BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN015B01

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011076650.1|  PREDICTED: uncharacterized protein LOC105160850    182   7e-53   Sesamum indicum [beniseed]
emb|CDP13970.1|  unnamed protein product                                177   1e-50   Coffea canephora [robusta coffee]
ref|XP_009776957.1|  PREDICTED: uncharacterized protein LOC104226...    172   8e-50   Nicotiana sylvestris
ref|XP_009591922.1|  PREDICTED: uncharacterized protein LOC104088...    172   8e-50   Nicotiana tomentosiformis
ref|XP_009591921.1|  PREDICTED: uncharacterized protein LOC104088...    173   2e-49   Nicotiana tomentosiformis
ref|XP_009776956.1|  PREDICTED: uncharacterized protein LOC104226...    173   3e-49   Nicotiana sylvestris
gb|EYU20061.1|  hypothetical protein MIMGU_mgv1a011365mg                171   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_006591393.1|  PREDICTED: uncharacterized protein LOC100809288    169   7e-48   
gb|KHN04787.1|  hypothetical protein glysoja_031887                     167   3e-47   Glycine soja [wild soybean]
ref|XP_004239953.1|  PREDICTED: uncharacterized protein LOC101260820    166   1e-46   Solanum lycopersicum
ref|XP_006355642.1|  PREDICTED: uncharacterized protein LOC102579...    164   1e-46   Solanum tuberosum [potatoes]
gb|KEH34808.1|  autophagy-related protein                               162   4e-46   Medicago truncatula
ref|XP_006355641.1|  PREDICTED: uncharacterized protein LOC102579...    165   4e-46   Solanum tuberosum [potatoes]
gb|KJB74365.1|  hypothetical protein B456_011G290500                    162   4e-46   Gossypium raimondii
gb|KHG25155.1|  Autophagy-related 27                                    163   2e-45   Gossypium arboreum [tree cotton]
ref|XP_007008867.1|  Leucine-rich repeat and IQ domain-containing...    160   2e-45   
ref|XP_003600978.1|  hypothetical protein MTR_3g071640                  163   2e-45   Medicago truncatula
gb|KJB74366.1|  hypothetical protein B456_011G290500                    162   4e-45   Gossypium raimondii
ref|XP_004148171.1|  PREDICTED: uncharacterized protein LOC101220308    162   4e-45   
ref|XP_007163579.1|  hypothetical protein PHAVU_001G246100g             162   6e-45   Phaseolus vulgaris [French bean]
gb|KHN31307.1|  hypothetical protein glysoja_022961                     163   2e-44   Glycine soja [wild soybean]
ref|XP_008454838.1|  PREDICTED: uncharacterized protein LOC103495149    160   2e-44   Cucumis melo [Oriental melon]
ref|XP_007008865.1|  Leucine-rich repeat and IQ domain-containing...    160   2e-44   
gb|KDP44701.1|  hypothetical protein JCGZ_01201                         159   8e-44   Jatropha curcas
ref|XP_006411288.1|  hypothetical protein EUTSA_v10017062mg             156   1e-43   Eutrema salsugineum [saltwater cress]
gb|KCW65717.1|  hypothetical protein EUGRSUZ_G03091                     154   9e-43   Eucalyptus grandis [rose gum]
ref|XP_006411289.1|  hypothetical protein EUTSA_v10017062mg             156   9e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002273745.2|  PREDICTED: uncharacterized protein LOC100255420    155   2e-42   Vitis vinifera
gb|KCW65716.1|  hypothetical protein EUGRSUZ_G03091                     153   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010067562.1|  PREDICTED: uncharacterized protein LOC104454422    153   2e-41   Eucalyptus grandis [rose gum]
emb|CDY18864.1|  BnaC04g04860D                                          152   2e-41   Brassica napus [oilseed rape]
gb|EPS63394.1|  hypothetical protein M569_11391                         149   3e-41   Genlisea aurea
ref|XP_011003078.1|  PREDICTED: uncharacterized protein LOC105109...    152   5e-41   Populus euphratica
ref|XP_002879864.1|  hypothetical protein ARALYDRAFT_903321             151   8e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010264548.1|  PREDICTED: uncharacterized protein LOC104602...    149   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008233814.1|  PREDICTED: uncharacterized protein LOC103332...    150   1e-40   Prunus mume [ume]
ref|XP_010264547.1|  PREDICTED: uncharacterized protein LOC104602...    149   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008233813.1|  PREDICTED: uncharacterized protein LOC103332...    149   3e-40   Prunus mume [ume]
ref|XP_010264546.1|  PREDICTED: uncharacterized protein LOC104602...    149   7e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006294774.1|  hypothetical protein CARUB_v10023827mg             147   7e-40   Capsella rubella
ref|XP_009369219.1|  PREDICTED: uncharacterized protein LOC103958...    147   1e-39   Pyrus x bretschneideri [bai li]
ref|NP_001078029.1|  uncharacterized protein                            145   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAX55150.1|  hypothetical protein At2g40316                          145   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAO86846.1|  hypothetical protein                                    145   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009369218.1|  PREDICTED: uncharacterized protein LOC103958...    147   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_006294775.1|  hypothetical protein CARUB_v10023827mg             146   5e-39   Capsella rubella
ref|XP_009345387.1|  PREDICTED: uncharacterized protein LOC103937190    146   7e-39   Pyrus x bretschneideri [bai li]
gb|AAY82253.1|  hypothetical protein At2g40316                          143   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505758.1|  PREDICTED: uncharacterized protein LOC104782...    143   2e-38   Camelina sativa [gold-of-pleasure]
ref|NP_181562.4|  uncharacterized protein                               145   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692932.1|  PREDICTED: uncharacterized protein LOC104905961    145   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009143226.1|  PREDICTED: uncharacterized protein LOC103866...    143   3e-38   Brassica rapa
ref|XP_004173078.1|  PREDICTED: uncharacterized protein LOC101226795    139   4e-38   
ref|XP_010534619.1|  PREDICTED: uncharacterized protein LOC104810122    144   6e-38   Tarenaya hassleriana [spider flower]
ref|XP_010505757.1|  PREDICTED: uncharacterized protein LOC104782...    143   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009143225.1|  PREDICTED: uncharacterized protein LOC103866...    143   9e-38   Brassica rapa
ref|XP_004307687.1|  PREDICTED: uncharacterized protein LOC101315282    143   1e-37   Fragaria vesca subsp. vesca
ref|XP_010508882.1|  PREDICTED: uncharacterized protein LOC104785...    141   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010508881.1|  PREDICTED: uncharacterized protein LOC104785...    140   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008804113.1|  PREDICTED: uncharacterized protein LOC103717...    137   2e-36   Phoenix dactylifera
ref|XP_008363772.1|  PREDICTED: uncharacterized protein LOC103427...    139   2e-36   
ref|XP_008363771.1|  PREDICTED: uncharacterized protein LOC103427...    138   6e-36   
ref|XP_008804111.1|  PREDICTED: uncharacterized protein LOC103717...    137   1e-35   Phoenix dactylifera
ref|XP_006847437.1|  hypothetical protein AMTR_s00153p00085570          137   2e-35   
gb|KFK36924.1|  hypothetical protein AALP_AA4G190300                    137   2e-35   Arabis alpina [alpine rockcress]
ref|XP_006435816.1|  hypothetical protein CICLE_v10032369mg             135   1e-34   Citrus clementina [clementine]
ref|XP_007008868.1|  Leucine-rich repeat and IQ domain-containing...    132   1e-33   
ref|XP_002311247.2|  hypothetical protein POPTR_0008s07320g             132   4e-33   
gb|AAD25948.1|AF085279_21  hypothetical protein                         125   2e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74798.1|  BnaA05g05440D                                          126   3e-31   
ref|XP_009416304.1|  PREDICTED: uncharacterized protein LOC103996952    125   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010517450.1|  PREDICTED: uncharacterized protein LOC104792...    120   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010517449.1|  PREDICTED: uncharacterized protein LOC104792...    119   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010921016.1|  PREDICTED: uncharacterized protein LOC105044726    119   9e-29   Elaeis guineensis
ref|XP_007219770.1|  hypothetical protein PRUPE_ppa025595mg             116   2e-28   
ref|XP_003558130.1|  PREDICTED: uncharacterized protein LOC100823098    113   1e-26   Brachypodium distachyon [annual false brome]
dbj|BAJ90180.1|  predicted protein                                      110   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006651281.1|  PREDICTED: uncharacterized protein LOC102717143    109   2e-24   Oryza brachyantha
ref|XP_007008869.1|  Leucine-rich repeat and IQ domain-containing...    105   1e-23   
ref|NP_001183686.1|  uncharacterized protein LOC100502280 precursor     102   2e-22   Zea mays [maize]
ref|XP_010087539.1|  hypothetical protein L484_006944                   100   4e-22   
emb|CAN76264.1|  hypothetical protein VITISV_001854                     101   5e-22   Vitis vinifera
ref|NP_001049832.1|  Os03g0296700                                       100   6e-22   
gb|AFK44428.1|  unknown                                                 100   7e-22   Lotus japonicus
ref|XP_004984880.1|  PREDICTED: uncharacterized protein LOC101783...  99.4    2e-21   
ref|XP_008343653.1|  PREDICTED: uncharacterized protein LOC103406452  88.6    1e-17   
ref|XP_008374955.1|  PREDICTED: uncharacterized protein LOC103438201  80.1    8e-15   
gb|EMT00564.1|  hypothetical protein F775_08095                       79.3    2e-14   
ref|XP_002979286.1|  hypothetical protein SELMODRAFT_110390           78.2    2e-14   
gb|ACU20834.1|  unknown                                               77.0    1e-13   Glycine max [soybeans]
ref|XP_001759768.1|  predicted protein                                74.3    6e-13   
ref|XP_001756445.1|  predicted protein                                76.3    9e-13   
ref|XP_008647628.1|  PREDICTED: uncharacterized protein LOC100502...  73.2    5e-12   Zea mays [maize]
gb|EEE58880.1|  hypothetical protein OsJ_10490                        69.3    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75047.1|  hypothetical protein OsI_11153                        69.3    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_002520790.1|  conserved hypothetical protein                   63.9    2e-09   
ref|XP_007008866.1|  Leucine-rich repeat and IQ domain-containing...  62.8    7e-09   
ref|XP_011003184.1|  PREDICTED: uncharacterized protein LOC105109...  60.5    4e-08   Populus euphratica
dbj|GAD91664.1|  vacuolar sorting receptor (Mrl1), putative           59.7    3e-07   Byssochlamys spectabilis No. 5
ref|XP_006819098.1|  PREDICTED: uncharacterized protein LOC102807910  55.5    4e-06   Saccoglossus kowalevskii
dbj|BAE54833.1|  unnamed protein product                              55.8    5e-06   Aspergillus oryzae RIB40
gb|EIT72508.1|  cation-independent mannose-6-phosphate receptor C...  55.8    5e-06   Aspergillus oryzae 3.042
ref|XP_001816835.2|  vacuolar sorting receptor (Mrl1)                 55.8    5e-06   
ref|XP_002383235.1|  vacuolar sorting receptor (Mrl1), putative       55.8    5e-06   Aspergillus flavus NRRL3357
ref|XP_001212231.1|  conserved hypothetical protein                   55.1    9e-06   Aspergillus terreus NIH2624
ref|XP_001265096.1|  vacuolar sorting receptor (Mrl1), putative       53.9    2e-05   Aspergillus fischeri NRRL 181
dbj|GAM39181.1|  hypothetical protein TCE0_034f10514                  53.5    3e-05   Talaromyces cellulolyticus
ref|XP_002480488.1|  vacuolar sorting receptor (Mrl1), putative       53.5    3e-05   Talaromyces stipitatus ATCC 10500
ref|XP_002542561.1|  conserved hypothetical protein                   52.4    3e-05   Uncinocarpus reesii 1704
ref|XP_001269587.1|  vacuolar sorting receptor (Mrl1), putative       53.5    3e-05   Aspergillus clavatus NRRL 1
ref|XP_008197150.1|  PREDICTED: uncharacterized protein LOC103314060  52.4    5e-05   Tribolium castaneum [rust-red flour beetle]
emb|CDH52540.1|  autophagy protein atg27                              52.4    7e-05   Lichtheimia corymbifera JMRC:FSU:9682
gb|KFX50812.1|  putative mannose 6-phosphate receptor-like protein    52.4    7e-05   Talaromyces marneffei PM1
ref|XP_002144095.1|  vacuolar sorting receptor (Mrl1), putative       52.4    7e-05   Talaromyces marneffei ATCC 18224
gb|KIL71248.1|  hypothetical protein M378DRAFT_154764                 52.0    1e-04   Amanita muscaria Koide BX008
emb|CEI91741.1|  hypothetical protein RMCBS344292_06022               51.6    2e-04   Rhizopus microsporus
gb|KDO68854.1|  hypothetical protein CISIN_1g037714mg                 50.4    2e-04   Citrus sinensis [apfelsine]
gb|EHJ65657.1|  hypothetical protein KGM_06525                        51.2    2e-04   
emb|CEG71777.1|  hypothetical protein RMATCC62417_07449               51.2    2e-04   Rhizopus microsporus
emb|CEI92604.1|  hypothetical protein RMCBS344292_06858               51.2    2e-04   Rhizopus microsporus
gb|EPB85865.1|  hypothetical protein HMPREF1544_07364                 50.8    2e-04   Mucor circinelloides f. circinelloides 1006PhL
gb|ELU12794.1|  hypothetical protein CAPTEDRAFT_127669                49.7    2e-04   Capitella teleta
ref|XP_750322.1|  vacuolar sorting receptor (Mrl1)                    50.8    3e-04   Aspergillus fumigatus Af293
ref|XP_007579807.1|  putative vacuolar sorting receptor protein       50.4    3e-04   
gb|KDQ57471.1|  hypothetical protein JAAARDRAFT_177653                50.4    4e-04   Jaapia argillacea MUCL 33604
ref|XP_009067010.1|  hypothetical protein LOTGIDRAFT_134805           48.9    4e-04   Lottia gigantea
gb|EEQ83764.1|  vacuolar sorting receptor                             50.1    4e-04   Blastomyces dermatitidis ER-3
gb|EQL29309.1|  hypothetical protein BDFG_08039                       50.1    4e-04   Blastomyces dermatitidis ATCC 26199
ref|XP_002625151.1|  vacuolar sorting receptor                        50.1    4e-04   Blastomyces gilchristii SLH14081
gb|EGE80100.1|  vacuolar sorting receptor                             50.1    4e-04   Blastomyces dermatitidis ATCC 18188
gb|EZF30130.1|  hypothetical protein H101_06229                       50.1    4e-04   Trichophyton interdigitale H6
gb|EKG17326.1|  Mannose-6-phosphate receptor binding protein          49.3    8e-04   Macrophomina phaseolina MS6
emb|CDS08563.1|  hypothetical protein LRAMOSA09924                    48.9    0.001   Lichtheimia ramosa
gb|KIV88105.1|  hypothetical protein, variant                         48.9    0.001   Exophiala mesophila
ref|XP_001244449.1|  hypothetical protein CIMG_03890                  49.3    0.001   



