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPIIEK  120

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD ++ED K HGT+DF+FVDADKDNY+NYHKRLIDLVK+GG+I
Sbjct  121  AGVGHKIDFREGPALPVLDHMLEDGKYHGTFDFVFVDADKDNYINYHKRLIDLVKIGGLI  180

Query  621  G  623
            G
Sbjct  181  G  181



>gb|AFU54611.1| caffeoyl-CoA O-methyltransferase [Pyrus x bretschneideri]
Length=247

 Score =   340 bits (871),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 3/185 (2%)
 Frame = +3

Query  78   AMAENQTTR---HQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            A  E Q TR   HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MT
Sbjct  3    ANGEEQQTRAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMT  62

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP
Sbjct  63   TSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLP  122

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            +IEKAGVAHKIDFREGPALP+LD L+ED K HG+YDFIFVDADKDNY+NYHKRLIDLVKV
Sbjct  123  IIEKAGVAHKIDFREGPALPVLDLLIEDKKNHGSYDFIFVDADKDNYINYHKRLIDLVKV  182

Query  609  GGVIG  623
            GG+IG
Sbjct  183  GGLIG  187



>gb|ACY66929.1| caffeoyl-CoA O-methyltransferase 2 [Eucalyptus camaldulensis]
Length=247

 Score =   340 bits (871),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>dbj|BAE48788.1| caffeoyl-CoA-O-methyltransferase [Codonopsis lanceolata]
Length=247

 Score =   340 bits (871),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            QTTRHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE TAKHPWN+MTTSADEGQF
Sbjct  11   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREATAKHPWNIMTTSADEGQF  70

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENY++G P+IEKAGVA
Sbjct  71   LNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYDIGRPIIEKAGVA  130

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LDQ++ED K HGT+DF+FVDADKDNY+NYHKR+IDLVKVGG+IG
Sbjct  131  HKIDFREGPALPVLDQMIEDGKYHGTFDFVFVDADKDNYINYHKRIIDLVKVGGLIG  187



>gb|KHF99603.1| Caffeoyl-CoA O-methyltransferase 1 [Gossypium arboreum]
Length=299

 Score =   342 bits (876),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  61   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  120

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMD+NRENYELGLPVI+KAG
Sbjct  121  QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDVNRENYELGLPVIQKAG  180

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQLVED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  181  VAHKIDFKEGPALPVLDQLVEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  239



>gb|ACX37696.1| caffeoyl-CoA O-methyltransferase 2 [Eucalyptus camaldulensis]
Length=247

 Score =   340 bits (871),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYVNYHKRLIDLVKVGGLIG  187



>gb|KFK30033.1| hypothetical protein AALP_AA7G208900 [Arabis alpina]
Length=258

 Score =   340 bits (871),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD+LV D K HGTYDFIFVDADKDNY+NYHKRLIDLVK+GGVIG
Sbjct  140  VAHKIDFREGPALPVLDELVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKIGGVIG  198



>ref|NP_001268047.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera]
 sp|Q43237.1|CAMT_VITVI RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCOAMT; Short=CCOAOMT 
[Vitis vinifera]
 emb|CAA90969.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera]
 emb|CAN79561.1| hypothetical protein VITISV_021020 [Vitis vinifera]
Length=242

 Score =   339 bits (870),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAENQTT-RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA NQ   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TA+HPWN+MTTSA
Sbjct  1    MATNQEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQ  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGI  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>emb|CDY49272.1| BnaA03g50850D [Brassica napus]
Length=258

 Score =   340 bits (871),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD+LV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDELVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>ref|XP_004248757.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Solanum lycopersicum]
Length=245

 Score =   339 bits (870),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSADE
Sbjct  6    GEVQEIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADE  65

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYE+GLP+IEKA
Sbjct  66   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYEIGLPIIEKA  125

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV+HKIDFREGPALP+LDQL+ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGGVIG
Sbjct  126  GVSHKIDFREGPALPLLDQLLEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGVIG  185



>emb|CDX72447.1| BnaC07g44690D [Brassica napus]
Length=258

 Score =   340 bits (871),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD+LV D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDELVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>ref|XP_010437675.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Camelina 
sativa]
Length=258

 Score =   340 bits (871),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>gb|ABF74683.1| caffeoyl-CoA-O-methyltransferase [Leucaena leucocephala]
 gb|ABE60811.2| caffeoyl coenzyme A 3-O-methyltransferase 1 [Leucaena leucocephala]
Length=244

 Score =   339 bits (869),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  6    QSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADEG  65

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG
Sbjct  66   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQKAG  125

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+FREGPALP+LD+LV+D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  126  VAHKIEFREGPALPVLDELVKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  184



>gb|AEK52482.1| caffeoyl-CoA 3-O-methyltransferase [Dimocarpus longan]
Length=247

 Score =   339 bits (870),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSD LYQYILETSVYP EPE+MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQVGRHQEVGHKSLLQSDDLYQYILETSVYPTEPESMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPA+P+LDQL+ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFREGPAMPLLDQLIEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>ref|XP_010432473.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Camelina sativa]
Length=258

 Score =   340 bits (871),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  20   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  80   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  198



>ref|XP_004231856.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Solanum lycopersicum]
Length=242

 Score =   339 bits (869),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED + HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGV
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGQYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGV  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>gb|AFN85667.1| putative caffeoyl-coenzyme A 3-O-methyltransferase [Hibiscus 
cannabinus]
Length=247

 Score =   339 bits (869),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPA+P+LDQLVED K HG+YDFIFVDADKDNY+NYH+RLI LVKVGG+IG
Sbjct  129  VAHKIEFKEGPAMPVLDQLVEDEKNHGSYDFIFVDADKDNYINYHERLIKLVKVGGLIG  187



>gb|AFX98065.1| caffeoyl-CoA O-methyltransferase [Cunninghamia lanceolata]
Length=255

 Score =   339 bits (870),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+M+ELRE+TAKHPWNLMTTSADEGQF
Sbjct  19   QVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMRELREITAKHPWNLMTTSADEGQF  78

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L++LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKI+AMDINRENYELGLPVI+KAGVA
Sbjct  79   LNLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKIIAMDINRENYELGLPVIQKAGVA  138

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LDQ++E+ + HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  139  HKIDFREGPALPVLDQMLENKEMHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  195



>ref|XP_010066009.1| PREDICTED: caffeoyl-CoA O-methyltransferase 2 [Eucalyptus grandis]
 gb|AGE09588.1| CCOAMT2-like protein [Eucalyptus cladocalyx]
 gb|KCW63757.1| hypothetical protein EUGRSUZ_G01417 [Eucalyptus grandis]
Length=247

 Score =   338 bits (868),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  +H EVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  9    QTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN+E+GLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQLV+D K HGTYDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  LAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>dbj|BAM05558.1| caffeoyl-CoA O-methyltransferase [Eucalyptus pilularis]
 dbj|BAM05560.1| caffeoyl-CoA O-methyltransferase [Eucalyptus pyrocarpa]
Length=246

 Score =   338 bits (868),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 174/180 (97%), Gaps = 1/180 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALPILDQL+ED  K GT+DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVAHKIDFREGPALPILDQLIED-GKQGTFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186



>ref|XP_006856484.1| hypothetical protein AMTR_s00046p00069700 [Amborella trichopoda]
 gb|ERN17951.1| hypothetical protein AMTR_s00046p00069700 [Amborella trichopoda]
Length=246

 Score =   338 bits (868),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +3

Query  75   KAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTS  254
            K   + Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTS
Sbjct  4    KQEEQQQVGRHQEVGHKSLLQSDELYQYILETSVYPREPESMKELREITAKHPWNIMTTS  63

Query  255  ADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI  434
            ADEGQFL++LLKLINAKNTMEIGVYTGYSLLATALALPDDGKI+AMDIN+ENYELGLPVI
Sbjct  64   ADEGQFLNLLLKLINAKNTMEIGVYTGYSLLATALALPDDGKIIAMDINKENYELGLPVI  123

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            EKAGVAHKIDFREGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG
Sbjct  124  EKAGVAHKIDFREGPALPVLDQMLEDEKYHGSFDFIFVDADKDNYLNYHKRLIELVKVGG  183

Query  615  VIG  623
            VIG
Sbjct  184  VIG  186



>ref|XP_011000746.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Populus euphratica]
Length=247

 Score =   338 bits (867),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYP+EPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDALYQYILETSVYPKEPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>ref|XP_009345067.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Pyrus x bretschneideri]
 ref|XP_009345068.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Pyrus x bretschneideri]
Length=247

 Score =   338 bits (867),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD LVED K +G++DFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  VAHKIDFREGPALPVLDLLVEDKKNYGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIG  187



>ref|NP_195131.1| putative caffeoyl-CoA O-methyltransferase [Arabidopsis thaliana]
 ref|XP_002869178.1| hypothetical protein ARALYDRAFT_912997 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O49499.1|CAMT4_ARATH RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT1 
[Arabidopsis thaliana]
 emb|CAA17567.1| caffeoyl-CoA O-methyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB80122.1| caffeoyl-CoA O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL09793.1| AT4g34050/F28A23_190 [Arabidopsis thaliana]
 gb|AAL32708.1| Phosphoglycerate dehydrogenase - like protein [Arabidopsis thaliana]
 gb|AAM10019.1| phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AAN28918.1| At4g34050/F28A23_190 [Arabidopsis thaliana]
 gb|EFH45437.1| hypothetical protein ARALYDRAFT_912997 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE86314.1| putative caffeoyl-CoA O-methyltransferase [Arabidopsis thaliana]
Length=259

 Score =   338 bits (868),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  21   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  80

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  81   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  140

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKDNY+NYHKRLIDLVK+GGVIG
Sbjct  141  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKIGGVIG  199



>gb|ACQ59095.1| caffeoyl CoA O-methyltransferase 1 [Gossypium hirsutum]
Length=250

 Score =   338 bits (867),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAVPDDGKILAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPA+P+LD+LV+D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  132  VAHKIDFKEGPAMPVLDELVQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  190



>gb|ACZ06244.1| caffeoyl-CoA O-methyltransferase 1 [Gossypium hirsutum]
 gb|KJB79352.1| hypothetical protein B456_013G045300 [Gossypium raimondii]
Length=250

 Score =   338 bits (867),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKI AMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKIFAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPA+P+LD+LV+D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  132  VAHKIDFKEGPAMPVLDELVQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  190



>ref|XP_011092559.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Sesamum indicum]
Length=247

 Score =   338 bits (866),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    ENQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALALP D KILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLMNAKNTMEIGVYTGYSLLATALALPHDAKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI F+EGPALP+LDQ+++D K HGT+DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  129  VAHKIHFKEGPALPLLDQMIQDGKYHGTFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  187



>ref|XP_002313125.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
 sp|O65862.1|CAMT1_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Populus trichocarpa]
 emb|CAA12198.1| caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 emb|CAA11496.1| caffeoyl CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|ABK93314.1| unknown [Populus trichocarpa]
 gb|ACC63876.1| trans-caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|EEE87080.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
 gb|AFZ78547.1| caffeoyl-CoA O-methyltransferase [Populus tomentosa]
Length=247

 Score =   338 bits (866),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>ref|XP_007042461.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX98292.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=304

 Score =   340 bits (871),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 180/201 (90%), Gaps = 6/201 (3%)
 Frame = +3

Query  39   ETSVKGSLAGKFKAMAEN------QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAM  200
            +T  + S   +F  MA N      Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE M
Sbjct  44   KTEKQQSNLWRFVPMATNTQEQQSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPM  103

Query  201  KELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGK  380
            KELRE+TAKHPWNLMTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGK
Sbjct  104  KELRELTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGK  163

Query  381  ILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADK  560
            ILAMDINRENYELGLPVI+KAGVAHKIDF+EGPA+P LDQLVED K HG++DF+FVDADK
Sbjct  164  ILAMDINRENYELGLPVIQKAGVAHKIDFKEGPAMPALDQLVEDEKNHGSFDFVFVDADK  223

Query  561  DNYLNYHKRLIDLVKVGGVIG  623
            DNY+NYHKRLI+LVKVGG+IG
Sbjct  224  DNYINYHKRLIELVKVGGLIG  244



>gb|ABB89956.1| caffeoyl-CoA O-methyltransferase [Chamaecyparis formosensis]
Length=249

 Score =   338 bits (866),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE M+ELRE+TAKHPWNLMTTSADE
Sbjct  10   STQQVSRHQEVGHKSLLQSDALYQYILETSVYPREPEPMRELREITAKHPWNLMTTSADE  69

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  70   GQFLHLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYELGLPVIQKA  129

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++E+ + HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  130  GVAHKIDFREGPALPVLDQMLENKEMHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  189



>ref|XP_006356576.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5-like [Solanum tuberosum]
Length=245

 Score =   337 bits (865),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSADE
Sbjct  6    GEVQEIKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADE  65

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYE+GLP+IEKA
Sbjct  66   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYEIGLPIIEKA  125

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV+HKIDFREGPALP+LDQL+ED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGG+IG
Sbjct  126  GVSHKIDFREGPALPLLDQLLEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGLIG  185



>ref|XP_009604110.1| PREDICTED: caffeoyl-CoA O-methyltransferase 2 [Nicotiana tomentosiformis]
 sp|O24149.1|CAMT2_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Nicotiana tabacum]
 gb|AAC49914.1| caffeoyl-CoA O-methyltransferase 2 [Nicotiana tabacum]
Length=242

 Score =   337 bits (865),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLP+IE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPIIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI FREGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIVFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>sp|Q43095.1|CAMT_POPTM RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Populus tremuloides]
 gb|AAA80651.1| caffeoyl-CoA 3-O-methyltransferase [Populus tremuloides]
Length=247

 Score =   337 bits (865),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>gb|AFY97679.1| caffeoyl-CoA-O-methyltransferase [Camellia sinensis]
Length=245

 Score =   337 bits (865),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  9    QNLRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNIMTTSADEGQF  68

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINR+N+E+GLP+IEKAGVA
Sbjct  69   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRDNFEIGLPIIEKAGVA  128

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP LDQ+++D K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  HKIDFREGPALPALDQMIKDGKHHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIG  185



>gb|AAF44689.1| caffeoyl-CoA O-methyltransferase [Populus tomentosa]
Length=239

 Score =   337 bits (864),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  1    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  60

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  61   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  120

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  121  VAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIG  179



>ref|XP_003518701.2| PREDICTED: caffeoyl-CoA O-methyltransferase-like isoform 1 [Glycine 
max]
Length=325

 Score =   340 bits (872),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 6/188 (3%)
 Frame = +3

Query  78   AMAE---NQTT---RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            AMAE   NQTT   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN
Sbjct  78   AMAEQNQNQTTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWN  137

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYEL
Sbjct  138  IMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYEL  197

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGV HKI+FREGPALP+LD++V+D K HG+YDFIFVDADKDNYLNYHKRLI+L
Sbjct  198  GLPVIKKAGVDHKIEFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYLNYHKRLIEL  257

Query  600  VKVGGVIG  623
            VKVGGVIG
Sbjct  258  VKVGGVIG  265



>gb|ABB87184.1| caffeoyl-CoA O-methyltransferase [Taiwania cryptomerioides]
Length=249