>ref|XP_011076650.1| PREDICTED: uncharacterized protein LOC105160850 [Sesamum indicum]
Length=284

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQTLE VG CD++TEL+HP GC  +IS+ G GLGWFGT +IIILCLFGAYLL G +YRY
Sbjct  174  GPQTLETVGFCDYSTELKHPLGCAKIISSHGNGLGWFGTFMIIILCLFGAYLLAGAVYRY  233

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            +FLHIRGID+IPNLEFW+SLPH++QS+F S+ +RFRGPSQ +RS+YSPV F
Sbjct  234  YFLHIRGIDVIPNLEFWASLPHRIQSFFLSLVRRFRGPSQGYRSSYSPVNF  284



>emb|CDP13970.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP+ LEKVGTCD+ T+LRHP+GC  VIS+ G G GWFGT L+IILCLFGAYLL G++YRY
Sbjct  183  GPRMLEKVGTCDYVTQLRHPAGCAKVISSHGSGWGWFGTFLVIILCLFGAYLLAGVVYRY  242

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL+I GID IPNLEFW+++PHKVQS+F ++ +RFRGPSQ +RS+YSPV F
Sbjct  243  FFLNIHGIDAIPNLEFWATVPHKVQSFFVALVRRFRGPSQGYRSSYSPVNF  293



>ref|XP_009776957.1| PREDICTED: uncharacterized protein LOC104226625 isoform X2 [Nicotiana 
sylvestris]
Length=213

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P+TLE VGTCD+AT++ HPSGC  +IS+ G+G+GWFGT++IIILCLFG YLLGG  YRYF
Sbjct  104  PRTLELVGTCDYATQIHHPSGCAMIISSHGQGMGWFGTMMIIILCLFGVYLLGGAAYRYF  163

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
             L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS+YSPV F
Sbjct  164  SLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRFRGPSHGHRSSYSPVNF  213



>ref|XP_009591922.1| PREDICTED: uncharacterized protein LOC104088879 isoform X2 [Nicotiana 
tomentosiformis]
Length=213

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP+TLE VGTC +ATE+ HPSGC  +IS+ G+G+GWFGT++IIILCLFG YLLGG  YRY
Sbjct  103  GPRTLELVGTCAYATEIHHPSGCAVIISSHGQGMGWFGTMMIIILCLFGIYLLGGAAYRY  162

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRSTYSPV F
Sbjct  163  FSLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRFRGPSHGHRSTYSPVNF  213



>ref|XP_009591921.1| PREDICTED: uncharacterized protein LOC104088879 isoform X1 [Nicotiana 
tomentosiformis]
Length=283

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP+TLE VGTC +ATE+ HPSGC  +IS+ G+G+GWFGT++IIILCLFG YLLGG  YRY
Sbjct  173  GPRTLELVGTCAYATEIHHPSGCAVIISSHGQGMGWFGTMMIIILCLFGIYLLGGAAYRY  232

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRSTYSPV F
Sbjct  233  FSLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRFRGPSHGHRSTYSPVNF  283



>ref|XP_009776956.1| PREDICTED: uncharacterized protein LOC104226625 isoform X1 [Nicotiana 
sylvestris]
Length=283

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P+TLE VGTCD+AT++ HPSGC  +IS+ G+G+GWFGT++IIILCLFG YLLGG  YRYF
Sbjct  174  PRTLELVGTCDYATQIHHPSGCAMIISSHGQGMGWFGTMMIIILCLFGVYLLGGAAYRYF  233

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
             L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS+YSPV F
Sbjct  234  SLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRFRGPSHGHRSSYSPVNF  283



>gb|EYU20061.1| hypothetical protein MIMGU_mgv1a011365mg [Erythranthe guttata]
Length=284