 Score =   337 bits (864),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+M+ELRE+TAKHPWNLMTTSADE
Sbjct  10   STQQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMRELREITAKHPWNLMTTSADE  69

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  70   GQFLHLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYELGLPVIQKA  129

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ++E+ + HG++DFIFVDADKD+YLNYHKRLIDLVK+GGVIG
Sbjct  130  GVAHKIDFREGPALPVLDQMLENKEMHGSFDFIFVDADKDDYLNYHKRLIDLVKIGGVIG  189



>ref|XP_004231855.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Solanum lycopersicum]
Length=242

 Score =   337 bits (864),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+FREGPALP+LDQ++ED + HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+
Sbjct  121  KAGLAHKIEFREGPALPVLDQMIEDGQYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGL  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>gb|AGR51164.1| catechol-O-methyltransferase [Camellia sinensis]
Length=245

 Score =   337 bits (864),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  9    QNLRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNIMTTSADEGQF  68

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINR+N+E+GLP+IEKAGVA
Sbjct  69   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRDNFEIGLPIIEKAGVA  128

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP LD+++ED K HG++DFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  129  HKIDFREGPALPALDKMIEDGKHHGSFDFIFVDADKDNYINYHKRLIDLVKVGGLIG  185



>gb|ABE60812.1| caffeoyl coenzyme A 3-O-methyltransferase 2 [Leucaena leucocephala]
 gb|ABF74684.1| caffeoyl-CoA-O-methyltransferase [Leucaena leucocephala]
Length=244

 Score =   337 bits (864),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKE+RE+TAKHPWN+MTTSADEG
Sbjct  6    QSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKEIREITAKHPWNIMTTSADEG  65

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG
Sbjct  66   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQKAG  125

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPALP+LD+LV+D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  126  VAHKIEFKEGPALPVLDELVKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  184



>emb|CBI32387.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   337 bits (863),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAENQTT-RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA  Q   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TA+HPWN+MTTSA
Sbjct  1    MATKQEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+
Sbjct  61   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQ  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGI  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>ref|XP_011000123.1| PREDICTED: caffeoyl-CoA O-methyltransferase 2 [Populus euphratica]
Length=247

 Score =   337 bits (864),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  VAHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>gb|KGN43930.1| Caffeoyl-CoA O-methyltransferase [Cucumis sativus]
Length=275

 Score =   338 bits (866),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 182/206 (88%), Gaps = 3/206 (1%)
 Frame = +3

Query  6    TTKSA*KKLRPETSVKGSLAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPR  185
            T KS  +KL    ++  +  G+     +NQ  RHQEVGHKSLLQSDALYQYILETSVYPR
Sbjct  13   TGKSTKQKLHHSPTMASTTNGQED---QNQAGRHQEVGHKSLLQSDALYQYILETSVYPR  69

Query  186  EPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAL  365
            EPE+MKELR++TAKHPWN+MTTSADEGQFL+MLLKLINAK TMEIGVYTGYSLLATALAL
Sbjct  70   EPESMKELRDLTAKHPWNIMTTSADEGQFLNMLLKLINAKKTMEIGVYTGYSLLATALAL  129

Query  366  PDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIF  545
            P+DG ILAMDINRENYELGLPVIEKAGVAHKI+F+EGPALP+LD +V D K HG+YDFIF
Sbjct  130  PEDGTILAMDINRENYELGLPVIEKAGVAHKIEFKEGPALPVLDDMVADKKNHGSYDFIF  189

Query  546  VDADKDNYLNYHKRLIDLVKVGGVIG  623
            VDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  190  VDADKDNYINYHKRLIDLVKVGGVIG  215



>ref|XP_010690616.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Beta vulgaris subsp. 
vulgaris]
Length=258

 Score =   337 bits (864),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  +H EVGHKSLLQSDAL+QYILETSVYPREPE MKELRE+TA HPWNLMTTSADEG
Sbjct  20   QSKEIKHSEVGHKSLLQSDALFQYILETSVYPREPEPMKELREITANHPWNLMTTSADEG  79

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVIEKAG
Sbjct  80   QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIEKAG  139

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD L+EDPK HG++DF+FVDADKDNY NYHKRLIDLVKVGGVIG
Sbjct  140  VAHKIDFREGPALPVLDLLLEDPKNHGSFDFVFVDADKDNYWNYHKRLIDLVKVGGVIG  198



>gb|KJB47341.1| hypothetical protein B456_008G024000 [Gossypium raimondii]
Length=318

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELR++TAKHPWNLMTTSADEG
Sbjct  80   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRKLTAKHPWNLMTTSADEG  139

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMD+NRENYELGLPVI+KAG
Sbjct  140  QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDVNRENYELGLPVIQKAG  199

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQLVED K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  200  VAHKIDFKEGPALPVLDQLVEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  258



>dbj|BAG71889.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=244

 Score =   337 bits (863),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  E Q  +HQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWNLMTTSA
Sbjct  3    ATGETQPAKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSA  62

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL++LLKLINAKNTMEIGVYTGYSLL+TALALP+DGKILA+DINRENYE+GLP+IE
Sbjct  63   DEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIE  122

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LD+++ D K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGV
Sbjct  123  KAGVAHKIDFREGPALPLLDEMIGDEKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGV  182

Query  618  IG  623
            IG
Sbjct  183  IG  184



>gb|KHN05829.1| Caffeoyl-CoA O-methyltransferase [Glycine soja]
Length=247

 Score =   337 bits (863),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 3/182 (2%)
 Frame = +3

Query  87   ENQTT---RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            +NQTT   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSA
Sbjct  6    QNQTTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIK  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGV HKI+FREGPALP+LD++V+D K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGGV
Sbjct  126  KAGVDHKIEFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGV  185

Query  618  IG  623
            IG
Sbjct  186  IG  187



>gb|KHG18720.1| Caffeoyl-CoA O-methyltransferase 1 [Gossypium arboreum]
Length=248

 Score =   337 bits (863),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++   RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  10   QSAAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  70   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPA+P+LD+LVED K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  130  VAHKIEFKEGPAMPVLDKLVEDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGLIG  188



>sp|O24150.2|CAMT3_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 3; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 3; Short=CCoAMT-3; 
Short=CCoAOMT-3 [Nicotiana tabacum]
 gb|AAC49915.1| caffeoyl-CoA O-methyltransferase 3 [Nicotiana tabacum]
Length=242

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>ref|XP_007047308.1| Caffeoyl-CoA O-methyltransferase 1 [Theobroma cacao]
 gb|EOX91465.1| Caffeoyl-CoA O-methyltransferase 1 [Theobroma cacao]
Length=247

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQAGRHQEVGHKSLLQSDNLYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGP+LP+LDQ++E  K HGT+DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFKEGPSLPVLDQMIEAGKYHGTFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>gb|KHN43056.1| Caffeoyl-CoA O-methyltransferase [Glycine soja]
Length=247

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 3/182 (2%)
 Frame = +3

Query  87   ENQTT---RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            +NQTT   RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSA
Sbjct  6    QNQTTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIK  125

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGV HKI+FREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGGV
Sbjct  126  KAGVDHKIEFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGV  185

Query  618  IG  623
            IG
Sbjct  186  IG  187



>sp|O24144.1|CAMT1_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Nicotiana tabacum]
 gb|AAC49913.1| caffeoyl-coenzymeA O-methyltransferase [Nicotiana tabacum]
Length=239

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 174/181 (96%), Gaps = 2/181 (1%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N   RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSAD
Sbjct  1    MATN--GRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSAD  58

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEK
Sbjct  59   EGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEK  118

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+I
Sbjct  119  AGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLI  178

Query  621  G  623
            G
Sbjct  179  G  179



>gb|KJB77663.1| hypothetical protein B456_012G149800 [Gossypium raimondii]
Length=248

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQY+LETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  10   QSEAGRHQEVGHKSLLQSDALYQYMLETSVYPREPEPMKELRELTAKHPWNLMTTSADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  70   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPA+P+LD+LVED K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  130  VAHKIEFKEGPAMPVLDKLVEDEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGLIG  188



>dbj|BAG71891.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=247

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +E+Q  +HQEVGHKSLLQSDALYQYILETSVYPREP  MKELREVTAKHPWNLMTTSADE
Sbjct  8    SESQPAKHQEVGHKSLLQSDALYQYILETSVYPREPAPMKELREVTAKHPWNLMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL++LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILA+DINRENYE+GLP+IEKA
Sbjct  68   GQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILALDINRENYEIGLPIIEKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LD ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  128  GVAHKIDFREGPALPLLDSMIEDKKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  187



>sp|O24151.1|CAMT4_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 4; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 4; Short=CCoAMT-4; 
Short=CCoAOMT-4 [Nicotiana tabacum]
 gb|AAC49916.1| caffeoyl-CoA O-methyltransferase 4 [Nicotiana tabacum]
Length=242

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  4    DGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  63

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEKAG
Sbjct  64   QFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAG  123

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+IG
Sbjct  124  LAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLIG  182



>ref|XP_009604111.1| PREDICTED: caffeoyl-CoA O-methyltransferase 3 [Nicotiana tomentosiformis]
Length=242

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSA
Sbjct  1    MATNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINR+NYE+GLPVIE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>ref|XP_008454948.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Cucumis melo]
Length=249

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSADEG
Sbjct  11   QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNIMTTSADEG  70

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLPVIEKAG
Sbjct  71   QFLNMLLKLINAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPVIEKAG  130

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPALP+LD +V D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  131  VAHKIEFKEGPALPVLDDMVADKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  189



>gb|AAM66108.1| caffeoyl-CoA O-methyltransferase-like protein [Arabidopsis thaliana]
Length=259

 Score =   336 bits (861),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  21   QSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEG  80

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+IEKAG
Sbjct  81   QFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAG  140

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V D K HGTYDFIFVDADKD Y+NYHKRLIDLVK+GGVIG
Sbjct  141  VAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDXYINYHKRLIDLVKIGGVIG  199



>gb|ABK94003.1| unknown [Populus trichocarpa]
Length=247

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVG+KSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGNKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP+LDQ++ED K HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  VAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>ref|XP_009407208.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 2/182 (1%)
 Frame = +3

Query  84   AENQT--TRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            +ENQ    RHQEVGHKSLLQSD LYQYILET+VYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  3    SENQNGDRRHQEVGHKSLLQSDELYQYILETTVYPREPEAMKELREITAKHPWNLMTTSA  62

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLPVI+
Sbjct  63   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPVIQ  122

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAGVAHKIDFREGPALP+LDQ++ED K HG++DF+FVDADKDNY+NYHKRL++LV+VGGV
Sbjct  123  KAGVAHKIDFREGPALPVLDQMIEDEKNHGSFDFVFVDADKDNYINYHKRLLELVRVGGV  182

Query  618  IG  623
            I 
Sbjct  183  IA  184



>gb|KHG16338.1| Caffeoyl-CoA O-methyltransferase 1 [Gossypium arboreum]
Length=250

 Score =   335 bits (860),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PD GKILAMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAVPDHGKILAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPA+P+LD+LV+D K HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  132  VAHKIDFKEGPAMPVLDELVQDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  190



>gb|AFY97680.1| caffeoyl-CoA-O-methyltransferase [Camellia sinensis]
Length=245

 Score =   335 bits (859),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  9    QNLRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNIMTTSADEGQF  68

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINR+N+E+GLP+IEKAGVA
Sbjct  69   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRDNFEIGLPIIEKAGVA  128

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP LD+++ED K HG++DFIFVDADKDNY NYHKRLIDLVKVGG+IG
Sbjct  129  HKIDFREGPALPALDKMIEDGKHHGSFDFIFVDADKDNYNNYHKRLIDLVKVGGLIG  185



>gb|AII00961.1| coffee acyl coenzyme A-3-O-methyl transferase [Curcuma longa]
Length=245

 Score =   335 bits (859),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +3

Query  102  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSM  281
            RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELR++TAKHPWNLMTTSADEGQFL +
Sbjct  12   RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRDITAKHPWNLMTTSADEGQFLGL  71

Query  282  LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKI  461
            LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GLPVI+KAGVAHKI
Sbjct  72   LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPVIQKAGVAHKI  131

Query  462  DFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            DFREGPALP+LDQL+ED K HG++DF+FVDADKDNY+NYHKRL++LVKVGGVI 
Sbjct  132  DFREGPALPVLDQLLEDAKNHGSFDFVFVDADKDNYINYHKRLLELVKVGGVIA  185



>gb|AFZ78548.1| caffeoyl-CoA O-methyltransferase [Populus tomentosa]
Length=247

 Score =   335 bits (858),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VA+KI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  VANKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>ref|XP_002518739.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF43664.1| o-methyltransferase, putative [Ricinus communis]
Length=248

 Score =   335 bits (858),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A   +   +NQ  RHQEVGHKSLLQSDALYQYILETSVYP EPE MKELRE+TAKHPWN
Sbjct  1    MASNNEEQQQNQAGRHQEVGHKSLLQSDALYQYILETSVYPNEPEPMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   IMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI+KAGVAHKI+FREGPA+P+LD++V D K HG++DFIFVDADKDNYLNYH+RL++L
Sbjct  121  GLPVIQKAGVAHKIEFREGPAMPVLDEMVADEKYHGSFDFIFVDADKDNYLNYHQRLVEL  180

Query  600  VKVGGVIG  623
            VKVGGVIG
Sbjct  181  VKVGGVIG  188



>ref|XP_006346396.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6-like [Solanum tuberosum]
Length=248

 Score =   335 bits (858),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 1/183 (1%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ ++HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    ASQENQVSKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENY-ELGLPVI  434
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDIN+ENY E+GLP+I
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINKENYEEIGLPII  125

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            +KAGVAHKIDFREGPALP+LD LVED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGG
Sbjct  126  QKAGVAHKIDFREGPALPVLDLLVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGG  185

Query  615  VIG  623
            VIG
Sbjct  186  VIG  188



>ref|XP_009784107.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Nicotiana sylvestris]
Length=239

 Score =   334 bits (857),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 174/181 (96%), Gaps = 2/181 (1%)
 Frame = +3

Query  81   MAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            MA N   RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSAD
Sbjct  1    MATN--GRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSAD  58

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEK
Sbjct  59   EGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEK  118

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AG+AHKI+F+EGPALP+LDQ++E+ K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+I
Sbjct  119  AGLAHKIEFKEGPALPVLDQMIENGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLI  178

Query  621  G  623
            G
Sbjct  179  G  179



>ref|XP_004230766.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Solanum lycopersicum]
Length=248

 Score =   334 bits (857),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 1/183 (1%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A  ENQ ++HQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  6    ASQENQVSKHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSA  65

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENY-ELGLPVI  434
            DEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALP DGKILAMDIN+ENY E+GLP+I
Sbjct  66   DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPRDGKILAMDINKENYEEIGLPII  125

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            +KAGVAHKIDFREGPALP+LD LVED   HGTYDFIFVDADKDNY+NYHKR+I+LVKVGG
Sbjct  126  QKAGVAHKIDFREGPALPVLDLLVEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGG  185

Query  615  VIG  623
            VIG
Sbjct  186  VIG  188



>gb|ACH47151.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitatissimum]
Length=247

 Score =   334 bits (857),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            +A + K+ +EN  +RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELREVTAKHPWN
Sbjct  1    MAEEQKSSSEN-VSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWN  59

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            +MTTSADEGQFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+PDDGK LAMDINRENYE+
Sbjct  60   IMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPDDGKTLAMDINRENYEI  119

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLP+IEKAG+AHKI+FREGPALP LD +VE+   HGTYDFIFVDADKDNY+NYHKRLIDL
Sbjct  120  GLPIIEKAGLAHKIEFREGPALPALDLMVENKSLHGTYDFIFVDADKDNYINYHKRLIDL  179

Query  600  VKVGGVIG  623
            VK+GGVIG
Sbjct  180  VKIGGVIG  187



>ref|XP_009784105.1| PREDICTED: caffeoyl-CoA O-methyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
Length=242

 Score =   334 bits (857),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  4    DGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  63

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENYE+GLPVIEKAG
Sbjct  64   QFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAG  123

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKI+F+EGPALP+LDQ++E+ K HG+YDFIFVDADKDNYLNYHKRLIDLVK+GG+IG
Sbjct  124  LAHKIEFKEGPALPVLDQMIENGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLIG  182



>dbj|BAG71892.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=247

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            +E+Q  +HQEVGHKS LQSDALYQYILETSVYPREP +MKELREVTAKHPWNLMTTSADE
Sbjct  8    SESQPAKHQEVGHKSFLQSDALYQYILETSVYPREPASMKELREVTAKHPWNLMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLS+LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILA+DINRENYE+GLP+IEKA
Sbjct  68   GQFLSLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILALDINRENYEIGLPIIEKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
             VAHKIDFREGPALP+LDQ++ D K HG++DFIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  128  RVAHKIDFREGPALPLLDQMINDEKFHGSFDFIFVDADKDNYLNYHKRLIDLVKIGGVIG  187



>dbj|BAG71894.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=252

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +3

Query  69   KFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            K ++  + Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MT
Sbjct  8    KTESNDKEQVSRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMT  67

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFL+MLLKL+NAKNTMEIGV+TGYSLLATALALP+DGKILAMDINR+NYELGLP
Sbjct  68   TSADEGQFLNMLLKLVNAKNTMEIGVFTGYSLLATALALPEDGKILAMDINRDNYELGLP  127

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            +IEKAGVAHKIDF+EGPA+P+LD+++ D K HGTYDFIFVDADKDNY+NYHKRLIDLVKV
Sbjct  128  IIEKAGVAHKIDFKEGPAMPVLDEMIADGKYHGTYDFIFVDADKDNYINYHKRLIDLVKV  187

Query  609  GGVIG  623
            GG+IG
Sbjct  188  GGLIG  192



>ref|XP_004136981.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Cucumis sativus]
Length=249

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE+MKELR++TAKHPWN+MTTSADEG
Sbjct  11   QNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRDLTAKHPWNIMTTSADEG  70

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLPVIEKAG
Sbjct  71   QFLNMLLKLINAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPVIEKAG  130

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPALP+LD +V D K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  131  VAHKIEFKEGPALPVLDDMVADKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  189



>ref|XP_004505242.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Cicer arietinum]
Length=247

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDIN+ENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V+D K HG+YDFIFVDADKDNY+NYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYINYHKRLIELVKVGGVIG  187



>gb|ACJ84500.1| unknown [Medicago truncatula]
Length=247

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 2/181 (1%)
 Frame = +3

Query  87   ENQTT--RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            +NQT   RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSAD
Sbjct  7    QNQTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSAD  66

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+K
Sbjct  67   EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKK  126

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVI
Sbjct  127  AGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  186

Query  621  G  623
            G
Sbjct  187  G  187



>dbj|BAM05559.1| caffeoyl-CoA O-methyltransferase [Eucalyptus globulus subsp. 
globulus]
Length=246

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 173/180 (96%), Gaps = 1/180 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++NQ  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186



>ref|XP_003607927.1| Caffeoyl-CoA O-methyltransferase [Medicago truncatula]
 gb|AES90124.1| caffeoyl-CoA 3-O-methyltransferase [Medicago truncatula]
 gb|AFK37143.1| unknown [Medicago truncatula]
Length=247

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 2/181 (1%)
 Frame = +3

Query  87   ENQTT--RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            +NQT   RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSAD
Sbjct  7    QNQTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSAD  66

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+K
Sbjct  67   EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKK  126

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVI
Sbjct  127  AGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  186

Query  621  G  623
            G
Sbjct  187  G  187



>gb|AAY89237.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitatissimum]
Length=246

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 173/186 (93%), Gaps = 5/186 (3%)
 Frame = +3

Query  81   MAENQ-----TTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLM  245
            MAE Q      +RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELREVTAKHPWN+M
Sbjct  1    MAEQQQSGENVSRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIM  60

Query  246  TTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGL  425
            TTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE+GL
Sbjct  61   TTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGL  120

Query  426  PVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVK  605
            P+IEKAG+AHKI+F+EGPALP LD++VED   HG YDFIFVDADKDNY+NYHKRLIDLVK
Sbjct  121  PIIEKAGLAHKIEFKEGPALPALDKMVEDKANHGAYDFIFVDADKDNYINYHKRLIDLVK  180

Query  606  VGGVIG  623
            +GGVIG
Sbjct  181  IGGVIG  186



>sp|Q40313.1|CAMT_MEDSA RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Medicago sativa]
 pdb|1SUI|A Chain A, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUI|B Chain B, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUI|C Chain C, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUI|D Chain D, Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
 pdb|1SUS|A Chain A, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 pdb|1SUS|B Chain B, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 pdb|1SUS|C Chain C, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 pdb|1SUS|D Chain D, Crystal Structure Of Alfalfa Feruoyl Coenzyme A 3-O- 
Methyltransferase
 gb|AAC28973.1| S-adenosyl-L-methionine:trans-caffeoyl-CoA 3-O-methyltransferase 
[Medicago sativa]
Length=247

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAG
Sbjct  69   QFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            V HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  129  VDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  187



>ref|NP_001234801.1| caffeoyl-CoA O-methyltransferase [Solanum lycopersicum]
 gb|ABV90868.1| caffeoyl-CoA O-methyltransferase [Solanum lycopersicum]
Length=242

 Score =   333 bits (855),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 173/182 (95%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE+TAKHPWNLMTTSA
Sbjct  1    MASNGENGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSMLLKLINAKNTMEIGV+TGYSLLATA+ALPDDGKILAMDINRENY +GLPVIE
Sbjct  61   DEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYVIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI FREGPALP+LDQ+++D K HG+Y+FIFVDADKDNYLNYHKRLIDLV VGG+
Sbjct  121  KAGLAHKIVFREGPALPVLDQMIDDGKYHGSYEFIFVDADKDNYLNYHKRLIDLVNVGGI  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>ref|XP_007042462.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX98293.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=248

 Score =   333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 173/180 (96%), Gaps = 1/180 (1%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQ-YILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++Q  RHQEVGHKSLLQSDALYQ YILETSVYPREPE MKELRE+TAKHPWNLMTTSADE
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADE  68

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  69   GQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  128

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDF+EGPA+P LDQLVED K HG++DF+FVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  GVAHKIDFKEGPAMPALDQLVEDEKNHGSFDFVFVDADKDNYINYHKRLIELVKVGGLIG  188



>gb|AFD23679.1| caffeoyl CoA O-methyltransferase [Salvia miltiorrhiza]
Length=247

 Score =   333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKELRE+TA HPWN+MTTSADEG
Sbjct  9    ENQAGRHQEVGHKSLLQSDDLYQYILETSVYPREPEPMKELREITANHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKI+F+EGPALP+LDQ+V + K HG++DFIFVDADKDNYLNYHKR IDLVKVGGVIG
Sbjct  129  VAHKIEFKEGPALPVLDQMVAEGKHHGSFDFIFVDADKDNYLNYHKRPIDLVKVGGVIG  187



>gb|AEV93479.1| cinnamoyl-CoA O-methyltransferase [Caragana korshinskii]
Length=247

 Score =   333 bits (854),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + ++ RHQEVGHKSLLQSDALYQYILETSVYPRE EAMKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTESGRHQEVGHKSLLQSDALYQYILETSVYPREHEAMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V+D K HG+YDFIFVDADKDNY+NYH+RLIDLVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDEMVKDEKNHGSYDFIFVDADKDNYINYHQRLIDLVKVGGVIG  187



>gb|AEW26089.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26091.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26092.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26093.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26094.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26095.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26096.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26097.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26099.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26100.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26105.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26106.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26112.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26115.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26116.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26117.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26118.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26119.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26120.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26121.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26122.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26123.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26124.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26125.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26127.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26128.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26129.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26130.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26133.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26134.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26135.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26137.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26139.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26140.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26141.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26142.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26144.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26145.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26146.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26147.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26148.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26149.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26150.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26152.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26153.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26154.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26155.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26156.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26157.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26158.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26159.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26160.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=237

 Score =   333 bits (853),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  178



>gb|AEW26107.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
Length=235

 Score =   332 bits (852),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  178



>gb|AEW26132.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
Length=237

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  178



>gb|AEW26103.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
Length=231

 Score =   332 bits (852),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  178



>ref|XP_006422984.1| hypothetical protein CICLE_v10029158mg [Citrus clementina]
 gb|ESR36224.1| hypothetical protein CICLE_v10029158mg [Citrus clementina]
Length=247

 Score =   333 bits (853),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H+EVGHKSLLQSDALYQYILETSVYPRE E+MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QNQQGGHKEVGHKSLLQSDALYQYILETSVYPREAESMKELRELTAKHPWNVMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD L++D K HG++DFIFVDADKDNYLNYHKRL++LVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDLLIQDEKNHGSFDFIFVDADKDNYLNYHKRLVELVKVGGVIG  187



>gb|ACQ59096.1| caffeoyl CoA O-methyltransferase 2 [Gossypium hirsutum]
Length=248

 Score =   333 bits (853),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 173/188 (92%), Gaps = 7/188 (4%)
 Frame = +3

Query  81   MAENQTT-------RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWN  239
            MA N T        RHQEVGHKSLLQSDALYQYILETSVYP EPE MKELRE+TAKHPWN
Sbjct  1    MATNTTQEQQPAAGRHQEVGHKSLLQSDALYQYILETSVYPMEPEPMKELRELTAKHPWN  60

Query  240  LMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  419
            LMTTSADEGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL
Sbjct  61   LMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEL  120

Query  420  GLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDL  599
            GLPVI KAGVAHKI+F+EGPA+P+LD+LVED K HG+YDFIFVDADKDNYLNYHKRLI+L
Sbjct  121  GLPVIRKAGVAHKIEFKEGPAMPVLDKLVEDEKNHGSYDFIFVDADKDNYLNYHKRLIEL  180

Query  600  VKVGGVIG  623
            VKVGG+IG
Sbjct  181  VKVGGLIG  188



>gb|AEM45654.1| caffeoyl-CoA O-methyltransferase 3 [Gerbera jamesonii]
Length=252

 Score =   333 bits (853),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 2/191 (1%)
 Frame = +3

Query  57   SLAGKFKAMAEN--QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKH  230
            ++ G+ K  + N  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKH
Sbjct  2    AINGETKTESNNGDQASRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKH  61

Query  231  PWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINREN  410
            PWN+MTTSADEGQFL+MLLKL+NAKNTMEIGV+TGYSLLATALALPDDG ILAMDIN++N
Sbjct  62   PWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVFTGYSLLATALALPDDGXILAMDINKDN  121

Query  411  YELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRL  590
            YELG P+IEKAGVAHKIDF+EGPALP+LDQ++ D K HGT+DFIFVDADKDNY+NYHKRL
Sbjct  122  YELGRPIIEKAGVAHKIDFKEGPALPVLDQMIADGKYHGTFDFIFVDADKDNYINYHKRL  181

Query  591  IDLVKVGGVIG  623
            IDLVKVGG+IG
Sbjct  182  IDLVKVGGLIG  192



>sp|O04854.1|CAMT_EUCGU RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Eucalyptus gunnii]
 emb|CAA72911.1| caffeoyl-CoA O-methyltransferase [Eucalyptus gunnii]
Length=249

 Score =   332 bits (852),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 172/180 (96%), Gaps = 1/180 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186



>gb|ABO77959.1| caffeoyl-CoA 3-O methyltransferase [Coffea canephora]
 emb|CDO97193.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   332 bits (852),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    DSQNLRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+M++KLINAK TMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVIE+AG
Sbjct  69   QFLNMIIKLINAKKTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIERAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            V+HKIDFREGPALP+LD+L+ED K HG++DFIFVDADKDNYLNYHKR+I+LVKVGG+IG
Sbjct  129  VSHKIDFREGPALPVLDELIEDDKNHGSFDFIFVDADKDNYLNYHKRIIELVKVGGMIG  187



>ref|XP_002298729.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
 sp|O65922.1|CAMT2_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Populus trichocarpa]
 emb|CAA12199.1| caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 emb|CAA12200.1| caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 emb|CAA11495.1| caffeoyl CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|ABK94944.1| unknown [Populus trichocarpa]
 gb|ACC63878.1| trans-caffeoyl-CoA 3-O-methyltransferase [Populus trichocarpa]
 gb|EEE83534.1| caffeoyl-CoA O-methyltransferase family protein [Populus trichocarpa]
Length=247

 Score =   332 bits (851),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            + HKI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  LEHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>ref|XP_008799011.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Phoenix dactylifera]
Length=278

 Score =   333 bits (854),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 1/186 (1%)
 Frame = +3

Query  69   KFKAMAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLM  245
            K ++ ++N Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+M
Sbjct  33   KSQSQSQNGQVGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREITAKHPWNIM  92

Query  246  TTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGL  425
            TTSADEGQFL+MLLKL+NAK TMEIGVYTGYSLLATALALPDDG+ILAMDINRENYELGL
Sbjct  93   TTSADEGQFLNMLLKLVNAKKTMEIGVYTGYSLLATALALPDDGQILAMDINRENYELGL  152

Query  426  PVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVK  605
            PVIEKAGVAHKIDFR GPALP+LD LVED K HG++DFIFVDADKDNYLNYHKRL+DLVK
Sbjct  153  PVIEKAGVAHKIDFRVGPALPLLDGLVEDEKNHGSFDFIFVDADKDNYLNYHKRLLDLVK  212

Query  606  VGGVIG  623
             GG+I 
Sbjct  213  PGGIIA  218



>gb|KJB79353.1| hypothetical protein B456_013G045300 [Gossypium raimondii]
Length=248

 Score =   332 bits (851),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 172/179 (96%), Gaps = 2/179 (1%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADEG
Sbjct  12   QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEG  71

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKI AMDINRENYELGLPVI+KAG
Sbjct  72   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKIFAMDINRENYELGLPVIQKAG  131

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPA+P+LD+LV+D   HG++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  132  VAHKIDFKEGPAMPVLDELVQD--NHGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  188