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQ LE  GTCD+ TEL+HP GC   IS+ G G GWFGT +IIILCL G YLL G  YRY
Sbjct  174  GPQKLETNGTCDYTTELKHPLGCAKTISSGGNGWGWFGTFMIIILCLSGGYLLAGAGYRY  233

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFLH+RGID+IPNLEFW+SLPH +Q+ FQS+ +RFRGPSQ +RS+YSPV F
Sbjct  234  FFLHVRGIDVIPNLEFWASLPHTIQTLFQSLVRRFRGPSQGYRSSYSPVNF  284



>ref|XP_006591393.1| PREDICTED: uncharacterized protein LOC100809288 [Glycine max]
Length=278

 Score =   169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP+TLE++G CD+ TEL+HPSGC  +++  G GLGWFGTLLII+LCLF AYLL G++YR+
Sbjct  168  GPRTLERLGACDYVTELKHPSGCAIIVNVHGGGLGWFGTLLIIVLCLFAAYLLAGIVYRF  227

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRGIDIIPNL+FW SLP + QS   S+A++F+GPS+ HRSTYSPV F
Sbjct  228  FFLGIRGIDIIPNLDFWVSLPRRTQSLCASLARKFKGPSEGHRSTYSPVNF  278



>gb|KHN04787.1| hypothetical protein glysoja_031887 [Glycine soja]
Length=259

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP+TLE++G CD+ TEL+HPSGC  +++  G GLGWFGTLLII+LCLF AYLL G++YR+
Sbjct  149  GPRTLERLGACDYVTELKHPSGCAIIVNVHGGGLGWFGTLLIIVLCLFAAYLLAGIVYRF  208

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRGIDIIPNL+FW SLP + QS   S+ ++F+GPS+ HRSTYSPV F
Sbjct  209  FFLGIRGIDIIPNLDFWVSLPRRTQSLCASLGRKFKGPSEGHRSTYSPVNF  259



>ref|XP_004239953.1| PREDICTED: uncharacterized protein LOC101260820 [Solanum lycopersicum]
Length=283

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQTLE VGTCD+AT++ HPSGC  +IS+ G G+GWFGT+LI+IL   G YLLGG +YRY
Sbjct  171  GPQTLELVGTCDYATKIHHPSGCALIISSHGNGMGWFGTMLILILFFLGVYLLGGAVYRY  230

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            + L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS+YSPV F
Sbjct  231  YSLGIRGIDIIPNLEFWASLPHTLQSSFTSLVRRFRGPSHGHRSSYSPVNF  281



>ref|XP_006355642.1| PREDICTED: uncharacterized protein LOC102579236 isoform X2 [Solanum 
tuberosum]
Length=213

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQTLE VGTCD+AT++ HPSGC  +IS+   G+GWFGT+LI+IL  FG YL+GG +YRY
Sbjct  103  GPQTLELVGTCDYATKIHHPSGCALIISSHRNGMGWFGTMLILILFFFGVYLVGGAVYRY  162

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            + L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS+YSPV F
Sbjct  163  YSLGIRGIDIIPNLEFWASLPHTLQSSFTSLVRRFRGPSHGHRSSYSPVNF  213



>gb|KEH34808.1| autophagy-related protein [Medicago truncatula]
Length=201

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQTLE+ G C++ATEL+HPSGC  ++   G G GWFGTLL+I+LCLF AYLL G++YRY
Sbjct  91   GPQTLERSGDCNYATELKHPSGCAMIVHVHGSGWGWFGTLLVIVLCLFAAYLLAGIVYRY  150

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRG ++IPNL+ W+SLP + QS   S+ ++F+GPS+ HRSTYSPV F
Sbjct  151  FFLKIRGTEVIPNLDLWTSLPRRTQSLCSSVVRKFKGPSEGHRSTYSPVNF  201



>ref|XP_006355641.1| PREDICTED: uncharacterized protein LOC102579236 isoform X1 [Solanum 
tuberosum]
Length=283

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQTLE VGTCD+AT++ HPSGC  +IS+   G+GWFGT+LI+IL  FG YL+GG +YRY
Sbjct  173  GPQTLELVGTCDYATKIHHPSGCALIISSHRNGMGWFGTMLILILFFFGVYLVGGAVYRY  232

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            + L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS+YSPV F
Sbjct  233  YSLGIRGIDIIPNLEFWASLPHTLQSSFTSLVRRFRGPSHGHRSSYSPVNF  283



>gb|KJB74365.1| hypothetical protein B456_011G290500 [Gossypium raimondii]
Length=201

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP ++EK+GTCD+AT LRHPSGC  +IS  GKG GWFGTL+III+CLFGAYLL G +YRY
Sbjct  91   GPDSVEKLGTCDYATTLRHPSGCATIISIGGKGFGWFGTLIIIIICLFGAYLLAGTVYRY  150

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            FFL + GI+ IPNL+ W+SLPH+ Q +F S+ ++F GPS  HR++YSPV 
Sbjct  151  FFLGVHGIEAIPNLDLWASLPHRTQIFFSSLVRQFSGPSTSHRNSYSPVN  200



>gb|KHG25155.1| Autophagy-related 27 [Gossypium arboreum]
Length=279

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP ++EK+GTCD+AT LRHPSGC  VIS  GKG GWFGTLLIII+CLFGAYLL G +YRY
Sbjct  169  GPDSVEKLGTCDYATTLRHPSGCATVISIGGKGFGWFGTLLIIIICLFGAYLLAGTVYRY  228

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            FFL + GI+ +PNL+ W+SLPH+ Q +F S+ ++F GPS  HR++YSPV 
Sbjct  229  FFLGVYGIEAVPNLDLWASLPHRTQIFFSSLVRQFSGPSTSHRNSYSPVN  278



>ref|XP_007008867.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 3 [Theobroma cacao]
 gb|EOY17677.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 3 [Theobroma cacao]
Length=201

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ IILCLFGAYLL G +YR+
Sbjct  91   GPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTIILCLFGAYLLAGTVYRF  150

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL +RG+++IPNLEFW+SL H+ QS+F S+ ++F GPS  HRS+YS V F
Sbjct  151  FFLGVRGVEVIPNLEFWASLQHRTQSFFSSLVRKFSGPSAGHRSSYSRVNF  201



>ref|XP_003600978.1| hypothetical protein MTR_3g071640 [Medicago truncatula]
 gb|AES71229.1| autophagy-related protein [Medicago truncatula]
Length=284

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQTLE+ G C++ATEL+HPSGC  ++   G G GWFGTLL+I+LCLF AYLL G++YRY
Sbjct  174  GPQTLERSGDCNYATELKHPSGCAMIVHVHGSGWGWFGTLLVIVLCLFAAYLLAGIVYRY  233

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRG ++IPNL+ W+SLP + QS   S+ ++F+GPS+ HRSTYSPV F
Sbjct  234  FFLKIRGTEVIPNLDLWTSLPRRTQSLCSSVVRKFKGPSEGHRSTYSPVNF  284



>gb|KJB74366.1| hypothetical protein B456_011G290500 [Gossypium raimondii]
Length=279

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP ++EK+GTCD+AT LRHPSGC  +IS  GKG GWFGTL+III+CLFGAYLL G +YRY
Sbjct  169  GPDSVEKLGTCDYATTLRHPSGCATIISIGGKGFGWFGTLIIIIICLFGAYLLAGTVYRY  228

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            FFL + GI+ IPNL+ W+SLPH+ Q +F S+ ++F GPS  HR++YSPV 
Sbjct  229  FFLGVHGIEAIPNLDLWASLPHRTQIFFSSLVRQFSGPSTSHRNSYSPVN  278



>ref|XP_004148171.1| PREDICTED: uncharacterized protein LOC101220308 [Cucumis sativus]
 gb|KGN50697.1| hypothetical protein Csa_5G217160 [Cucumis sativus]
Length=281

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQ LEK+G CD+AT LRHPSGC  ++    +G G+FGT  IIILCLFG YLL G++YRY
Sbjct  171  GPQILEKIGPCDYATSLRHPSGCAKIVHVHRRGWGFFGTFTIIILCLFGGYLLAGIVYRY  230

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L +RG+D+IPNLEFW SLPHK+QS F S+ ++F+GPS+ HR +YSPV F
Sbjct  231  FVLKVRGVDVIPNLEFWLSLPHKIQSLFASLVRKFKGPSRGHRDSYSPVNF  281



>ref|XP_007163579.1| hypothetical protein PHAVU_001G246100g [Phaseolus vulgaris]
 gb|ESW35573.1| hypothetical protein PHAVU_001G246100g [Phaseolus vulgaris]
Length=290

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQ +E++G CD+  EL+HPSGC  +++  G GLGWFGTLLII+LCLF AYLL G++YR+
Sbjct  180  GPQAMERLGACDYVIELKHPSGCAIIVNVHGGGLGWFGTLLIIVLCLFAAYLLAGIVYRF  239

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRG+DIIPNL+FW SLP + QS   S+ +RF+GPS+ +RS+YSPV F
Sbjct  240  FFLGIRGVDIIPNLDFWVSLPRRTQSLCASLVRRFKGPSESYRSSYSPVNF  290



>gb|KHN31307.1| hypothetical protein glysoja_022961 [Glycine soja]
Length=356

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQ LE++G CD+ TEL+HPSGC  +I+  G G GWFGTLLII+LCLF AYLL G++YR+
Sbjct  246  GPQALERLGACDYVTELKHPSGCAIIINVHGGGWGWFGTLLIIVLCLFAAYLLAGIVYRF  305