>ref|XP_009413346.1| PREDICTED: caffeoyl-CoA O-methyltransferase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score =   332 bits (850),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQY+LET+VYPREPE MKELRE+TA HPWN+MTTSADEGQF
Sbjct  10   QQGRHQEVGHKSLLQSDALYQYMLETTVYPREPECMKELREITANHPWNIMTTSADEGQF  69

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA
Sbjct  70   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  129

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD L+ED KK G++DF+FVDADKDNYLNYHKRL++LVKVGGVI 
Sbjct  130  HKIDFREGPALPVLDLLLEDEKKQGSFDFVFVDADKDNYLNYHKRLLELVKVGGVIA  186



>gb|ACE95173.1| caffeoyl-CoA-3-O-methyltransferase [Populus tomentosa]
Length=247

 Score =   332 bits (850),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDINRENYELG PVIEKAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGPPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VA+KI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  129  VANKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYINYHKRLIELVKVGGLIG  187



>gb|ABK21526.1| unknown [Picea sitchensis]
 gb|ACN40568.1| unknown [Picea sitchensis]
Length=259

 Score =   332 bits (850),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = +3

Query  75   KAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTS  254
            KA    +  RHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTS
Sbjct  17   KAEEPAKVARHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTS  76

Query  255  ADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI  434
            ADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+I
Sbjct  77   ADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMI  136

Query  435  EKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGG  614
            EKAGVAHKIDFREGPALP+LDQ++++ + HG++DF+FVDADKDNYLNYHKRLIDLVKVGG
Sbjct  137  EKAGVAHKIDFREGPALPLLDQMIQNEELHGSFDFVFVDADKDNYLNYHKRLIDLVKVGG  196

Query  615  VIG  623
            VI 
Sbjct  197  VIA  199



>ref|XP_007153585.1| hypothetical protein PHAVU_003G047900g [Phaseolus vulgaris]
 gb|ESW25579.1| hypothetical protein PHAVU_003G047900g [Phaseolus vulgaris]
Length=247

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 174/181 (96%), Gaps = 2/181 (1%)
 Frame = +3

Query  87   ENQTT--RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            +NQT   RHQEVGHKSLLQSDALYQYILETSVYPREP++MKELRE+TAKHPWN+MTTSAD
Sbjct  7    QNQTEAGRHQEVGHKSLLQSDALYQYILETSVYPREPDSMKELRELTAKHPWNIMTTSAD  66

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVI+K
Sbjct  67   EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIKK  126

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKI+FREGPALP+LD+++ D K HG+YDFIFVDADKDNY+NYHKRLI+LVKVGG+I
Sbjct  127  AGVDHKIEFREGPALPVLDEMITDEKNHGSYDFIFVDADKDNYINYHKRLIELVKVGGLI  186

Query  621  G  623
            G
Sbjct  187  G  187



>gb|AEM45655.1| caffeoyl-CoA O-methyltransferase 3 [Petunia x hybrida]
Length=242

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 1/182 (1%)
 Frame = +3

Query  81   MAEN-QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            MA N +  RHQEVG KSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSA
Sbjct  1    MATNGENGRHQEVGRKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSA  60

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFLSML+KLINAKNTMEIGV+TGYSLLATA+ALPDD KILAMDINRENYE+GLPVIE
Sbjct  61   DEGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDDKILAMDINRENYEIGLPVIE  120

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KAG+AHKI+F+EGPALP+LDQ++ED K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGG+
Sbjct  121  KAGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGL  180

Query  618  IG  623
            IG
Sbjct  181  IG  182



>gb|ABX75853.1| caffeoyl-CoA-O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|AEV43321.1| caffeoyl-CoA O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=249

 Score =   331 bits (849),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +++  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  11   QSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADEG  70

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELG P +EKAG
Sbjct  71   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGRPTLEKAG  130

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHK+DFREGPALP LD+LV+D K HG++DFIFVDADKDNYLNYH+RL+ LVKVGGVIG
Sbjct  131  VAHKVDFREGPALPFLDELVKDEKNHGSFDFIFVDADKDNYLNYHERLLQLVKVGGVIG  189



>gb|AEW26114.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=237

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELR VTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELRXVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  178



>sp|Q41720.1|CAMT_ZINVI RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Zinnia violacea]
 gb|AAA59389.1| S-adenosyl-L-methionine:trans-caffeoyl-CoA 3-O-methyltransferase 
[Zinnia violacea]
Length=245

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             E Q  +HQEVGHKSLLQSDALYQYILETSVYPREP+ MKELR +TAKHPWNLMTTSADE
Sbjct  6    GETQPAKHQEVGHKSLLQSDALYQYILETSVYPREPQPMKELRRITAKHPWNLMTTSADE  65

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL++LLKLINAKNTMEIGVYTGYSLL+TALALP+DGKILA+DINRENYE+GLP+I+KA
Sbjct  66   GQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIQKA  125

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LDQ+++D K HG++DFIFVDADKDNYLNYHKRLIDLVK GGVIG
Sbjct  126  GVAHKIDFREGPALPLLDQMLQDEKCHGSFDFIFVDADKDNYLNYHKRLIDLVKFGGVIG  185



>gb|ADI43381.1| caffeoyl-CoA O-methyltransferase [Eucalyptus camaldulensis]
Length=246

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G +DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGAFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186



>gb|ACV50428.1| caffeoyl-CoA O-methyltransferase [Jatropha curcas]
Length=246

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ  RHQEVGHKSLL+SDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  8    QNQAGRHQEVGHKSLLRSDALYQYILETSVYPREPEPMKELRELTAKHPWNIMTTSADEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLK  NAKNTME+GVYTGYSLLATALALPDD KILAMD+NRENYELGLP+I+KAG
Sbjct  68   QFLNMLLKPNNAKNTMEMGVYTGYSLLATALALPDDEKILAMDVNRENYELGLPIIQKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V D K HGT+DFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  128  VAHKIDFREGPALPVLDEMVADEKNHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  186



>gb|ABL86148.1| caffeoyl CoAO-methyltransferase [Populus deltoides]
Length=247

 Score =   330 bits (847),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+P+DGKILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            + HKI+F+EGPALP+LDQ++ED K HGTYDFIFVDADKDNY+NYHKRL +LVKVGG+IG
Sbjct  129  LEHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLFELVKVGGLIG  187



>ref|XP_010028437.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Eucalyptus grandis]
 gb|KCW55183.1| hypothetical protein EUGRSUZ_I01134 [Eucalyptus grandis]
Length=246

 Score =   330 bits (847),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 172/180 (96%), Gaps = 1/180 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELR++TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRDITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186



>gb|AEW26126.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=237

 Score =   330 bits (846),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++++D K  G+YDFIFVDADKDNYLNYHKRLIDLVKVGGVIG
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNRGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  178



>gb|KDP31954.1| hypothetical protein JCGZ_12415 [Jatropha curcas]
Length=281

 Score =   332 bits (850),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N   RHQE+GHKSLLQSDALYQYILETSVYPREPE +KELRE+TA HPWN+MTTSADEG
Sbjct  43   QNLVGRHQEIGHKSLLQSDALYQYILETSVYPREPEPLKELRELTANHPWNIMTTSADEG  102

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSML+KLINAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYELGLPVIEKAG
Sbjct  103  QFLSMLIKLINAKNTMEIGVYTGYSLLATALALPHDGKILAMDINRENYELGLPVIEKAG  162

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQLV+D K HG++DFIFVDADKDNY+NYHKR I+LVKVGG+IG
Sbjct  163  LAHKIDFREGPALPVLDQLVQDEKNHGSFDFIFVDADKDNYINYHKRTIELVKVGGIIG  221



>gb|AFZ15799.1| caffeoyl-CoA O-methyltransferase [Lonicera japonica]
Length=247

 Score =   330 bits (847),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  102  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSM  281
            RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEGQFL+M
Sbjct  14   RHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNIMTTSADEGQFLNM  73

Query  282  LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKI  461
            LLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG+AHKI
Sbjct  74   LLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAGLAHKI  133

Query  462  DFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +FREG ALP+LDQ+++D   HGT+DFIFVDADKDNYLNYHKRLIDLVKVGG+IG
Sbjct  134  EFREGSALPVLDQMIQDENYHGTFDFIFVDADKDNYLNYHKRLIDLVKVGGLIG  187



>emb|CAK18782.1| caffeoyl CoA O-methyltransferase [Picea abies]
Length=259

 Score =   330 bits (847),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++V++ + HG++DF+FVDADKDNYLNYH+RLIDLVKVGGVI 
Sbjct  143  HKIDFREGPALPLLDEMVKNEEMHGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIA  199



>gb|AAK16714.1| caffeoyl-CoA 3-O-methyltransferase [Populus alba x Populus glandulosa]
Length=247

 Score =   330 bits (846),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKL+NAKNTMEIGVYTGYSLLATALA+P+DG+ILAMDINRENYELGLPVIEKAG
Sbjct  69   QFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGEILAMDINRENYELGLPVIEKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            V +KI+F+EGPALP+LDQ++ED K HG+YDFIFVDADK NY+NYHKRLI+LVKVGG+IG
Sbjct  129  VXNKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKKNYINYHKRLIELVKVGGLIG  187



>sp|O81185.1|CAMT1_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Eucalyptus globulus]
 gb|AAC26191.1| caffeoyl-CoA 3-O-methyltransferase [Eucalyptus globulus]
Length=246

 Score =   330 bits (845),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 172/180 (96%), Gaps = 1/180 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            ++ Q  RHQEVGHKSLLQSDALYQ+ILETSVYPREPE MKELRE+TAKHPWN+MTTSADE
Sbjct  8    SQTQAGRHQEVGHKSLLQSDALYQHILETSVYPREPEPMKELREITAKHPWNIMTTSADE  67

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KA
Sbjct  68   GQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKA  127

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  128  GVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  186



>gb|AEW26143.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=174

 Score =   327 bits (837),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVG  611
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKVG
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVG  174



>ref|XP_002523619.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF38814.1| o-methyltransferase, putative [Ricinus communis]
Length=292

 Score =   331 bits (848),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ENQ  RHQE+GHKSLLQSDALYQYILETSVYP EPE MKELRE+TA H WN+MTTSADEG
Sbjct  54   ENQAGRHQEIGHKSLLQSDALYQYILETSVYPGEPEPMKELRELTATHKWNIMTTSADEG  113

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFLSMLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLP+I+KAG
Sbjct  114  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPIIKKAG  173

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQL++D K HGT+DFIFVDADKDNYLNYHKR + L KVGGVIG
Sbjct  174  VAHKIDFREGPALPVLDQLIQDGKHHGTFDFIFVDADKDNYLNYHKRTVQLAKVGGVIG  232



>gb|AFL65039.1| caffeoyl-CoA-O-methyltransferase [Pinus pinaster]
Length=259

 Score =   330 bits (845),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPIIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++V++   HG++DF+FVDADKDNYLNYHKRLIDLVKVGG+I 
Sbjct  143  HKIDFREGPALPVLDEMVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVGGLIA  199



>gb|AHL67654.1| caffeoyl-CoA 3-O-methyltransferase [Pinus massoniana]
Length=259

 Score =   330 bits (845),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPIIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++V++   HG++DF+FVDADKDNYLNYHKRLIDLVKVGG+I 
Sbjct  143  HKIDFREGPALPVLDEMVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVGGLIA  199



>emb|CBL95257.2| caffeoyl CoA O-methyltransferase [Pinus pinaster]
Length=259

 Score =   330 bits (845),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPIIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++V++   HG++DF+FVDADKDNYLNYHKRLIDLVKVGG+I 
Sbjct  143  HKIDFREGPALPVLDEMVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVGGLIA  199



>sp|O65162.1|CAMT_MESCR RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Mesembryanthemum crystallinum]
 gb|AAC08395.1| caffeoyl-CoA O-methyltransferase [Mesembryanthemum crystallinum]
Length=254

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  102  RHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSM  281
            +HQEVGHKSLLQSDAL+QYILETSVYPREPE MKELR++TAKHPWNLMTTSADEGQFL+M
Sbjct  21   KHQEVGHKSLLQSDALFQYILETSVYPREPEPMKELRDITAKHPWNLMTTSADEGQFLNM  80

Query  282  LLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKI  461
            LLKLINAKNT+EIGVYTGYSLLA+ALALPDDGKILAMDINRENYELGLPVI+KAGVAHKI
Sbjct  81   LLKLINAKNTIEIGVYTGYSLLASALALPDDGKILAMDINRENYELGLPVIQKAGVAHKI  140

Query  462  DFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            DFREGPALP+LD L+ED K HG++DF FVDADKDNY NYHKRLIDLVK+GGVIG
Sbjct  141  DFREGPALPVLDLLIEDAKNHGSFDFAFVDADKDNYGNYHKRLIDLVKIGGVIG  194



>gb|ABR17605.1| unknown [Picea sitchensis]
 gb|ACN40076.1| unknown [Picea sitchensis]
Length=259

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  23   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDLVKVGGVI 
Sbjct  143  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIA  199



>gb|ACN40635.1| unknown [Picea sitchensis]
Length=258

 Score =   328 bits (841),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  22   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  82   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDLVKVGGVI 
Sbjct  142  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIA  198



>gb|AEW26090.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. caerulea]
 gb|AEW26098.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago sativa 
subsp. x varia]
 gb|AEW26108.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26113.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
 gb|AEW26138.1| caffeoyl-CoA 3-o-methyltransferase, partial [Medicago falcata]
Length=173

 Score =   324 bits (831),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            ++ RHQEVGHKSLLQSDALYQYILETSV+PRE EAMKELREVTAKHPWN+MTTSADEGQF
Sbjct  2    ESGRHQEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQF  61

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            LSMLLKLINAKNTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGV 
Sbjct  62   LSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVD  121

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            HKIDFREGPALP+LD++++D K HG+YDFIFVDADKDNYLNYHKRLIDLVKV
Sbjct  122  HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKV  173



>dbj|BAM05557.1| caffeoyl-CoA O-methyltransferase [Eucalyptus globulus subsp. 
globulus]
Length=247

 Score =   326 bits (836),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 172/181 (95%), Gaps = 2/181 (1%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSL-LQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            ++ Q  RHQEVGHKSL +QSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSAD
Sbjct  8    SQTQAGRHQEVGHKSLHIQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSAD  67

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+MLLKLINAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+K
Sbjct  68   EGQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQK  127

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGVA KIDFREGPALPILDQL+ED  K G++DFIFVDADKDNYLNYHKRLI+LVKVGG+I
Sbjct  128  AGVADKIDFREGPALPILDQLIED-GKQGSFDFIFVDADKDNYLNYHKRLIELVKVGGLI  186

Query  621  G  623
            G
Sbjct  187  G  187



>gb|ADV40957.1| caffeoyl-CoA O-methyltransferase [Pinus radiata]
Length=259

 Score =   327 bits (837),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 174/196 (89%), Gaps = 2/196 (1%)
 Frame = +3

Query  42   TSVKGSLAGKFKAMAEN--QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE  215
            TSV  +        AE   +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKELRE
Sbjct  4    TSVAAAEVKAQTTQAEEPVKVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRE  63

Query  216  VTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMD  395
            VTAKHPWNLMTTSADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMD
Sbjct  64   VTAKHPWNLMTTSADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMD  123

Query  396  INRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLN  575
            INRENY++GLP+IEKAGVAHKIDFREGPALP+ D+L+++   HG++DF+FVDADKDNYLN
Sbjct  124  INRENYDIGLPIIEKAGVAHKIDFREGPALPVPDELLKNEDMHGSFDFVFVDADKDNYLN  183

Query  576  YHKRLIDLVKVGGVIG  623
            YHKRLIDLVKVGG+I 
Sbjct  184  YHKRLIDLVKVGGLIA  199



>gb|AFK44432.1| unknown [Lotus japonicus]
Length=247

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + +  RHQEVGHKSLLQSDALYQYILETSVYPRE EAMKELR++TAKHPWN+MTTSADEG
Sbjct  9    QTEAGRHQEVGHKSLLQSDALYQYILETSVYPREHEAMKELRDLTAKHPWNIMTTSADEG  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+ML KLINAKNTMEIGVYTGYS LATALA+PDDGKILAMD+N+ENYELGLPVI+KAG
Sbjct  69   QFLNMLFKLINAKNTMEIGVYTGYSPLATALAIPDDGKILAMDVNKENYELGLPVIKKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD++V+  K HG+YDFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  129  VAHKIDFREGPALPVLDEMVKAEKNHGSYDFIFVDADKDNYLNYHKRLIELVKVGGVIG  187



>ref|XP_008366398.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Malus domestica]
Length=243

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 4/179 (2%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            + Q  RHQEVGHKSLLQSDALYQ    TSVYPREPE+MKELREVTAKHPWN+MTTSADEG
Sbjct  9    QTQAGRHQEVGHKSLLQSDALYQ----TSVYPREPESMKELREVTAKHPWNIMTTSADEG  64

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALA+PDDGKILAMDIN+ENYELGLP+IEKAG
Sbjct  65   QFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINKENYELGLPIIEKAG  124

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LD L+E+ K HG+YDFIFVDADKDNY+NYHKRLIDLVKVGG+IG
Sbjct  125  VAHKIDFREGPALPMLDLLIENKKNHGSYDFIFVDADKDNYINYHKRLIDLVKVGGLIG  183



>gb|ABK22164.1| unknown [Picea sitchensis]
Length=259

 Score =   326 bits (835),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTS DEGQF
Sbjct  23   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSEDEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  83   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDLVKVGGVI 
Sbjct  143  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDLVKVGGVIA  199



>gb|AFD53035.1| caffeoyl-CoA O-methyltransferase [Bambusa emeiensis]
Length=258

 Score =   325 bits (832),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELREVTAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALA+P+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLLKLIGAKKTMEIGVYTGYSLLATALAIPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LDQL+ED   HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  142  HKIDFREGPALPVLDQLLEDESNHGSFDFVFVDADKDNYLNYHERLMKLVKVGGLVG  198



>gb|ABB87185.1| caffeoyl-CoA O-methyltransferase [Chamaecyparis obtusa var. formosana]
Length=278

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 175/209 (84%), Gaps = 29/209 (14%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVT--------------  221
            +  Q +RHQEVGHKSLLQSDALYQYILETSVYPREPE+M+ELRE+T              
Sbjct  10   STQQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMRELREITQSDALYQYILETSV  69

Query  222  ---------------AKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATA  356
                           AKHPWNLMTTSADEGQFL++LLKLINAKNTMEIGVYTGYSLL+TA
Sbjct  70   YPREPESMRELREITAKHPWNLMTTSADEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTA  129

Query  357  LALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYD  536
            LALPDDGKILAMDINRENYELGLPVI+KAGVAHKIDFREGPALP+LDQ++E+ + HG++D
Sbjct  130  LALPDDGKILAMDINRENYELGLPVIQKAGVAHKIDFREGPALPVLDQMLENKEMHGSFD  189

Query  537  FIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            FIFVDADKDNYLNYHKRLIDLVK+GGVIG
Sbjct  190  FIFVDADKDNYLNYHKRLIDLVKIGGVIG  218



>gb|AAR91504.1| caffeoyl-CoA-O-methyltransferase [Corchorus capsularis]
Length=250

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 170/182 (93%), Gaps = 3/182 (2%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            ++Q  RHQEV HKS+LQSDALYQYILETSVYPREPE MKELRE+TAKHPWNLMTTSADE 
Sbjct  9    QSQAGRHQEVEHKSVLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNLMTTSADEW  68

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            QFL+MLLKLINAKNTMEIGVYTGYSLLATALALPDD KILAMDINRENYELGLPVI+KAG
Sbjct  69   QFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDAKILAMDINRENYELGLPVIQKAG  128

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKD---NYLNYHKRLIDLVKVGGV  617
            VAHKI+F+EGPALP+LD+LVED K H +YDFIFVDADKD   NY+NYHKRLIDLVKVGG+
Sbjct  129  VAHKIEFKEGPALPVLDKLVEDEKNHESYDFIFVDADKDNYINYINYHKRLIDLVKVGGL  188

Query  618  IG  623
            IG
Sbjct  189  IG  190



>gb|ABO26812.1| caffeoyl-CoA O-methyltransferase [Bambusa oldhamii]
Length=259

 Score =   323 bits (829),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELREVTAKHPWNLMTTSADEGQF
Sbjct  23   QKTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREVTAKHPWNLMTTSADEGQF  82

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALA+P+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  83   LNMLLKLIGAKKTMEIGVYTGYSLLATALAIPEDGTILAMDINRENYELGLPCIEKAGVA  142

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LDQL+ED   HG++DF+FVDADKDNYLNYH RL+ LVKVGG++G
Sbjct  143  HKIDFREGPALPVLDQLLEDEANHGSFDFVFVDADKDNYLNYHDRLMKLVKVGGLVG  199



>gb|EPS69718.1| hypothetical protein M569_05045, partial [Genlisea aurea]
Length=246

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +3

Query  105  HQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSML  284
            H+EVGHKSLL+SDALYQYILETSVYPREPE+MKELRE+TAKHPWN+MTTSADEGQFL+ML
Sbjct  14   HREVGHKSLLKSDALYQYILETSVYPREPESMKELREITAKHPWNMMTTSADEGQFLNML  73

Query  285  LKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKID  464
            LKLINAK TMEIGVYTGYSLLATALALP DGKILAMDINRENYELGLPVI+KAGVA KID
Sbjct  74   LKLINAKKTMEIGVYTGYSLLATALALPPDGKILAMDINRENYELGLPVIQKAGVADKID  133

Query  465  FREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            FREGPALP+LD+L+ D K HG +DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  134  FREGPALPVLDELILDEKNHGAFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  186



>dbj|BAK01687.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   322 bits (826),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELRE+TA HPWNLMTTSADEGQF
Sbjct  30   QVTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  90   LNMLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPCIEKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD L+ED   HGT+DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  150  HKIDFREGPALPVLDALLEDEANHGTFDFVFVDADKDNYLNYHERLMKLVKVGGLLG  206



>sp|Q9ZTT5.1|CAMT_PINTA RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Pinus taeda]
 gb|AAD02050.1| caffeoyl-CoA O-methyltransferase [Pinus taeda]
Length=259

 Score =   322 bits (825),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 172/196 (88%), Gaps = 2/196 (1%)
 Frame = +3

Query  42   TSVKGSLAGKFKAMAEN--QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELRE  215
            TSV  +        AE   +  RHQEVGHKSLLQSDALYQYILETSVYPREPE MKEL  
Sbjct  4    TSVAAAEVKAQTTQAEEPVKVVRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELPR  63

Query  216  VTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMD  395
            VTAKHPWNLMTTSADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMD
Sbjct  64   VTAKHPWNLMTTSADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMD  123

Query  396  INRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLN  575
            INRENY++GLP+IEKAGVAHKIDFREGPALP+LD+L+++   HG++DF+FVD DKDNYLN
Sbjct  124  INRENYDIGLPIIEKAGVAHKIDFREGPALPVLDELLKNEDMHGSFDFVFVDRDKDNYLN  183

Query  576  YHKRLIDLVKVGGVIG  623
            YHKRLIDLVKVGG+I 
Sbjct  184  YHKRLIDLVKVGGLIA  199



>dbj|BAG71893.1| caffeoyl CoA O-methyltransferase [Carthamus tinctorius]
Length=252

 Score =   319 bits (817),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +3

Query  69   KFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            K  +  E Q + HQEVGHKSLLQSDALYQYILETSVYPREP  MKELRE+TAKHP N+M 
Sbjct  8    KIDSNNEEQASGHQEVGHKSLLQSDALYQYILETSVYPREPTPMKELREITAKHPMNVMA  67

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFL+MLLKL+NAKNTMEIGV+TGYSLLATALALP+DGKILAMDINR++YELG P
Sbjct  68   TSADEGQFLNMLLKLVNAKNTMEIGVFTGYSLLATALALPEDGKILAMDINRDDYELGRP  127

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            +IEKAGVAHKIDF+EGPA+P+LD+++ D K HGTYDFIFVDADKDNY+NYHKRL+DLVKV
Sbjct  128  IIEKAGVAHKIDFKEGPAMPVLDEMIVDGKYHGTYDFIFVDADKDNYINYHKRLVDLVKV  187

Query  609  GGVIG  623
            GG+IG
Sbjct  188  GGLIG  192



>gb|AIN39535.1| caffeoyl-CoA-3-O-methyl transferase [Cenchrus purpureus]
Length=266

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELREVTAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREVTAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD L+ D K HG++DF+FVDADKDNYLNYH+RL+ LVK+GG+IG
Sbjct  150  HKIDFREGPALPVLDDLIADEKNHGSFDFVFVDADKDNYLNYHERLLKLVKMGGLIG  206



>ref|XP_009413345.1| PREDICTED: caffeoyl-CoA O-methyltransferase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=271

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 169/202 (84%), Gaps = 25/202 (12%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q  RHQEVGHKSLLQSDALYQY+LET+VYPREPE MKELRE+TA HPWN+MTTSADEGQF
Sbjct  10   QQGRHQEVGHKSLLQSDALYQYMLETTVYPREPECMKELREITANHPWNIMTTSADEGQF  69

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA
Sbjct  70   LNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  129

Query  453  HKIDFREGPALPILDQLVED-------------------------PKKHGTYDFIFVDAD  557
            HKIDFREGPALP+LD L+ED                          KK G++DF+FVDAD
Sbjct  130  HKIDFREGPALPVLDLLLEDVRIECIFQPLLLVSADKCCRRGWSQEKKQGSFDFVFVDAD  189

Query  558  KDNYLNYHKRLIDLVKVGGVIG  623
            KDNYLNYHKRL++LVKVGGVI 
Sbjct  190  KDNYLNYHKRLLELVKVGGVIA  211



>gb|ABR16981.1| unknown [Picea sitchensis]
Length=240

 Score =   317 bits (811),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            + TRHQEVGHKSLLQSDALYQYILETSVYPREPE +KELREVTAKHPWNLMTTSADEGQF
Sbjct  22   KVTRHQEVGHKSLLQSDALYQYILETSVYPREPEPLKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY+LGLP+IEKAGVA
Sbjct  82   LGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDLGLPMIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLV  602
            HKIDFREGPALP+LD++V++ +  G++DF+FVDADKDNYLNYH+RLIDLV
Sbjct  142  HKIDFREGPALPLLDEMVKNEEMQGSFDFVFVDADKDNYLNYHRRLIDLV  191



>ref|NP_001056910.1| Os06g0165800 [Oryza sativa Japonica Group]
 dbj|BAA78733.1| putative caffeoyl-CoA O-methyltransferase [Oryza sativa Japonica 
Group]
 gb|AAT68022.1| caffeoyl-CoA O-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD67858.1| putative caffeoyl-CoA O-methyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF18824.1| Os06g0165800 [Oryza sativa Japonica Group]
 gb|EAZ35945.1| hypothetical protein OsJ_20249 [Oryza sativa Japonica Group]
Length=260

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYILETSVYPRE E MKELREVTA HPWNLMTTSADEGQF
Sbjct  24   QKTRHSEVGHKSLLKSDDLYQYILETSVYPREHECMKELREVTANHPWNLMTTSADEGQF  83

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L++LLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  84   LNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVA  143

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LDQLVE+   HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  144  HKIDFREGPALPVLDQLVEEEGNHGSFDFVFVDADKDNYLNYHERLMKLVKVGGLVG  200



>gb|EAY99818.1| hypothetical protein OsI_21809 [Oryza sativa Indica Group]
Length=260

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYILETSVYPRE E MKELREVTA HPWNLMTTSADEGQF
Sbjct  24   QKTRHSEVGHKSLLKSDDLYQYILETSVYPREHECMKELREVTANHPWNLMTTSADEGQF  83

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L++LLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  84   LNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVA  143

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LDQLVE+   HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  144  HKIDFREGPALPVLDQLVEEEGNHGSFDFVFVDADKDNYLNYHERLMKLVKVGGLVG  200



>gb|ADC84472.1| caffeoyl CoA O-methyltransferase [Salix sachalinensis]
Length=168

 Score =   312 bits (800),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  126  SLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAK  305
            SLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEGQFL+MLLKLINAK
Sbjct  1    SLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINAK  60

Query  306  NTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPAL  485
            NTMEIGVYTGYSLLATALA+P+DGKILAMDIN+ENYELGLPVI+KAGVAHKIDF+EGPAL
Sbjct  61   NTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPAL  120

Query  486  PILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            P+LDQ++ED   HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  121  PVLDQMIEDGNHHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIG  166



>sp|Q9SLP8.1|CAMT_CITNA RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT 
[Citrus natsudaidai]
 dbj|BAA88234.1| caffeoyl-CoA 3-O-methyltransferase [Citrus natsudaidai]
Length=232

 Score =   315 bits (806),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  117  GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLI  296
            GHKS LQSDAL QYILETSVYPREPE+MKELREVTAKHPWNLM TSADEGQFL+M LKLI
Sbjct  4    GHKSKLQSDALRQYILETSVYPREPESMKELREVTAKHPWNLMRTSADEGQFLNMSLKLI  63

Query  297  NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREG  476
            NAKNTMEIGVYT YSLLATALA+PDDGKILAMDINRENYE+GLP IEKAGVAH+I FREG
Sbjct  64   NAKNTMEIGVYTDYSLLATALAIPDDGKILAMDINRENYEIGLPKIEKAGVAHRIQFREG  123

Query  477  PALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            PALP+LDQLVED K HGTYDFIFVDADKDNY+NYHKR+IDLVKVGG+IG
Sbjct  124  PALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIG  172



>gb|ABM79759.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera]
Length=218

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +3

Query  132  LQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNT  311
            LQSDALYQYILETSVYPREPE+MKELRE+TA+HPWN+MTTSADEGQFL+MLLKLINAKNT
Sbjct  1    LQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSADEGQFLNMLLKLINAKNT  60

Query  312  MEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPI  491
            MEIGVYTGYSLLATALALPDDGKILAMDIN+ENYELGLPVI+KAGVAHKIDF+EGPALP+
Sbjct  61   MEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPALPV  120