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRGIDIIPNL+FW SLP + QS   S+ ++F+GPS+ +RS+YSPV F
Sbjct  306  FFLGIRGIDIIPNLDFWVSLPRRTQSLCTSLVRKFKGPSEGYRSSYSPVNF  356



>ref|XP_008454838.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
 ref|XP_008454839.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
 ref|XP_008454840.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
Length=281

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            PQ LEK+G CD+AT LRHPSGC  +I    +G G+FGT  IIILCLFG YLL G++YRYF
Sbjct  172  PQILEKIGPCDYATSLRHPSGCAKIIHVHRRGWGFFGTFTIIILCLFGGYLLAGIVYRYF  231

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
             L +RG+D+IPNLEFW SLPHK+QS F S+ ++F+GPS+ HR +YSPV F
Sbjct  232  VLKVRGVDVIPNLEFWLSLPHKIQSLFASLVRKFKGPSRGHRDSYSPVNF  281



>ref|XP_007008865.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 1 [Theobroma cacao]
 gb|EOY17675.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 1 [Theobroma cacao]
Length=282

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ IILCLFGAYLL G +YR+
Sbjct  172  GPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTIILCLFGAYLLAGTVYRF  231

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL +RG+++IPNLEFW+SL H+ QS+F S+ ++F GPS  HRS+YS V F
Sbjct  232  FFLGVRGVEVIPNLEFWASLQHRTQSFFSSLVRKFSGPSAGHRSSYSRVNF  282



>gb|KDP44701.1| hypothetical protein JCGZ_01201 [Jatropha curcas]
Length=287

 Score =   159 bits (402),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP++LEK+GTCD+AT ++HPSGC  V+S  G G GWF TLLIIILCLFG Y+L G  YRY
Sbjct  177  GPESLEKLGTCDYATVMQHPSGCAMVVSVHGNGWGWFVTLLIIILCLFGGYMLVGAAYRY  236

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRG+D+IPNL+ W+ LP + QS+F S+ ++FRGP++ +RS+YSPV F
Sbjct  237  FFLGIRGLDMIPNLDIWARLPQRTQSFFASLVRKFRGPTEGYRSSYSPVNF  287



>ref|XP_006411288.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
 gb|ESQ52741.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
Length=214

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P TLEK GTC +ATELRHPSGC   IS  G G GWF TLLIIILCLFGAYLLGG++YRYF
Sbjct  105  PLTLEKSGTCHYATELRHPSGCAAAISGHGSGWGWFSTLLIIILCLFGAYLLGGVLYRYF  164

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
             L IRG D+IPNL+FW+++PH+ QS F S+ QRF G S   R++YS V F
Sbjct  165  SLGIRGTDVIPNLDFWATVPHRTQSCFGSLFQRFGGSSHGQRTSYSQVNF  214



>gb|KCW65717.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=205

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK GTCD+AT LRHPSGC  +I   G G GWFG LLII LCLFG YLL G +YRY
Sbjct  95   GPNLLEKSGTCDYATSLRHPSGCAKIIYVHGHGWGWFGILLIISLCLFGGYLLAGTVYRY  154

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L + GID IPNLEFW+SLPH+ Q    S+ Q+FRGPS+ +RS+Y+ V F
Sbjct  155  FMLGVHGIDAIPNLEFWASLPHRTQGLVMSLVQKFRGPSEGYRSSYTSVGF  205



>ref|XP_006411289.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
 gb|ESQ52742.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
Length=276

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P TLEK GTC +ATELRHPSGC   IS  G G GWF TLLIIILCLFGAYLLGG++YRYF
Sbjct  167  PLTLEKSGTCHYATELRHPSGCAAAISGHGSGWGWFSTLLIIILCLFGAYLLGGVLYRYF  226

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
             L IRG D+IPNL+FW+++PH+ QS F S+ QRF G S   R++YS V F
Sbjct  227  SLGIRGTDVIPNLDFWATVPHRTQSCFGSLFQRFGGSSHGQRTSYSQVNF  276



>ref|XP_002273745.2| PREDICTED: uncharacterized protein LOC100255420 [Vitis vinifera]
 emb|CBI25422.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LE+ GTCD+ATE+RHPSGC  ++S  G+GLGWF T LII+ C  G YLL G +YR+
Sbjct  169  GPYSLEQSGTCDYATEMRHPSGCAEIVSVHGRGLGWFSTFLIILFCFLGVYLLVGTVYRF  228

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL +RG+DIIPNL FW+SLP + QS   S+ ++FRGPSQ HR +YS V F
Sbjct  229  FFLGVRGVDIIPNLGFWTSLPQRTQSSCASLVRKFRGPSQGHRDSYSAVNF  279



>gb|KCW65716.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=205

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK GTCD+AT LRHPSGC  +I   G G GWFG LLII LCLFG YLL G +YRY
Sbjct  95   GPNLLEKSGTCDYATSLRHPSGCAKIIYVHGHGWGWFGILLIISLCLFGGYLLAGTVYRY  154

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L + GID IPNLEFW+SLPH+ Q    S+ Q+FRGPS+ +RS+Y+ V F
Sbjct  155  FMLGVHGIDAIPNLEFWASLPHRTQGLVMSLVQKFRGPSEGYRSSYTSVGF  205



>ref|XP_010067562.1| PREDICTED: uncharacterized protein LOC104454422 [Eucalyptus grandis]
 gb|KCW65715.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=282

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK GTCD+AT LRHPSGC  +I   G G GWFG LLII LCLFG YLL G +YRY
Sbjct  172  GPNLLEKSGTCDYATSLRHPSGCAKIIYVHGHGWGWFGILLIISLCLFGGYLLAGTVYRY  231

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L + GID IPNLEFW+SLPH+ Q    S+ Q+FRGPS+ +RS+Y+ V F
Sbjct  232  FMLGVHGIDAIPNLEFWASLPHRTQGLVMSLVQKFRGPSEGYRSSYTSVGF  282



>emb|CDY18864.1| BnaC04g04860D [Brassica napus]
Length=275

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTCD+ATELRHPSGC   IS  G G GWF TLLIIILCLFGAYLLGG +YRY
Sbjct  166  GPLTLTKSGTCDYATELRHPSGCAVAISGHGSGWGWFSTLLIIILCLFGAYLLGGSLYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            F L IRGI++IPN +FW ++PH++QS F S+ QRFRG S   +++YS V 
Sbjct  226  FSLGIRGIEVIPNSDFWVTVPHRIQSCFGSLFQRFRGSSHGQQASYSRVN  275



>gb|EPS63394.1| hypothetical protein M569_11391, partial [Genlisea aurea]
Length=190

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP+TLE  G C+++TE++HP GC  + S    G GWFGTL+IIILCLFGAYL+ G +YR+
Sbjct  78   GPRTLEVHGPCEYSTEIKHPLGCAKITSHDRSGFGWFGTLMIIILCLFGAYLVAGAVYRH  137

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFR--GPSQHHRSTYSPVEF  357
            F LH+RG+D+IP+LE W+SLPH VQS FQS  +R    GPS  HRS+YSPV F
Sbjct  138  FVLHVRGLDVIPHLELWTSLPHTVQSCFQSSMRRLSGGGPSHVHRSSYSPVNF  190



>ref|XP_011003078.1| PREDICTED: uncharacterized protein LOC105109879 isoform X1 [Populus 
euphratica]
Length=283

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK+GTCD+A  L+HPSGC   I+  GKG GWFGTL+I + CLFG YLL G +YR+
Sbjct  174  GPHSLEKLGTCDYAAVLQHPSGCA-TINGHGKGWGWFGTLMITVFCLFGGYLLAGAVYRH  232

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F+L + G+D+IPNL+FW+ LPH+ Q +F S+ +RFRGP++ +R++YSPV F
Sbjct  233  FYLGVHGLDMIPNLDFWTRLPHRTQGFFASLVRRFRGPTEGYRNSYSPVNF  283



>ref|XP_002879864.1| hypothetical protein ARALYDRAFT_903321 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56123.1| hypothetical protein ARALYDRAFT_903321 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLIIILCLFGAYLLGG +YRY
Sbjct  166  GPLTLAKSGTCHYATQLRHPSGCAAAISGHSSGWGWFSTLLIIILCLFGAYLLGGAVYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGID+IPN+++W+++PH VQS F S+  RF G S+  R++YS V F
Sbjct  226  FSLGIRGIDVIPNVDYWATVPHSVQSCFGSLFSRFGGSSRGQRTSYSQVNF  276



>ref|XP_010264548.1| PREDICTED: uncharacterized protein LOC104602522 isoform X3 [Nelumbo 
nucifera]
Length=230

 Score =   149 bits (377),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK GTCD+AT L+HP+GC  +IS   +G GW GT++ IILCL G YLL G +YR+
Sbjct  120  GPYSLEKSGTCDYATILKHPAGCAKIISVHRRGWGWLGTIITIILCLLGGYLLVGAVYRF  179

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRGI++IPNLEFW SLP + +S   S+ ++FRGPS+ +RS+YSPV F
Sbjct  180  FFLGIRGIEVIPNLEFWLSLPQRTKSLLGSLVRKFRGPSRGYRSSYSPVNF  230



>ref|XP_008233814.1| PREDICTED: uncharacterized protein LOC103332832 isoform X2 [Prunus 
mume]
Length=261

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK G CD+AT L HPSGC  V+   G G GWFGTL  I+LCLFGAYLL G +YRY
Sbjct  150  GPHSLEKTGKCDYATVLTHPSGCAKVVHVHGHGWGWFGTLGTIVLCLFGAYLLAGAVYRY  209