Query  492  LDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            LDQ++ED K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+IG
Sbjct  121  LDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGIIG  164



>ref|XP_006655824.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1-like [Oryza brachyantha]
Length=257

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYILETSVYPRE E MKELREVTAKHPWNLMTTSADEGQF
Sbjct  21   QKTRHSEVGHKSLLKSDDLYQYILETSVYPREHECMKELREVTAKHPWNLMTTSADEGQF  80

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L++LLKLI AK TMEIGVYTGYSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVA
Sbjct  81   LNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVA  140

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LDQL+E+   HG +DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  141  HKIDFREGPALPLLDQLLEEDANHGAFDFVFVDADKDNYLNYHERLLRLVKVGGLVG  197



>ref|XP_009764364.1| PREDICTED: caffeoyl-CoA O-methyltransferase 3-like [Nicotiana 
sylvestris]
Length=244

 Score =   314 bits (805),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
             ENQ  RHQEVGHKSLLQSDALYQYIL+TSVYP+EPE MKELRE+TAKHPWN+MTTSADE
Sbjct  5    GENQNGRHQEVGHKSLLQSDALYQYILDTSVYPKEPEPMKELREITAKHPWNIMTTSADE  64

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLSMLLKLINAKNTMEIGV+ GY LLAT +ALPDDGKILAM+INRENYE+GLPVIEK 
Sbjct  65   GQFLSMLLKLINAKNTMEIGVFIGYYLLATTMALPDDGKILAMNINRENYEIGLPVIEKV  124

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            G+AHKI+F+EG ALP+LDQ++ED K H TYDFIFVDA K+NYLNYHK LIDLVK+GG+IG
Sbjct  125  GLAHKIEFKEGHALPVLDQMLEDGKYHETYDFIFVDAGKENYLNYHKILIDLVKIGGLIG  184



>gb|ADC84473.1| caffeoyl CoA O-methyltransferase [Salix miyabeana]
Length=169

 Score =   309 bits (792),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  126  SLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAK  305
            SLLQSDALYQYILETSVYPREPE MKELRE+TAKHPWN+MTTSADEGQFL+MLLKLINAK
Sbjct  1    SLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINAK  60

Query  306  NTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPAL  485
            NTMEIGVYTGYS LATALA+P+DGKILAMDIN+ENYELGLPVI+KAGVAHKIDF+EGPAL
Sbjct  61   NTMEIGVYTGYSPLATALAIPEDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPAL  120

Query  486  PILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            P+LDQ++ED   HG++DFIFVDADKDNY+NYHKRLI+LVKVGG+IG
Sbjct  121  PVLDQMIEDGNHHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIG  166



>gb|AAP37885.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37886.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I+KAGVA
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIDKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  206



>gb|AAP37884.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGVA
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVA  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  206



>sp|Q9XGD5.1|CAMT2_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 2; Short=CCoAMT-2; 
Short=CCoAOMT-2 [Zea mays]
 emb|CAB45150.1| Caffeoyl CoA O-methyltransferase [Zea mays]
 gb|AAP33130.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37894.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37896.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37904.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=264

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  28   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  87

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  88   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  147

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYLNYH+RL+ LV+ GG+IG
Sbjct  148  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLNYHERLLKLVRPGGLIG  204



>gb|AAP37876.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37877.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37887.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37888.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37889.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37890.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37892.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37895.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37897.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|ACF79475.1| unknown [Zea mays]
 gb|ACF85778.1| unknown [Zea mays]
 gb|AFW85676.1| caffeoyl-CoA O-methyltransferase 2 [Zea mays]
Length=263

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  27   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  86

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  87   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  146

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  147  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  203



>gb|AAP37882.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37883.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37893.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37898.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37899.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37900.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37901.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37902.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37903.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37905.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  206



>gb|AAP37881.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37891.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=264

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  28   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  87

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  88   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  147

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  148  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  204



>gb|AAP37879.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=267

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  31   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  90

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  91   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  150

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  151  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  207



>gb|AAP37878.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
 gb|AAP37880.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=266

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  30   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  89

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  90   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  149

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  150  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  206



>gb|EMS59880.1| Caffeoyl-CoA O-methyltransferase 2 [Triticum urartu]
Length=284

 Score =   308 bits (788),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 165/207 (80%), Gaps = 25/207 (12%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A    Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELRE+TA HPWNLMTTSA
Sbjct  18   ANGSEQVTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSA  77

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDG--------------------  377
            DEGQFL+MLLKLI AK TMEIGVYTGYSLLATALA+PDDG                    
Sbjct  78   DEGQFLNMLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTVSSLTSPLPDPPLPIHQET  137

Query  378  -----KILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFI  542
                 +ILAMDINRENYELGLP IEKAGVAHKIDFREGPALP+LD L+ED   HGT+DF+
Sbjct  138  ETGMKQILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDALLEDEANHGTFDFV  197

Query  543  FVDADKDNYLNYHKRLIDLVKVGGVIG  623
            FVDADKDNYLNYH+RL+ LVK+GG++G
Sbjct  198  FVDADKDNYLNYHERLMKLVKLGGLLG  224



>gb|ACF79629.1| unknown [Zea mays]
Length=402

 Score =   311 bits (798),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  166  QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  225

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  226  LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  285

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  286  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  342



>gb|AAP33129.1| caffeoyl CoA 3-O-methyltransferase [Zea mays]
Length=267

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVG KSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  31   QKTRHSEVGRKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  90

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I KAGV 
Sbjct  91   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVG  150

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  151  HKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  207



>dbj|BAO20881.1| caffeoyl CoA O-methyltransferase 1 [Panicum virgatum]
Length=257

 Score =   304 bits (779),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  21   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  80

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  81   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  140

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKR  587
            HKIDFREGPALP+LD L+ D K HGT+DF+FVDADKDNYLNYH+R
Sbjct  141  HKIDFREGPALPVLDDLIADEKNHGTFDFVFVDADKDNYLNYHER  185



>ref|XP_002436550.1| hypothetical protein SORBIDRAFT_10g004540 [Sorghum bicolor]
 gb|EER87917.1| hypothetical protein SORBIDRAFT_10g004540 [Sorghum bicolor]
Length=261

 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  25   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  84

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  85   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  144

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKR  587
            HKIDFREGPALP+LD L+ D K HG++DF+FVDADKDNYLNYH R
Sbjct  145  HKIDFREGPALPVLDDLIADEKNHGSFDFVFVDADKDNYLNYHDR  189



>gb|ABQ45355.1| caffeoyl-CoA 3-O-methyltransferase [Amorpha fruticosa]
Length=223

 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  135  QSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTM  314
            QSDALYQYILE SVYPRE EAMKELRE+TAKHPWN+MTTSADEGQFL+ML+KLINAKNTM
Sbjct  1    QSDALYQYILEASVYPREHEAMKELRELTAKHPWNIMTTSADEGQFLNMLIKLINAKNTM  60

Query  315  EIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPIL  494
            EIGVYTGYSLLATALALP+DGKILAMDINRENYELGLPVI+KAG+ HKI+FREGPALP+L
Sbjct  61   EIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIKKAGLEHKIEFREGPALPVL  120

Query  495  DQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            D+LV+D K HG++DFIFVDADKDNYLNYHKRLIDLVKVGG+IG
Sbjct  121  DELVKDEKNHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGLIG  163



>gb|KHN42093.1| Caffeoyl-CoA O-methyltransferase 2 [Glycine soja]
Length=249

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            NQ   H+E+ HKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNLM T  DEGQ
Sbjct  12   NQIAGHKELAHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLMATPPDEGQ  71

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
             L MLLKLINAKNTMEIGV+TGYSLL+TALALP DGKILAMD+NRE YELGLPVI+KAGV
Sbjct  72   LLGMLLKLINAKNTMEIGVFTGYSLLSTALALPSDGKILAMDVNREYYELGLPVIQKAGV  131

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            AHKIDFREGPALP+LDQL++D K  G +DFI+VDADKDNYLNYHKR+I+LVKVGG++G
Sbjct  132  AHKIDFREGPALPLLDQLIKDEKNKGAFDFIYVDADKDNYLNYHKRVIELVKVGGLVG  189



>gb|ACG38343.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
 gb|ACG40539.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
Length=265

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 162/181 (90%), Gaps = 4/181 (2%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQ----YILETSVYPREPEAMKELREVTAKHPWNLMTTSAD  260
            Q TRH EVGHKSLL+SD LYQ    YIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSAD
Sbjct  25   QKTRHSEVGHKSLLKSDDLYQNDPQYILDTSVYPREPESMKELREITAKHPWNLMTTSAD  84

Query  261  EGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEK  440
            EGQFL+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP I K
Sbjct  85   EGQFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINK  144

Query  441  AGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVI  620
            AGV HKIDFREGPALP+LD LV D ++HG++DF FVDADKDNYL+YH+RL+ LV+ GG+I
Sbjct  145  AGVGHKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLI  204

Query  621  G  623
            G
Sbjct  205  G  205



>gb|KHN36241.1| Caffeoyl-CoA O-methyltransferase 2 [Glycine soja]
Length=248

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            NQ   H+E+GHKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNLM T  DEGQ
Sbjct  11   NQIAGHKELGHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLMATPPDEGQ  70

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
             L MLLKLINAKNTMEIGV+TGYSLL+TALALP DGKILAMD+NRE YELGLPVIEKAGV
Sbjct  71   LLGMLLKLINAKNTMEIGVFTGYSLLSTALALPSDGKILAMDVNREYYELGLPVIEKAGV  130

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            AHKIDFREGPALP+LD L++D K  G +DFI+VDADKDNYLNYHKR+I+LVK+GG+IG
Sbjct  131  AHKIDFREGPALPLLDVLIKDEKNKGAFDFIYVDADKDNYLNYHKRVIELVKLGGLIG  188



>gb|AFY17068.1| caffeoyl-coenzymeA O-methyltransferase 1b [Panicum virgatum]
Length=258

 Score =   302 bits (773),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKR  587
            HKIDFREGPALP+LD L+ D K HGT+DF FVDADKDNYLNYH+R
Sbjct  142  HKIDFREGPALPVLDDLIADEKNHGTFDFAFVDADKDNYLNYHER  186



>sp|Q9XGD6.1|CAMT1_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 
3-O-methyltransferase 1; Short=CCoAMT-1; 
Short=CCoAOMT-1 [Zea mays]
 emb|CAB45149.1| Caffeoyl CoA O-methyltransferase [Zea mays]
 gb|AAQ89899.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89901.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89907.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89910.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89913.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89918.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89923.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89925.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89928.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89931.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|ACG24581.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
 gb|ACG43034.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
Length=258

 Score =   302 bits (773),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELREVTAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREVTAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKR  587
            HKIDFREGPALP+LD L+ + K HG++DF+FVDADKDNYLNYH+R
Sbjct  142  HKIDFREGPALPVLDDLIAEEKNHGSFDFVFVDADKDNYLNYHER  186



>ref|NP_001242163.1| uncharacterized protein LOC100799303 [Glycine max]
 gb|ACU20512.1| unknown [Glycine max]
Length=247

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            NQ   H+E+GHKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNLM T  DEGQ
Sbjct  11   NQIAGHKELGHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLMATPPDEGQ  70

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
             L MLLKLINAKNTMEIGV+TGYSLL+TALALP DGKILAMD+NRE YELGLPVIEKAGV
Sbjct  71   LLGMLLKLINAKNTMEIGVFTGYSLLSTALALPSDGKILAMDVNREYYELGLPVIEKAGV  130

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            AHKIDFREGPALP+LD L+++ K  G +DFI+VDADKDNYLNYHKR+I+LVK+GG+IG
Sbjct  131  AHKIDFREGPALPLLDVLIKNEKNKGAFDFIYVDADKDNYLNYHKRVIELVKLGGLIG  188



>gb|AAQ89900.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89902.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89903.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89904.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89905.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89906.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89908.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89909.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89911.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89912.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89914.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89915.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89916.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89917.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89919.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89920.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89921.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89922.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89924.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89926.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89927.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AAQ89930.1| caffeoyl-CoA 3-O-methyltransferase 1 [Zea mays]
 gb|AFW75630.1| caffeoyl-CoA O-methyltransferase 1 [Zea mays]
Length=258

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQF
Sbjct  22   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQF  81

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ML+KLI AK TMEIGVYTGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  82   LNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  141

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKR  587
            HKIDFREGPALP+LD L+ + K HG++DF+FVDADKDNYLNYH+R
Sbjct  142  HKIDFREGPALPVLDDLIAEEKNHGSFDFVFVDADKDNYLNYHER  186



>ref|XP_003564267.1| PREDICTED: caffeoyl-CoA O-methyltransferase 1 [Brachypodium distachyon]
Length=262

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELREVTA HPWNLMTTSADEGQF
Sbjct  26   QKTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREVTANHPWNLMTTSADEGQF  85

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+MLLKLI AK TMEIGVYTGYSLLATALALP DG ILAMDINRENYELGLP IEKAGVA
Sbjct  86   LNMLLKLIGAKKTMEIGVYTGYSLLATALALPADGTILAMDINRENYELGLPCIEKAGVA  145

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD L+ED + HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  146  HKIDFREGPALPVLDALLEDERNHGSFDFVFVDADKDNYLNYHERLMRLVKVGGLLG  202



>ref|XP_007156786.1| hypothetical protein PHAVU_002G017500g [Phaseolus vulgaris]
 gb|ESW28780.1| hypothetical protein PHAVU_002G017500g [Phaseolus vulgaris]
Length=248

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H+++ HKSLLQSDALYQYILETSVYPRE E++KELRE+T KHPWNL+ T  DEG
Sbjct  10   QNQMAGHKQLRHKSLLQSDALYQYILETSVYPREHESLKELRELTEKHPWNLLATPPDEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q L MLLKLINAKNTMEIGVYTGYSLL+TALALP DGKILA+DINRE YELGLPVIEKAG
Sbjct  70   QLLGMLLKLINAKNTMEIGVYTGYSLLSTALALPSDGKILALDINREYYELGLPVIEKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDFREGPALP+LDQL+++ K  GT+DFIFVDADKDNYLNYH R+I+LVKVGG+I 
Sbjct  130  VAHKIDFREGPALPLLDQLIKEEKNKGTFDFIFVDADKDNYLNYHNRVIELVKVGGMIA  188



>gb|AAV68503.1| putative caffeoyl-CoA 3-O-methyltransferase [Brassica napus]
 gb|AAV80201.1| caffeoyl-CoA 3-O-methyltransferase [Brassica napus]
Length=162

 Score =   296 bits (759),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +3

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE+MKELREVTAKHPWN+MTTSADEGQFL+ML+KL+NAKNTMEIGVYTGYSLL
Sbjct  1    TSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLL  60

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            ATALALP+DGKILAMD+NRENYELGLP+IEKAGVAHKIDFREGPALP+LDQLV D K HG
Sbjct  61   ATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHG  120

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            TYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  121  TYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  152



>gb|AEJ83060.1| caffeoyl CoA 3-O-methyltransferase [Triarrhena lutarioriparia 
var. lutarioriparia]
Length=261

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPWNLMTT+ADEGQ 
Sbjct  25   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTTADEGQT  84

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVA  452
            L+ L  LI AK T + G  TGYSLLATALALP+DG ILAMDINRENYELGLP IEKAGVA
Sbjct  85   LNKLNNLIGAKKTRKTGEDTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVA  144

Query  453  HKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            HKIDFREGPALP+LD LV D K HG++DF+FVDADKDNYLNYH+RL+ LV+VGG+IG
Sbjct  145  HKIDFREGPALPVLDDLVADEKNHGSFDFVFVDADKDNYLNYHERLMQLVRVGGLIG  201



>ref|XP_002523618.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF38813.1| o-methyltransferase, putative [Ricinus communis]
Length=309

 Score =   299 bits (765),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = +3

Query  69   KFKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMT  248
            K +++ ++++ + + V  K L  +   Y+YIL+TSVYP EPE MKELRE+TA H WN+MT
Sbjct  66   KLRSLNQHKSKKTKLVDIKKL-DTRVFYRYILQTSVYPGEPEPMKELRELTATHKWNIMT  124

Query  249  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLP  428
            TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALP+DGKILAMDINRENYELGLP
Sbjct  125  TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLP  184

Query  429  VIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKV  608
            VI+KAGVAHKIDFREGPALP+LDQL++D K HGT+DFIFVDADKDNYLNYHKR I+LVKV
Sbjct  185  VIKKAGVAHKIDFREGPALPVLDQLIQDGKHHGTFDFIFVDADKDNYLNYHKRTIELVKV  244

Query  609  GGVIG  623
            GGVIG
Sbjct  245  GGVIG  249



>gb|AAV65754.1| caffeoyl-CoA O-methyltransferase [Boehmeria nivea]
Length=162

 Score =   293 bits (751),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +3

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGV+TGYSLL
Sbjct  1    TSVYPREPESMKELREITAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVFTGYSLL  60

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            ATALALP+DGKILAMDINRENYELGLPVIEKAG+AHKIDFREGPALP LDQ++ED K HG
Sbjct  61   ATALALPEDGKILAMDINRENYELGLPVIEKAGLAHKIDFREGPALPALDQMIEDGKYHG  120

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            ++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  121  SFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  152



>gb|AAV80203.1| caffeoyl-CoA 3-O-methyltransferase [Brassica napus]
Length=162

 Score =   293 bits (749),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE+MKELREVTAKHPWN+MTTSADEGQFL+ML+KL+NAKNTMEIGVYTGYSLL
Sbjct  1    TSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLL  60

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            ATALALP+DGKILAMD+NRENYELGLP+IEKAGVAHKIDFREGPAL +LD+LV D K HG
Sbjct  61   ATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALSVLDELVADEKNHG  120

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            TYDFIFVDADKDNY+NYHKRLIDLVKVGGVIG
Sbjct  121  TYDFIFVDADKDNYINYHKRLIDLVKVGGVIG  152



>gb|AAV80200.1| caffeoyl-CoA 3-O-methyltransferase [Boehmeria nivea]
 gb|AAV80202.1| caffeoyl-CoA 3-O-methyltransferase [Boehmeria nivea]
Length=162

 Score =   293 bits (749),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +3

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGV+TGYSLL
Sbjct  1    TSVYPREPESMKELREITAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVFTGYSLL  60

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            ATALALP+DGKILAMDINRENYELGLPVIEKAG+AHKIDFREGPALP LDQ++ED K HG
Sbjct  61   ATALALPEDGKILAMDINRENYELGLPVIEKAGLAHKIDFREGPALPALDQMLEDGKYHG  120

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            ++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  121  SFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  152



>gb|ACX37697.1| caffeoyl-CoA O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=232

 Score =   294 bits (753),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 156/169 (92%), Gaps = 1/169 (1%)
 Frame = +3

Query  117  GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLI  296
            G +S  Q+    +YILETSVYPREPE MKELRE+TAKHPWN+MTTSADEGQFL+MLLKLI
Sbjct  5    GEESQTQAGRHQEYILETSVYPREPEPMKELREITAKHPWNIMTTSADEGQFLNMLLKLI  64

Query  297  NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREG  476
            NAKNTMEIGV+TGYSLLATALALPDDGKILAMDINRENYELGLPVI+KAGVA KIDFREG
Sbjct  65   NAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFREG  124

Query  477  PALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            PALPILDQL+ED  K G +DFIFVDADKDNYLNYHKRLI+LVKVGG+IG
Sbjct  125  PALPILDQLIED-GKQGAFDFIFVDADKDNYLNYHKRLIELVKVGGLIG  172



>gb|AHX74224.1| caffeoyl-CoA O-methyltransferase [Pinus taeda]
Length=261

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 160/184 (87%), Gaps = 2/184 (1%)
 Frame = +3

Query  72   FKAMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTT  251
            FK MA       +     +  Q++   +YILETSVYPREPE MKELREVTAKHPWNLMTT
Sbjct  20   FKEMAGTSVAAAEVKAQTT--QAEEPVKYILETSVYPREPEPMKELREVTAKHPWNLMTT  77

Query  252  SADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPV  431
            SADEGQFL +LLKLINAKNTMEIGVYTGYSLL+TALALPDDGKILAMDINRENY++GLP+
Sbjct  78   SADEGQFLGLLLKLINAKNTMEIGVYTGYSLLSTALALPDDGKILAMDINRENYDIGLPI  137

Query  432  IEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVG  611
            IEKAGVAHKIDFREGPA+P+LD+LV++   HG++DF+FVDADKDNYLNYHKRLIDLVKVG
Sbjct  138  IEKAGVAHKIDFREGPAMPVLDELVKNEDMHGSFDFVFVDADKDNYLNYHKRLIDLVKVG  197

Query  612  GVIG  623
            G+I 
Sbjct  198  GLIA  201



>ref|XP_009418796.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  78   AMAENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSA  257
            A    Q   HQEVGHKSLLQSDALYQYIL+TSV PREPE MKELR++TA HP N+M+ S 
Sbjct  2    ASQNGQQRPHQEVGHKSLLQSDALYQYILDTSVLPREPECMKELRQITANHPMNIMSISV  61

Query  258  DEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIE  437
            DEGQFL+MLLKL  AK TMEIGVYTGYSLLATALALPDDGKILAMD NR+ YE+GLP I+
Sbjct  62   DEGQFLNMLLKLTRAKKTMEIGVYTGYSLLATALALPDDGKILAMDTNRKYYEVGLPTIQ  121

Query  438  KAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGV  617
            KA VAHKIDFREGPALP+LDQL++D   HG++DF+FVDADK+NY+NYH+RL+DLVKVGG+
Sbjct  122  KAAVAHKIDFREGPALPVLDQLLQDETNHGSFDFVFVDADKENYVNYHRRLLDLVKVGGL  181

Query  618  IG  623
            I 
Sbjct  182  IA  183



>gb|AAV80199.1| caffeoyl-CoA 3-O-methyltransferase [Boehmeria nivea]
Length=162

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  168  TSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLL  347
            TSVYPREPE+MKELRE+TAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGV+TGYSLL
Sbjct  1    TSVYPREPESMKELREITAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVFTGYSLL  60

Query  348  ATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHG  527
            A  LALP+DGKILAMDINRENYELGLPVIEKAG+AHKIDFREGPALP LDQ++ED K HG
Sbjct  61   ANGLALPEDGKILAMDINRENYELGLPVIEKAGLAHKIDFREGPALPALDQMIEDGKYHG  120

Query  528  TYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            ++DFIFVDADKDNYLNYHKRLI+LVKVGGVIG
Sbjct  121  SFDFIFVDADKDNYLNYHKRLIELVKVGGVIG  152



>ref|XP_006466586.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
Length=249

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  117  GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLI  296
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW++M TS DE QFLSMLLKLI
Sbjct  21   GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLI  80

Query  297  NAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREG  476
            NAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE GLP+I+KAGVAHKIDFREG
Sbjct  81   NAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREG  140

Query  477  PALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            PALP+LDQL++D K HGT+DF+FVDADK+NY+NYHKRLI+LVKVGGVIG
Sbjct  141  PALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIG  189



>ref|XP_010928606.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Elaeis guineensis]
Length=247

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 159/186 (85%), Gaps = 4/186 (2%)
 Frame = +3

Query  78   AMAENQTTRHQEV----GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLM  245
            A A    +R QE       KSLL+SDALYQYILETSVYPREPE MKELR VTAKHPWN M
Sbjct  2    ANAPEDESREQENPTDHAQKSLLKSDALYQYILETSVYPREPECMKELRLVTAKHPWNGM  61

Query  246  TTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGL  425
              +ADE QFL MLLK++NAKNTMEIGVYTGYSLLATALALPDDGKILA DINRENYELGL
Sbjct  62   AAAADEVQFLGMLLKVLNAKNTMEIGVYTGYSLLATALALPDDGKILAFDINRENYELGL  121

Query  426  PVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVK  605
            PV++KAGVAHKIDF EGPALP+LDQ+V D K  G+ DF+FVDADK+NYLNYHKR+++LV+
Sbjct  122  PVLKKAGVAHKIDFHEGPALPVLDQMVHDEKHKGSLDFVFVDADKENYLNYHKRVLELVR  181

Query  606  VGGVIG  623
            VGGVIG
Sbjct  182  VGGVIG  187



>ref|XP_006425921.1| hypothetical protein CICLE_v10026344mg [Citrus clementina]
 gb|ESR39161.1| hypothetical protein CICLE_v10026344mg [Citrus clementina]
Length=249

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEV-GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW  236
            +A   +   EN+   ++ + G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW
Sbjct  1    MAANREGQEENKDRYYKTLHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPW  60

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            + M T+ DE QFLSMLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE
Sbjct  61   SAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYE  120

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
             GLP+I+KAGVAHKIDFREGPALP+LDQL++D K HGT+DF+FVDADK+NY+NYHKRLI+
Sbjct  121  KGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIE  180

Query  597  LVKVGGVIG  623
            LVKVGGVIG
Sbjct  181  LVKVGGVIG  189



>gb|ACL54796.1| unknown [Zea mays]
 gb|AFW85675.1| hypothetical protein ZEAMMB73_482080 [Zea mays]
Length=299

 Score =   291 bits (745),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 162/213 (76%), Gaps = 36/213 (17%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW------------  236
            Q TRH EVGHKSLL+SD LYQYIL+TSVYPREPE+MKELRE+TAKHPW            
Sbjct  27   QKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWYVPLAFRPVVRG  86

Query  237  ------------------------NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSL  344
                                    NLMTTSADEGQFL+ML+KLI AK TMEIGVYTGYSL
Sbjct  87   GFECVGLLDVDRPRSENERGVACRNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSL  146

Query  345  LATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKH  524
            LATALALP+DG ILAMDINRENYELGLP I KAGV HKIDFREGPALP+LD LV D ++H
Sbjct  147  LATALALPEDGTILAMDINRENYELGLPCINKAGVGHKIDFREGPALPVLDDLVADKEQH  206

Query  525  GTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            G++DF FVDADKDNYL+YH+RL+ LV+ GG+IG
Sbjct  207  GSFDFAFVDADKDNYLSYHERLLKLVRPGGLIG  239



>ref|XP_002963752.1| hypothetical protein SELMODRAFT_266699 [Selaginella moellendorffii]
 gb|EFJ35623.1| hypothetical protein SELMODRAFT_266699 [Selaginella moellendorffii]
Length=291

 Score =   290 bits (743),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            A+ + ++HQ +GHKSLL+SDALYQY+LETSVYPREP +++ LRE+TAKHPWN+MTTS DE
Sbjct  52   AKEEASKHQTLGHKSLLKSDALYQYLLETSVYPREPASLRGLRELTAKHPWNIMTTSPDE  111

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLSML+K++NAKNT+EIGV+TGYSLL+TALALP+DGKI+AMDI+R NY+LG P +++A
Sbjct  112  GQFLSMLVKIMNAKNTIEIGVFTGYSLLSTALALPEDGKIIAMDIDRSNYDLGFPFLQEA  171

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV HKIDFREGPAL  LD+LV++ K HG +DFIF+DADK+NYLNYH+R++ LVK+GG+IG
Sbjct  172  GVDHKIDFREGPALATLDELVQNNKNHGFFDFIFIDADKNNYLNYHERVMQLVKIGGIIG  231



>ref|XP_002974834.1| hypothetical protein SELMODRAFT_101771 [Selaginella moellendorffii]
 gb|EFJ24354.1| hypothetical protein SELMODRAFT_101771 [Selaginella moellendorffii]
Length=278

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   AENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADE  263
            A+++ ++HQ +GHKSLL+SDALYQY+LETSVYPREP +++ LRE+TAKHPWN+MTTS DE
Sbjct  39   AKDEASKHQTLGHKSLLKSDALYQYLLETSVYPREPASLRGLRELTAKHPWNIMTTSPDE  98

Query  264  GQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKA  443
            GQFLS+L+K++NAKNT+EIGV+TGYSLL+TALALP+DGKI+AMDI+R NY+LG P +++A
Sbjct  99   GQFLSLLVKIMNAKNTIEIGVFTGYSLLSTALALPEDGKIIAMDIDRSNYDLGFPFLQEA  158

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GV HKIDFREGPAL  LD+LV++ K HG +DFIF+DADK+NYLNYH+R++ LVK+GG+IG
Sbjct  159  GVDHKIDFREGPALATLDELVQNDKNHGFFDFIFIDADKNNYLNYHERVMQLVKIGGIIG  218



>gb|AGV54319.1| caffeoyl CoA O-methyltransferase [Phaseolus vulgaris]
 gb|AGV54717.1| caffeoyl CoA O-methyltransferase [Phaseolus vulgaris]
Length=246

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N     +++ HK+LLQSDALYQYILETSVYPRE E +KELRE+T KHP NLM T  DEG
Sbjct  8    KNHVFGVKDLSHKTLLQSDALYQYILETSVYPREHECLKELREMTEKHPRNLMATPPDEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q LSML+KLINAKNT+EIGVYTGYSLL+TALALP DGKILA+D+NRE YELGLP+IEKAG
Sbjct  68   QLLSMLIKLINAKNTLEIGVYTGYSLLSTALALPPDGKILALDVNREYYELGLPIIEKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP LD+L++D  K GT+DF+FVDADK+NYLNYHKR+IDLVKVGG+IG
Sbjct  128  VAHKIDFKEGPALPFLDELLKDENKKGTFDFVFVDADKNNYLNYHKRVIDLVKVGGLIG  186



>ref|XP_006427260.1| hypothetical protein CICLE_v10026347mg [Citrus clementina]
 gb|ESR40500.1| hypothetical protein CICLE_v10026347mg [Citrus clementina]
Length=248

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  123  KSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINA  302
            K+LLQSD LYQYILETSVYPRE E +KELRE+T KHP N M ++ DE QFLSMLLKLINA
Sbjct  22   KNLLQSDELYQYILETSVYPREHECLKELRELTKKHPRNHMLSTPDEAQFLSMLLKLINA  81