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRG-PSQHHRSTYSPVEF  357
            F L +RGI +IPNL+FW+SLP + QS F S+ ++FRG  SQ HRS+YSPV F
Sbjct  210  FSLGVRGIHVIPNLDFWTSLPQRTQSLFASLLRKFRGSSSQGHRSSYSPVNF  261



>ref|XP_010264547.1| PREDICTED: uncharacterized protein LOC104602522 isoform X2 [Nelumbo 
nucifera]
Length=262

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK GTCD+AT L+HP+GC  +IS   +G GW GT++ IILCL G YLL G +YR+
Sbjct  152  GPYSLEKSGTCDYATILKHPAGCAKIISVHRRGWGWLGTIITIILCLLGGYLLVGAVYRF  211

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRGI++IPNLEFW SLP + +S   S+ ++FRGPS+ +RS+YSPV F
Sbjct  212  FFLGIRGIEVIPNLEFWLSLPQRTKSLLGSLVRKFRGPSRGYRSSYSPVNF  262



>ref|XP_008233813.1| PREDICTED: uncharacterized protein LOC103332832 isoform X1 [Prunus 
mume]
Length=279

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK G CD+AT L HPSGC  V+   G G GWFGTL  I+LCLFGAYLL G +YRY
Sbjct  168  GPHSLEKTGKCDYATVLTHPSGCAKVVHVHGHGWGWFGTLGTIVLCLFGAYLLAGAVYRY  227

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRG-PSQHHRSTYSPVEF  357
            F L +RGI +IPNL+FW+SLP + QS F S+ ++FRG  SQ HRS+YSPV F
Sbjct  228  FSLGVRGIHVIPNLDFWTSLPQRTQSLFASLLRKFRGSSSQGHRSSYSPVNF  279



>ref|XP_010264546.1| PREDICTED: uncharacterized protein LOC104602522 isoform X1 [Nelumbo 
nucifera]
Length=280

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK GTCD+AT L+HP+GC  +IS   +G GW GT++ IILCL G YLL G +YR+
Sbjct  170  GPYSLEKSGTCDYATILKHPAGCAKIISVHRRGWGWLGTIITIILCLLGGYLLVGAVYRF  229

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL IRGI++IPNLEFW SLP + +S   S+ ++FRGPS+ +RS+YSPV F
Sbjct  230  FFLGIRGIEVIPNLEFWLSLPQRTKSLLGSLVRKFRGPSRGYRSSYSPVNF  280



>ref|XP_006294774.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
 gb|EOA27672.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
Length=214

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLIIILCLFGAYL+ G +YRY
Sbjct  104  GPLTLVKSGTCHYATQLRHPSGCVAAISGHSSGWGWFSTLLIIILCLFGAYLVAGAMYRY  163

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L +RGID+IPN++FW+++PH+ QS F SI  RF G S+  R++YS V F
Sbjct  164  FSLGVRGIDVIPNVDFWATVPHRTQSCFGSIFSRFGGSSRGQRTSYSQVNF  214



>ref|XP_009369219.1| PREDICTED: uncharacterized protein LOC103958653 isoform X2 [Pyrus 
x bretschneideri]
Length=260

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK G CD+AT L HPSGC  +    GK  GWFGTL IIILCLFGAYLL G  YRY
Sbjct  150  GPHLLEKTGKCDYATVLTHPSGCAKIEHVHGKAWGWFGTLGIIILCLFGAYLLVGAAYRY  209

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
              L +RGI I+PNL+FW+SLP   QS F S+  +FRG S  HRSTYSPV+F
Sbjct  210  IKLGVRGIHIMPNLDFWTSLPQSTQSLFASLLHKFRGSSHGHRSTYSPVDF  260



>ref|NP_001078029.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09813.1| uncharacterized protein AT2G40316 [Arabidopsis thaliana]
Length=195

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLIIILCLFGAYL+GG +YRY
Sbjct  85   GPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLIIILCLFGAYLVGGAVYRY  144

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGID+IPN+++W+++PH +QS F S+  RF G  +  +++YS V F
Sbjct  145  FSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQQTSYSQVNF  195



>gb|AAX55150.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
Length=214

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLIIILCLFGAYL+GG +YRY
Sbjct  104  GPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLIIILCLFGAYLVGGAVYRY  163

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGID+IPN+++W+++PH +QS F S+  RF G  +  +++YS V F
Sbjct  164  FSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQQTSYSQVNF  214



>gb|AAO86846.1| hypothetical protein [Arabidopsis thaliana]
Length=214

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLIIILCLFGAYL+GG +YRY
Sbjct  104  GPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLIIILCLFGAYLVGGAVYRY  163

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGID+IPN+++W+++PH +QS F S+  RF G  +  +++YS V F
Sbjct  164  FSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQQTSYSQVNF  214



>ref|XP_009369218.1| PREDICTED: uncharacterized protein LOC103958653 isoform X1 [Pyrus 
x bretschneideri]
Length=278

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK G CD+AT L HPSGC  +    GK  GWFGTL IIILCLFGAYLL G  YRY
Sbjct  168  GPHLLEKTGKCDYATVLTHPSGCAKIEHVHGKAWGWFGTLGIIILCLFGAYLLVGAAYRY  227

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
              L +RGI I+PNL+FW+SLP   QS F S+  +FRG S  HRSTYSPV+F
Sbjct  228  IKLGVRGIHIMPNLDFWTSLPQSTQSLFASLLHKFRGSSHGHRSTYSPVDF  278



>ref|XP_006294775.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
 gb|EOA27673.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
Length=276

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLIIILCLFGAYL+ G +YRY
Sbjct  166  GPLTLVKSGTCHYATQLRHPSGCVAAISGHSSGWGWFSTLLIIILCLFGAYLVAGAMYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L +RGID+IPN++FW+++PH+ QS F SI  RF G S+  R++YS V F
Sbjct  226  FSLGVRGIDVIPNVDFWATVPHRTQSCFGSIFSRFGGSSRGQRTSYSQVNF  276



>ref|XP_009345387.1| PREDICTED: uncharacterized protein LOC103937190 [Pyrus x bretschneideri]
Length=278

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK G CD+AT L HPSGC  +    G+G GW GTL IIILCLFGAYLL G  YRY
Sbjct  168  GPHSLEKTGKCDYATVLTHPSGCAKIEHVHGRGWGWLGTLGIIILCLFGAYLLVGAGYRY  227

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
              L +RGI IIPNL+FW+SLP   QS F S+  +FRG S  HRSTYSPV+F
Sbjct  228  IKLGVRGIHIIPNLDFWTSLPQSTQSLFASLMHKFRGSSHGHRSTYSPVDF  278



>gb|AAY82253.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
Length=195

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC + T+LRHP+GC   IS    G GWF TLLIIILCLFGAYL+GG +YRY
Sbjct  85   GPLTLAKSGTCQYXTQLRHPAGCAAAISGHSSGWGWFSTLLIIILCLFGAYLVGGAVYRY  144

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGID+IPN+++W+++PH +QS F S+  RF G  +  +++YS V F
Sbjct  145  FSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQQTSYSQVNF  195



>ref|XP_010505758.1| PREDICTED: uncharacterized protein LOC104782507 isoform X2 [Camelina 
sativa]
Length=214

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLIIILCLFGAYLLGG  YRY
Sbjct  104  GPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWFSTLLIIILCLFGAYLLGGAAYRY  163

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F   IRGID+IPN++FW+++PH+ Q    SI  RF G S+  R++YS V F
Sbjct  164  FSFGIRGIDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQRTSYSQVNF  214



>ref|NP_181562.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY82252.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
 dbj|BAE99557.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09812.1| uncharacterized protein AT2G40316 [Arabidopsis thaliana]
Length=276

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLIIILCLFGAYL+GG +YRY
Sbjct  166  GPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLIIILCLFGAYLVGGAVYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRGID+IPN+++W+++PH +QS F S+  RF G  +  +++YS V F
Sbjct  226  FSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQQTSYSQVNF  276



>ref|XP_010692932.1| PREDICTED: uncharacterized protein LOC104905961 [Beta vulgaris 
subsp. vulgaris]
Length=297

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P+TL+K+GTC +ATELRHP+GC   I+A   G GWFG LL I+LC  GAYLL G +YR+ 
Sbjct  189  PETLKKLGTCHYATELRHPAGCPK-IAAHATGWGWFGILLTILLCSIGAYLLIGGVYRFS  247

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            +L IRG+D+IP+L+FW S+PH+++S F S+ QRFRGP+ HHRS+YS V F
Sbjct  248  YLGIRGLDVIPSLDFWISIPHRIKSVFMSLVQRFRGPTYHHRSSYSSVNF  297



>ref|XP_009143226.1| PREDICTED: uncharacterized protein LOC103866960 isoform X2 [Brassica 
rapa]
Length=226

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTCD+ATE+RHPSGC   IS  G G G F TL+IIILCLFGAYLLGG +YRY
Sbjct  117  GPFTLTKSGTCDYATEMRHPSGCAVAISGHGSGWGLFSTLVIIILCLFGAYLLGGALYRY  176

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            F L IRGI++IPN +FW ++PH++QS F S+ QRF G S   +++YS V 
Sbjct  177  FSLGIRGIEVIPNSDFWVTVPHRIQSCFGSLFQRFGGSSHGQQASYSRVN  226



>ref|XP_004173078.1| PREDICTED: uncharacterized protein LOC101226795, partial [Cucumis 
sativus]
Length=98

 Score =   139 bits (349),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  64   ATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPN  243
            AT LRHPSGC  ++    +G G+FGT  IIILCLFG YLL G++YRYF L +RG+D+IPN
Sbjct  1    ATSLRHPSGCAKIVHVHRRGWGFFGTFTIIILCLFGGYLLAGIVYRYFVLKVRGVDVIPN  60

Query  244  LEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            LEFW SLPHK+QS F S+ ++F+GPS+ HR +YSPV F
Sbjct  61   LEFWLSLPHKIQSLFASLVRKFKGPSRGHRDSYSPVNF  98



>ref|XP_010534619.1| PREDICTED: uncharacterized protein LOC104810122 [Tarenaya hassleriana]
Length=276

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK G C +ATELRHPSGC   +S  G G GWFGTLLIIILCLFGAY L G +YRY
Sbjct  166  GPIKLEKSGACHYATELRHPSGCASAVSGHGGGWGWFGTLLIIILCLFGAYFLAGAVYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
              L +RGID+IPNL+FW+++P  +QS F S+ QR RGPS  HRS+YSPV F
Sbjct  226  SALGVRGIDVIPNLDFWTTVPRGIQSLFASVVQRIRGPSYGHRSSYSPVNF  276



>ref|XP_010505757.1| PREDICTED: uncharacterized protein LOC104782507 isoform X1 [Camelina 
sativa]
Length=276

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLIIILCLFGAYLLGG  YRY
Sbjct  166  GPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWFSTLLIIILCLFGAYLLGGAAYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F   IRGID+IPN++FW+++PH+ Q    SI  RF G S+  R++YS V F
Sbjct  226  FSFGIRGIDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQRTSYSQVNF  276



>ref|XP_009143225.1| PREDICTED: uncharacterized protein LOC103866960 isoform X1 [Brassica 
rapa]
Length=275

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTCD+ATE+RHPSGC   IS  G G G F TL+IIILCLFGAYLLGG +YRY
Sbjct  166  GPFTLTKSGTCDYATEMRHPSGCAVAISGHGSGWGLFSTLVIIILCLFGAYLLGGALYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            F L IRGI++IPN +FW ++PH++QS F S+ QRF G S   +++YS V 
Sbjct  226  FSLGIRGIEVIPNSDFWVTVPHRIQSCFGSLFQRFGGSSHGQQASYSRVN  275



>ref|XP_004307687.1| PREDICTED: uncharacterized protein LOC101315282 [Fragaria vesca 
subsp. vesca]
Length=278

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P  LEK G CD+AT L+HPSGC  ++   GKG GWF T LIIILCLFG YLL G  YRYF
Sbjct  169  PYLLEKTGKCDYATMLKHPSGCAKIVHVYGKGWGWFVTFLIIILCLFGVYLLAGAGYRYF  228

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
             L   GIDI+PNL+FW+ LP + QS   S+  +FRG SQ HRS+YSPV F
Sbjct  229  SLGFHGIDILPNLDFWTGLPQQAQSVSASLLHKFRGSSQVHRSSYSPVNF  278



>ref|XP_010508882.1| PREDICTED: uncharacterized protein LOC104785377 isoform X2 [Camelina 
sativa]
Length=214

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS+   G GWF TLLIII+CLFGAYLLGG  YRY
Sbjct  104  GPLTLVKSGTCHYATQLRHPSGCAAAISSHRSGWGWFSTLLIIIVCLFGAYLLGGAAYRY  163

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  +++YS V F
Sbjct  164  FSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQQASYSQVNF  214



>ref|XP_010508881.1| PREDICTED: uncharacterized protein LOC104785377 isoform X1 [Camelina 
sativa]
Length=276

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS+   G GWF TLLIII+CLFGAYLLGG  YRY
Sbjct  166  GPLTLVKSGTCHYATQLRHPSGCAAAISSHRSGWGWFSTLLIIIVCLFGAYLLGGAAYRY  225

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  +++YS V F
Sbjct  226  FSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQQASYSQVNF  276



>ref|XP_008804113.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804114.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804115.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
Length=201

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P +L   G+CD+AT LRHPSGC  VIS  G GLGWFGTL+IIILCL G Y+L G IYR+F
Sbjct  92   PNSLNISGSCDYATVLRHPSGCAKVISVNGNGLGWFGTLIIIILCLVGGYILIGTIYRFF  151

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            FL I G + IPN+EFW SLP + +S   S+ +RFRG ++  R +Y+P+ 
Sbjct  152  FLGIHGAEAIPNMEFWFSLPQRARSMLGSLVRRFRGHTRDSRGSYAPMN  200



>ref|XP_008363772.1| PREDICTED: uncharacterized protein LOC103427491 isoform X2 [Malus 
domestica]
Length=260

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK G CD+AT L HPSGC  +    G+  GWFGTL IIILCLFGAYLL G  YRY
Sbjct  150  GPHLLEKTGKCDYATVLTHPSGCAKIEYVHGRAWGWFGTLGIIILCLFGAYLLVGAAYRY  209

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
              L +RGI IIPNL+FW++L    QS F S+  +F G S  HRSTYSPV F
Sbjct  210  IKLGVRGIHIIPNLDFWTTLRQSTQSLFASLLHKFXGSSHGHRSTYSPVNF  260



>ref|XP_008363771.1| PREDICTED: uncharacterized protein LOC103427491 isoform X1 [Malus 
domestica]
Length=278

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP  LEK G CD+AT L HPSGC  +    G+  GWFGTL IIILCLFGAYLL G  YRY
Sbjct  168  GPHLLEKTGKCDYATVLTHPSGCAKIEYVHGRAWGWFGTLGIIILCLFGAYLLVGAAYRY  227

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
              L +RGI IIPNL+FW++L    QS F S+  +F G S  HRSTYSPV F
Sbjct  228  IKLGVRGIHIIPNLDFWTTLRQSTQSLFASLLHKFXGSSHGHRSTYSPVNF  278



>ref|XP_008804111.1| PREDICTED: uncharacterized protein LOC103717482 isoform X1 [Phoenix 
dactylifera]
Length=280

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P +L   G+CD+AT LRHPSGC  VIS  G GLGWFGTL+IIILCL G Y+L G IYR+F
Sbjct  171  PNSLNISGSCDYATVLRHPSGCAKVISVNGNGLGWFGTLIIIILCLVGGYILIGTIYRFF  230

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            FL I G + IPN+EFW SLP + +S   S+ +RFRG ++  R +Y+P+ 
Sbjct  231  FLGIHGAEAIPNMEFWFSLPQRARSMLGSLVRRFRGHTRDSRGSYAPMN  279



>ref|XP_006847437.1| hypothetical protein AMTR_s00153p00085570 [Amborella trichopoda]
 gb|ERN09018.1| hypothetical protein AMTR_s00153p00085570 [Amborella trichopoda]
Length=279

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LE +GTCD+AT LRHP+GC  VIS  G   GWFGTL+ II+CLFGAY L GM+YR+
Sbjct  169  GPNSLELLGTCDYATVLRHPAGCAKVISLDGNEWGWFGTLITIIVCLFGAYFLVGMVYRF  228

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL I+G++++PNLEFW SLP + Q+   +I +R    +Q  RS+YS + F
Sbjct  229  FFLGIQGVEVVPNLEFWLSLPRRSQNLVGAIWRRTGRQAQASRSSYSTLNF  279



>gb|KFK36924.1| hypothetical protein AALP_AA4G190300 [Arabis alpina]
Length=276

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +1

Query  25   GPQTLEKVGT-CDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYR  201
            GP T+ K  T C +ATELRHPSGC   IS  G G GWF TLLIII+CLFG YL+GG +YR
Sbjct  165  GPLTMVKSNTSCHYATELRHPSGCAVAISGHGSGWGWFSTLLIIIICLFGTYLIGGSLYR  224

Query  202  YFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            +F L IRG D+IPN++FW ++P ++QS F S+ QRF G S + R++YS V F
Sbjct  225  HFSLGIRGTDVIPNIDFWVTVPLRIQSCFGSLFQRFGGSSHNQRTSYSQVNF  276



>ref|XP_006435816.1| hypothetical protein CICLE_v10032369mg [Citrus clementina]
 ref|XP_006486247.1| PREDICTED: uncharacterized protein LOC102610808 [Citrus sinensis]
 gb|ESR49056.1| hypothetical protein CICLE_v10032369mg [Citrus clementina]
Length=275

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GPQ++EK+GTC++ATE+RHPSGC  +I A+G G GWFGT + +ILCLFG YLL G  YRY
Sbjct  165  GPQSMEKLGTCNYATEIRHPSGCATIIPAEGGGWGWFGTFVTVILCLFGIYLLAGTAYRY  224

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FFL I G+  +PNL+FW S+ H++Q++F S  +RFRGPS+ HRSTYS + F
Sbjct  225  FFLGIHGLHALPNLDFWGSILHRMQNFFASFVRRFRGPSEGHRSTYSRINF  275



>ref|XP_007008868.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 4 [Theobroma cacao]
 gb|EOY17678.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 4 [Theobroma cacao]
Length=274

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 4/92 (4%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ IILCLFGAYLL G +YR+
Sbjct  172  GPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTIILCLFGAYLLAGTVYRF  231

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQ----SWF  288
            FFL +RG+++IPNLEFW+SL H+ Q    SW+
Sbjct  232  FFLGVRGVEVIPNLEFWASLQHRTQVPLVSWY  263



>ref|XP_002311247.2| hypothetical protein POPTR_0008s07320g [Populus trichocarpa]
 gb|EEE88614.2| hypothetical protein POPTR_0008s07320g [Populus trichocarpa]
Length=354