Query  303  KNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPA  482
            KNTMEIGVYTGYSLL TALA+PDDGKILAMDINRE YELGLP+IEKAGVAHKIDFREGPA
Sbjct  82   KNTMEIGVYTGYSLLYTALAIPDDGKILAMDINREYYELGLPIIEKAGVAHKIDFREGPA  141

Query  483  LPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            LP+LDQ+++D K HGT+DFIFVDADK+NY+NYH+R+I LVKVGGVIG
Sbjct  142  LPLLDQMIQDEKYHGTFDFIFVDADKNNYINYHERIIALVKVGGVIG  188



>ref|XP_006465346.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
Length=248

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  123  KSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINA  302
            K+LLQSD LYQYILETSVYPRE E +KELRE+T KHP N M ++ DE QFLSMLLKLINA
Sbjct  22   KNLLQSDELYQYILETSVYPREHECLKELRELTKKHPRNHMLSTPDEAQFLSMLLKLINA  81

Query  303  KNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPA  482
            KNTMEIGVYTGYSLL TALA+PDDGKILAMDINRE YELGLP+IEKAGVAHKIDFREGPA
Sbjct  82   KNTMEIGVYTGYSLLYTALAIPDDGKILAMDINREYYELGLPIIEKAGVAHKIDFREGPA  141

Query  483  LPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            LP+LDQ+++D K HGT+DFIFVDADK+N +NYHKR+I+LVKVGGVIG
Sbjct  142  LPLLDQMIQDEKYHGTFDFIFVDADKNNNINYHKRIIELVKVGGVIG  188



>gb|ACJ84250.1| unknown [Medicago truncatula]
 gb|KEH31447.1| caffeoyl-CoA 3-O-methyltransferase [Medicago truncatula]
Length=248

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H ++ HK+LLQSDALYQYIL+TSV+P E   +KELRE+T KHP NLM T ADEG
Sbjct  10   QNQIIGHTDLAHKTLLQSDALYQYILDTSVFPNEHPCLKELREMTEKHPRNLMATPADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q + ML+KLINAKNTMEIGVYTGYSLL+TALALP DGK+LA+D++RE YELGLP+IEKAG
Sbjct  70   QLIRMLIKLINAKNTMEIGVYTGYSLLSTALALPSDGKVLALDVSREYYELGLPIIEKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQL++D    G +DF+FVDADKDNYLNYH+R+IDLVKVGG+IG
Sbjct  130  IAHKIDFREGPALPLLDQLIQDENNKGAFDFVFVDADKDNYLNYHERIIDLVKVGGLIG  188



>ref|XP_007155910.1| hypothetical protein PHAVU_003G242400g [Phaseolus vulgaris]
 gb|ESW27904.1| hypothetical protein PHAVU_003G242400g [Phaseolus vulgaris]
Length=246

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +N     +++ HK+LLQSDALYQYIL+TSVYPRE E +KELRE+T KHP NLM T  DEG
Sbjct  8    KNHVFGIKDLSHKTLLQSDALYQYILDTSVYPREHECLKELREMTEKHPRNLMATPPDEG  67

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q LSML+KLINAKNT+EIGVYTGYSLL+TALALP DGKILA+D+NRE YELGLP+IEKAG
Sbjct  68   QLLSMLIKLINAKNTLEIGVYTGYSLLSTALALPPDGKILALDVNREYYELGLPIIEKAG  127

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            VAHKIDF+EGPALP LD+L++D  K GT+DF+FVDADK+NYLNYHKR+IDLVKVGG+IG
Sbjct  128  VAHKIDFKEGPALPFLDELLKDENKKGTFDFVFVDADKNNYLNYHKRVIDLVKVGGLIG  186



>ref|XP_002976256.1| hypothetical protein SELMODRAFT_271191 [Selaginella moellendorffii]
 gb|EFJ22516.1| hypothetical protein SELMODRAFT_271191 [Selaginella moellendorffii]
Length=258

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            N+  +H +VGHKS+L+SD LYQYIL+TSVYPREP  +K LRE+TA HPWNLMTTS DEGQ
Sbjct  21   NKAGKHSQVGHKSVLKSDKLYQYILDTSVYPREPAPLKGLREMTAHHPWNLMTTSPDEGQ  80

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
            FL  LLK++NAK TMEIGVYTGYSLL+TALALP+DG +LAMDINR+N+ELG P + +AGV
Sbjct  81   FLMFLLKMMNAKKTMEIGVYTGYSLLSTALALPEDGTVLAMDINRKNFELGYPYMVEAGV  140

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            AHKIDFREGPAL  LD++++D   HG +DFIFVDADKDNYLNYHKRLI LVKVGGVIG
Sbjct  141  AHKIDFREGPALAALDEMLKDEANHGAFDFIFVDADKDNYLNYHKRLISLVKVGGVIG  198



>ref|XP_002987152.1| hypothetical protein SELMODRAFT_158563 [Selaginella moellendorffii]
 gb|EFJ11728.1| hypothetical protein SELMODRAFT_158563 [Selaginella moellendorffii]
Length=258

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  90   NQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQ  269
            N+  +H +VGHKS+L+SD LYQYIL+TSVYPREP  +K LRE+TA HPWNLMTTS DEGQ
Sbjct  21   NKAGKHSQVGHKSVLKSDKLYQYILDTSVYPREPAPLKGLREMTAHHPWNLMTTSPDEGQ  80

Query  270  FLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGV  449
            FL  LLK++NAK TMEIGVYTGYSLL+TALALP+DG +LAMDINR+N+ELG P + +AGV
Sbjct  81   FLMFLLKMMNAKKTMEIGVYTGYSLLSTALALPEDGTVLAMDINRKNFELGYPYMVEAGV  140

Query  450  AHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            AHKIDFREGPAL  LD++++D   HG +DFIFVDADKDNYLNYHKRLI LVKVGGVIG
Sbjct  141  AHKIDFREGPALAALDEMLKDEANHGAFDFIFVDADKDNYLNYHKRLISLVKVGGVIG  198



>gb|AFK40182.1| unknown [Medicago truncatula]
Length=248

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ENQTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEG  266
            +NQ   H ++ HK+LLQSDALYQYIL+TSV+P E   +KELRE+T KHP NLM T ADEG
Sbjct  10   QNQIIGHTDLAHKTLLQSDALYQYILDTSVFPNEHPCLKELREMTEKHPRNLMATPADEG  69

Query  267  QFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAG  446
            Q + ML+KLINAKNTMEIGVYTGYSLL+T LALP DGK+LA+D++RE YELGLP+IEKAG
Sbjct  70   QLIRMLIKLINAKNTMEIGVYTGYSLLSTTLALPSDGKVLALDVSREYYELGLPIIEKAG  129

Query  447  VAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            +AHKIDFREGPALP+LDQL++D    G +DF+FVDADKDNYLNYH+R+IDLVKVGG+IG
Sbjct  130  IAHKIDFREGPALPLLDQLIQDENNKGAFDFVFVDADKDNYLNYHERIIDLVKVGGLIG  188



>gb|AFK31247.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Indica 
Group]
 gb|AFK31248.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Indica 
Group]
 gb|AFK31249.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Indica 
Group]
 gb|AFK31251.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Indica 
Group]
 gb|AFK31252.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31253.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31254.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31255.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31256.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31257.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31259.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31260.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31261.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31262.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
 gb|AFK31266.1| caffeoyl-CoA O-methyltransferase, partial [Oryza rufipogon]
 gb|AFK31267.1| caffeoyl-CoA O-methyltransferase, partial [Oryza rufipogon]
Length=179

 Score =   280 bits (717),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  YILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTG  335
            YILETSVYPRE E MKELREVTA HPWNLMTTSADEGQFL++LLKLI AK TMEIGVYTG
Sbjct  1    YILETSVYPREHECMKELREVTANHPWNLMTTSADEGQFLNLLLKLIGAKKTMEIGVYTG  60

Query  336  YSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDP  515
            YSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVAHKIDFREGPALP+LDQLVE+ 
Sbjct  61   YSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVAHKIDFREGPALPVLDQLVEEE  120

Query  516  KKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
              HG++DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  121  GNHGSFDFVFVDADKDNYLNYHERLMKLVKVGGLVG  156



>ref|XP_006428886.1| hypothetical protein CICLE_v10012561mg [Citrus clementina]
 gb|ESR42126.1| hypothetical protein CICLE_v10012561mg [Citrus clementina]
Length=249

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEV-GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW  236
            +A   +   EN+    + V G+K+ LQS+ LY+YILETSVYPREP+ +KE+RE+T KHP 
Sbjct  1    MAANREGQEENKDRYFKAVHGNKTFLQSEKLYEYILETSVYPREPQCLKEIRELTYKHPL  60

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            + M TS DE QF SMLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE
Sbjct  61   SPMMTSPDEAQFFSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYE  120

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
             GLP+I+KAGVAHKIDFREGPALP+LDQL++  K HGT+DF+FVDADKDNY+NYHKRLI+
Sbjct  121  KGLPIIQKAGVAHKIDFREGPALPLLDQLIQHEKYHGTFDFVFVDADKDNYVNYHKRLIE  180

Query  597  LVKVGGVIG  623
            LVKVGGVIG
Sbjct  181  LVKVGGVIG  189



>ref|XP_006480587.1| PREDICTED: caffeoyl-CoA O-methyltransferase-like [Citrus sinensis]
Length=249

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = +3

Query  60   LAGKFKAMAENQTTRHQEV-GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPW  236
            +A   +   EN+    + V G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHP 
Sbjct  1    MAANREDQEENKDRYFKAVHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTYKHPL  60

Query  237  NLMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYE  416
            + M TS DE QF SMLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE
Sbjct  61   SPMMTSPDEAQFFSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYE  120

Query  417  LGLPVIEKAGVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLID  596
             GLP+I+KAGVAHKIDFREGPALP+LDQL++  K HGT+DF+FVDADKDNY+NYHKRLI+
Sbjct  121  KGLPIIQKAGVAHKIDFREGPALPLLDQLIQHEKYHGTFDFVFVDADKDNYVNYHKRLIE  180

Query  597  LVKVGGVIG  623
            LVKVGGVIG
Sbjct  181  LVKVGGVIG  189



>gb|KDP31955.1| hypothetical protein JCGZ_12416 [Jatropha curcas]
Length=232

 Score =   281 bits (720),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +3

Query  111  EVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLK  290
             +    +L ++   +YIL+TSVYP+EP  +KELRE+TA HPW++MTTSAD GQFLS+LLK
Sbjct  2    SLNQTRMLATEVSCRYILDTSVYPKEPAPLKELRELTANHPWSIMTTSADGGQFLSILLK  61

Query  291  LINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFR  470
            ++NAKNTMEIGVYTGYSLLATALALP DGKILAMDINRENYELGLPVIEKAGVAHKIDFR
Sbjct  62   IMNAKNTMEIGVYTGYSLLATALALPYDGKILAMDINRENYELGLPVIEKAGVAHKIDFR  121

Query  471  EGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            EGPALP+LDQLV+D K HG +DFIFVDADKDNYLNYHKR I+LVKVG +IG
Sbjct  122  EGPALPVLDQLVQDEKNHGKFDFIFVDADKDNYLNYHKRNIELVKVGAIIG  172



>gb|EMT14560.1| Caffeoyl-CoA O-methyltransferase 2 [Aegilops tauschii]
Length=261

 Score =   282 bits (722),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 153/180 (85%), Gaps = 5/180 (3%)
 Frame = +3

Query  93   QTTRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQF  272
            Q TRH EVGHKSLLQSDALYQYILETSVYPRE E MKELRE+TA HPWNLMTTSADEGQF
Sbjct  24   QVTRHSEVGHKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSADEGQF  83

Query  273  LSMLLKLINAKNTMEIGVYTGYSLLATALALPDDG---KILAMDINRENYELGLPVIEKA  443
            L+MLLKLI AK TMEIG+Y  +S     L   ++    +ILAMDINRENYELGLP IEKA
Sbjct  84   LNMLLKLIGAKKTMEIGIY--HSQFTKKLKKNENETEMQILAMDINRENYELGLPCIEKA  141

Query  444  GVAHKIDFREGPALPILDQLVEDPKKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            GVAHKIDFREGPALP+LD L+ED   HGT+DF+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  142  GVAHKIDFREGPALPVLDALLEDEANHGTFDFVFVDADKDNYLNYHERLMKLVKVGGLLG  201



>ref|XP_002523620.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF38815.1| o-methyltransferase, putative [Ricinus communis]
Length=226

 Score =   281 bits (718),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  YILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTG  335
            YILETSVYPREP  MKELRE+TA H WN+MTTSADEGQFLSML+KLI+AKNTMEIGVYTG
Sbjct  11   YILETSVYPREPRPMKELRELTATHKWNVMTTSADEGQFLSMLVKLIHAKNTMEIGVYTG  70

Query  336  YSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDP  515
            YSLLATALALP+DGK+LA+DINRENYELGLP+I+KAGVAHKIDF+E PALP+LDQL++D 
Sbjct  71   YSLLATALALPEDGKVLAIDINRENYELGLPIIKKAGVAHKIDFKEEPALPVLDQLIQDG  130

Query  516  KKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
            K HGT+DFIFVDADKDNYLNYHKR I+LVKVGG+IG
Sbjct  131  KHHGTFDFIFVDADKDNYLNYHKRTIELVKVGGIIG  166



>gb|AFK31263.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
Length=179

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  YILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTG  335
            YILETSVYPRE E MKELREVTA HPWNLMTTSADEGQFL++LLKLI AK TMEIGVYTG
Sbjct  1    YILETSVYPREHECMKELREVTANHPWNLMTTSADEGQFLNLLLKLIGAKKTMEIGVYTG  60

Query  336  YSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDP  515
            YSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVAHKIDFREGPALP+LDQLVE+ 
Sbjct  61   YSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVAHKIDFREGPALPVLDQLVEEE  120

Query  516  KKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
              HG++ F+FVDADKDNYLNYH+RL+ LVKVGG++G
Sbjct  121  GNHGSFGFVFVDADKDNYLNYHERLMKLVKVGGLVG  156



>gb|AFK31258.1| caffeoyl-CoA O-methyltransferase, partial [Oryza sativa Japonica 
Group]
Length=179

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  YILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVYTG  335
            YILETSVYPRE E MKELREVTA HPWNLMTTSADEGQFL++LLKLI AK TMEIGVYTG
Sbjct  1    YILETSVYPREHECMKELREVTANHPWNLMTTSADEGQFLNLLLKLIGAKKTMEIGVYTG  60

Query  336  YSLLATALALPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFREGPALPILDQLVEDP  515
            YSLLATALA+PDDG ILAMDINRENYELGLP IEKAGVAHKIDFREGPALP+LDQLVE+ 
Sbjct  61   YSLLATALAIPDDGTILAMDINRENYELGLPSIEKAGVAHKIDFREGPALPVLDQLVEEE  120

Query  516  KKHGTYDFIFVDADKDNYLNYHKRLIDLVKVGGVIG  623
              HG++DF+FVDADK NYLNYH+RL+ LVKVGG++G
Sbjct  121  GNHGSFDFVFVDADKGNYLNYHERLMKLVKVGGLVG  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950