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 89/155 (57%), Gaps = 45/155 (29%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK+GTCD+A  L+HPSGC   I+  GKG GWFGTL+II+ CLFG Y L G +YR+
Sbjct  201  GPHSLEKLGTCDYAAVLQHPSGCA-TINGHGKGWGWFGTLMIIVFCLFGGYFLAGAVYRH  259

Query  205  FFLHIRGID--------------------------------------------IIPNLEF  252
            F++ + G+D                                            +IPNL+F
Sbjct  260  FYIGVHGLDQYCPVSNFIPVKQLIRWFKSSDFRDRHCLCCGIRVPHCGLIRDLMIPNLDF  319

Query  253  WSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            W+ LPH+ QS+F S+ +RFRGP++ +RS+YSPV F
Sbjct  320  WTRLPHRTQSFFASLVRRFRGPTEGYRSSYSPVNF  354



>gb|AAD25948.1|AF085279_21 hypothetical protein [Arabidopsis thaliana]
 gb|AAM15352.1| hypothetical protein [Arabidopsis thaliana]
Length=142

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +1

Query  25   GPQTLEKVGTCDF--ATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIY  198
            GP TL K GTC +  AT+LRHP+GC   IS    G GWF TLLIIILCLFGAYL+GG +Y
Sbjct  39   GPLTLAKSGTCQYVSATQLRHPAGCAAAISGHSSGWGWFSTLLIIILCLFGAYLVGGAVY  98

Query  199  RYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  288
            RYF L IRGID+IPN+++W+++PH +Q  F
Sbjct  99   RYFSLGIRGIDVIPNMDYWATVPHSIQVLF  128



>emb|CDX74798.1| BnaA05g05440D [Brassica napus]
Length=288

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTCD+ATE+RHPSGC   IS  G G G F TLLIIILCLFGAYLLGG +YRY
Sbjct  167  GPLTLTKSGTCDYATEMRHPSGCAVAISGHGSGWGLFSTLLIIILCLFGAYLLGGSLYRY  226

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQ-SWF  288
            F L IRGI++IPN +FW ++PH++Q  WF
Sbjct  227  FSLGIRGIEVIPNSDFWVTVPHRIQLLWF  255



>ref|XP_009416304.1| PREDICTED: uncharacterized protein LOC103996952 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +1

Query  31   QTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFF  210
             T    G CD+A  LRHPSGC  VI   GKG GWFGTL++IILCL   Y+L G IYR+FF
Sbjct  173  DTFNITGNCDYAVVLRHPSGCAKVIYVNGKGWGWFGTLMMIILCLLVGYVLVGTIYRFFF  232

Query  211  LHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            L I+GI+ IPNLEFW SLP+K  S  + + +RF   S+  R +Y+PV +
Sbjct  233  LGIQGIEAIPNLEFWLSLPYKASSMLRGLVRRF---SRDSRGSYAPVNY  278



>ref|XP_010517450.1| PREDICTED: uncharacterized protein LOC104792889 isoform X2 [Camelina 
sativa]
Length=214

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS    G GW  TLLIIILCL GAYLLGG  YRY
Sbjct  104  GPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWSSTLLIIILCLLGAYLLGGSAYRY  163

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  R++YS V F
Sbjct  164  FSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQRTSYSQVNF  214



>ref|XP_010517449.1| PREDICTED: uncharacterized protein LOC104792889 isoform X1 [Camelina 
sativa]
Length=271

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP TL K GTC +AT+LRHPSGC   IS    G GW  TLLIIILCL GAYLLGG  YRY
Sbjct  161  GPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWSSTLLIIILCLLGAYLLGGSAYRY  220

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            F L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  R++YS V F
Sbjct  221  FSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQRTSYSQVNF  271



>ref|XP_010921016.1| PREDICTED: uncharacterized protein LOC105044726 [Elaeis guineensis]
Length=280

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P +L   G+CD+AT LRHPSGC  V S  GKGLGWFGTL+IIILCL G Y+L G IYR+F
Sbjct  171  PNSLNISGSCDYATMLRHPSGCAKVSSVNGKGLGWFGTLIIIILCLLGGYILVGTIYRFF  230

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
            FL I G + IPN+EFW SLP + +    S+ +RFRG ++  R +Y+P+ +
Sbjct  231  FLGIHGAEAIPNVEFWLSLPQRARGMLDSLGRRFRGHTRDGRGSYAPMNY  280



>ref|XP_007219770.1| hypothetical protein PRUPE_ppa025595mg, partial [Prunus persica]
 gb|EMJ20969.1| hypothetical protein PRUPE_ppa025595mg, partial [Prunus persica]
Length=175

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK G CD+AT L HPSGC  V+   G   GWFGTL  I+LCLFGAYLL G +Y+Y
Sbjct  91   GPHSLEKTGKCDYATVLTHPSGCAKVVHVHGHWWGWFGTLGTIVLCLFGAYLLAGAVYQY  150

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQ  279
            F L +RGI +IPNL+FW+SLP + Q
Sbjct  151  FSLGVRGIHVIPNLDFWTSLPQRTQ  175



>ref|XP_003558130.1| PREDICTED: uncharacterized protein LOC100823098 [Brachypodium 
distachyon]
Length=282

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 67/109 (61%), Gaps = 1/109 (1%)
 Frame = +1

Query  31   QTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFF  210
                + G CD+ T LRHPSGC   +SA G G GW GT  I ILCL G Y+L G IYRY+F
Sbjct  173  DKFSQSGNCDYVTILRHPSGCARSVSASGNGWGWLGTSFITILCLLGGYILIGAIYRYYF  232

Query  211  LHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTY-SPVE  354
            L I  I+ IPNLEFW SLP KV+S F S  +  R  S+  R  Y +PV 
Sbjct  233  LGIHSIEAIPNLEFWISLPQKVKSMFVSSTRNPRSRSRDSRGPYATPVN  281



>dbj|BAJ90180.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=280

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P+   + G+CD+ T LRHPSGC   +S  G G GW GT  I I+CL G Y+L G IYRY+
Sbjct  171  PEKFSQSGSCDYVTILRHPSGCARSVSDTGNGWGWLGTSFITIVCLLGGYILIGAIYRYY  230

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            F+ I  ++ IPNLEFW SLP +++S F    +  R  S+  R  Y+ V 
Sbjct  231  FVGIHSVEAIPNLEFWISLPQRIKSMFVRSRRNPRSQSRDSRGPYTTVN  279



>ref|XP_006651281.1| PREDICTED: uncharacterized protein LOC102717143 [Oryza brachyantha]
Length=440

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +1

Query  49   GTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGI  228
            G+CD+AT LRHPSGC   ++A G G GW     + I CL G Y+L G +YRY+FL I  +
Sbjct  338  GSCDYATTLRHPSGCARSMAASGNGWGWLAISFVTIFCLLGGYILSGAVYRYYFLGIHSV  397

Query  229  DIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            + IPNLEFW SLP  ++S     A+  RG ++     Y+PV+
Sbjct  398  EAIPNLEFWISLPQTIKSMLLPSARSARGRNRQIEDPYAPVD  439



>ref|XP_007008869.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 ref|XP_007008870.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 gb|EOY17679.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 gb|EOY17680.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
Length=284

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ IILCLFGAYLL G +YR+
Sbjct  172  GPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTIILCLFGAYLLAGTVYRF  231

Query  205  FFLHIRGIDI  234
            FFL +RG+++
Sbjct  232  FFLGVRGVEV  241



>ref|NP_001183686.1| uncharacterized protein LOC100502280 precursor [Zea mays]
 gb|ACR37963.1| unknown [Zea mays]
 tpg|DAA44896.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
 tpg|DAA44897.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
Length=283

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 0/108 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P      G CD+AT L HPSGC   +SA G G GW  TL I ILCL G Y+L G +YRY+
Sbjct  174  PDKFVLSGLCDYATTLEHPSGCPRSVSASGSGWGWLSTLFITILCLLGGYILIGAVYRYY  233

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPV  351
            FL I  ++ IPNLEFW  LP ++++ F    +     S+    T +PV
Sbjct  234  FLGIHSVEAIPNLEFWIGLPQRIKTVFVPATRSHVSYSRDGLGTDAPV  281



>ref|XP_010087539.1| hypothetical protein L484_006944 [Morus notabilis]
 gb|EXB29270.1| hypothetical protein L484_006944 [Morus notabilis]
Length=257

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +L + GTC +ATEL+HPSGC  V +   KG GWF TL++II+CLFGAYLL G +YRY
Sbjct  175  GPYSLNRTGTCAYATELKHPSGCAEVANINAKGWGWFSTLILIIVCLFGAYLLAGAVYRY  234

Query  205  FFLHIRGID  231
            FFL IRGI+
Sbjct  235  FFLGIRGIE  243



>emb|CAN76264.1| hypothetical protein VITISV_001854 [Vitis vinifera]
Length=297

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 16/98 (16%)
 Frame = +1

Query  64   ATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPN  243
            ATE+RHPSGC  ++S  G+GLGWF T LII+ C  G YLL G +YR+FFL +RG+D    
Sbjct  216  ATEMRHPSGCAEIVSVHGRGLGWFSTFLIILFCFLGVYLLVGTVYRFFFLGVRGVD----  271

Query  244  LEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
                        S   S+ ++FRGPSQ HR +YS V F
Sbjct  272  ------------SSCASLVRKFRGPSQGHRDSYSAVNF  297



>ref|NP_001049832.1| Os03g0296700 [Oryza sativa Japonica Group]
 gb|ABF95446.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11746.1| Os03g0296700 [Oryza sativa Japonica Group]
Length=264

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  49   GTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGI  228
            G+CD+AT LRHPSGC   +SA G G GW  T  + ILCL G Y+L G IYRY+FL I  +
Sbjct  180  GSCDYATTLRHPSGCAQSMSASGNGWGWLATSFVTILCLLGGYILIGSIYRYYFLGIHSV  239

Query  229  DIIPNLEFWSSLPHKVQ  279
            + IPNLEFW SLP  ++
Sbjct  240  EAIPNLEFWISLPQTIK  256



>gb|AFK44428.1| unknown [Lotus japonicus]
Length=243

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
             P TLEK+G C++ATE++HPSGC  ++S  G+G GWFGTL+ IILCLF AYLL G+ YR 
Sbjct  169  APHTLEKLGACNYATEIKHPSGCATIVSVHGRGWGWFGTLITIILCLFAAYLLAGIAYR-  227

Query  205  FFLHIRGIDI  234
            FFL IRGID+
Sbjct  228  FFLGIRGIDV  237



>ref|XP_004984880.1| PREDICTED: uncharacterized protein LOC101783634 isoform X1 [Setaria 
italica]
Length=289

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 63/109 (58%), Gaps = 0/109 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P      G CD+AT  +HPSGC   +SA G G GW GTL I I+ L G Y+L G +YRY+
Sbjct  180  PDKFVVSGRCDYATTFKHPSGCARSVSASGSGWGWLGTLFITIMSLLGGYILLGAVYRYY  239

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVE  354
            FL +  ++ IPNL+FW SLP ++++ F    +     ++     Y+P  
Sbjct  240  FLGLHSVEAIPNLDFWISLPRRIKTMFVPATRSRISYNRDGLGAYAPAN  288



>ref|XP_008343653.1| PREDICTED: uncharacterized protein LOC103406452 [Malus domestica]
Length=262

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK G CD+AT L HPSGC  +    G+G GW GTL IIILCLFGAYLL G  YRY
Sbjct  168  GPHSLEKTGKCDYATVLTHPSGCAKIEHVHGRGWGWLGTLGIIILCLFGAYLLVGAGYRY  227

Query  205  FFLHIRGI  228
              L +RGI
Sbjct  228  IKLGVRGI  235



>ref|XP_008374955.1| PREDICTED: uncharacterized protein LOC103438201 [Malus domestica]
Length=246

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            GP +LEK G CD+AT L HPSGC  +    G+G GW GTL IIILCLFGAYLL G +  +
Sbjct  168  GPHSLEKTGKCDYATVLTHPSGCAKIEHVHGRGWGWLGTLGIIILCLFGAYLLVGAVLWW  227

Query  205  FFL  213
             FL
Sbjct  228  VFL  230



>gb|EMT00564.1| hypothetical protein F775_08095 [Aegilops tauschii]
Length=276

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P    + G+CD+ T LRHPSGC   +S  G G GW GT  I ILCL G Y+L G IYRY+
Sbjct  176  PDKFTQSGSCDYVTILRHPSGCARSVSDAGNGWGWLGTSFITILCLLGGYILIGAIYRYY  235

Query  208  FLHIRGIDI  234
            FL I  +++
Sbjct  236  FLGIHSVEL  244



>ref|XP_002979286.1| hypothetical protein SELMODRAFT_110390, partial [Selaginella 
moellendorffii]
 gb|EFJ19694.1| hypothetical protein SELMODRAFT_110390, partial [Selaginella 
moellendorffii]
Length=169

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  55   CDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDI  234
            C +   L+HP+GC  V    G GLGWF TLLI++LC    Y++   IYR   L I G++ 
Sbjct  86   CHYTAVLKHPAGCPVVTRLDGGGLGWFSTLLIVLLCFLVVYMIAATIYRRKALGIVGVEA  145

Query  235  IPNLEFWSSLPHKVQSWF  288
            IP+++FW S+P  +Q  +
Sbjct  146  IPHMDFWRSIPSNIQVCY  163



>gb|ACU20834.1| unknown [Glycine max]
Length=243

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLG  186
            GPQ LE++G CD+ TEL+HPSGC  +I+  G G GWFGTLLII+LCLF    LG
Sbjct  172  GPQALERLGACDYVTELKHPSGCAIIINVHGGGWGWFGTLLIIVLCLFCCISLG  225



>ref|XP_001759768.1| predicted protein [Physcomitrella patens]
 gb|EDQ75272.1| predicted protein [Physcomitrella patens]
Length=208

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +1

Query  49   GTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGI  228
            G CD+ T L+HP+GC  V +    G GWFG+L  ++L  F  Y+  G+ YR   L + G 
Sbjct  120  GVCDYETILKHPAGCPVVTNVSKGGWGWFGSLFFMLLLAFVVYMAVGIGYRVTVLGVSGF  179

Query  229  DIIPNLEFWSSLPHKVQ  279
            + IPNL+ W +LP K+Q
Sbjct  180  EAIPNLDTWRTLPSKIQ  196



>ref|XP_001756445.1| predicted protein [Physcomitrella patens]
 gb|EDQ78841.1| predicted protein [Physcomitrella patens]
Length=434

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  49   GTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGI  228
            G C+  T L+HP+GC  V +   KG GWFG+LL ++L +F  Y+  G+ YR   L   G 
Sbjct  331  GECNLETALKHPAGCPVVTNMSKKGWGWFGSLLFMLLLIFVVYVAVGIGYRVTVLGASGF  390

Query  229  DIIPNLEFWSSLPHKVQ  279
            + IPNL+ W +LP K+Q
Sbjct  391  EAIPNLDTWRALPSKIQ  407



>ref|XP_008647628.1| PREDICTED: uncharacterized protein LOC100502280 isoform X1 [Zea 
mays]
Length=335

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 18/108 (17%)
 Frame = +1

Query  28   PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  207
            P      G CD+AT L HPSGC                    ILCL G Y+L G +YRY+
Sbjct  244  PDKFVLSGLCDYATTLEHPSGCPR------------------ILCLLGGYILIGAVYRYY  285

Query  208  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPV  351
            FL I  ++ IPNLEFW  LP ++++ F    +     S+    T +PV
Sbjct  286  FLGIHSVEAIPNLEFWIGLPQRIKTVFVPATRSHVSYSRDGLGTDAPV  333



>gb|EEE58880.1| hypothetical protein OsJ_10490 [Oryza sativa Japonica Group]
Length=239

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   ATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDI  234
            AT LRHPSGC   +SA G G GW  T  + ILCL G Y+L G IYRY+FL I  +++
Sbjct  172  ATTLRHPSGCAQSMSASGNGWGWLATSFVTILCLLGGYILIGSIYRYYFLGIHSVEV  228



>gb|EEC75047.1| hypothetical protein OsI_11153 [Oryza sativa Indica Group]
Length=239

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   ATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDI  234
            AT LRHPSGC   +SA G G GW  T  + ILCL G Y+L G IYRY+FL I  +++
Sbjct  172  ATTLRHPSGCAQSMSASGNGWGWLATSFVTILCLLGGYILIGSIYRYYFLGIHSVEV  228



>ref|XP_002520790.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41499.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  153
            GP +LEK GTCD+A  L+HPSGC  ++S  G+G GWF TLLI+
Sbjct  178  GPHSLEKTGTCDYAAALQHPSGCATIVSVHGQGWGWFSTLLIM  220



>ref|XP_007008866.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 2 [Theobroma cacao]
 gb|EOY17676.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 2 [Theobroma cacao]
Length=214

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  153
            GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ +
Sbjct  172  GPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTM  214



>ref|XP_011003184.1| PREDICTED: uncharacterized protein LOC105109879 isoform X2 [Populus 
euphratica]
Length=215

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  150
            GP +LEK+GTCD+A  L+HPSGC   I+  GKG GWFGTL+I
Sbjct  174  GPHSLEKLGTCDYAAVLQHPSGC-ATINGHGKGWGWFGTLMI  214



>dbj|GAD91664.1| vacuolar sorting receptor (Mrl1), putative [Byssochlamys spectabilis 
No. 5]
Length=358

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 40/76 (53%), Gaps = 3/76 (4%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R P+ CGGV  A   GLG  G   +I+L    AYLLGG  Y+   +H
Sbjct  207  VGTMDQCTYFFEVRSPAACGGVAHAPNTGLGPGGVFGVIVLIAIAAYLLGGCAYQRTVMH  266

Query  217  IRGIDIIPNLEFWSSL  264
             RG    PN   W+ +
Sbjct  267  QRGWRQCPNYSLWAGM  282



>ref|XP_006819098.1| PREDICTED: uncharacterized protein LOC102807910 [Saccoglossus 
kowalevskii]
Length=244

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 53/113 (47%), Gaps = 10/113 (9%)
 Frame = +1

Query  31   QTLEKVGTCDFAT----ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIY  198
             TL   G+ DF+T    +L     C   I     GL     L II + L   YL+GG+++
Sbjct  138  DTLHAYGSADFSTNYDFDLSSKYCC--PIDGGNGGLSAGSVLCIIAVVLVVVYLIGGILF  195

Query  199  RYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  357
              F  H  G D+IPN +FW++LP  ++  F         P +   S YS +++
Sbjct  196  NKFIRHAEGSDVIPNKQFWAALPALIKDGFLFAIS----PCRKGSSPYSSIDY  244



>dbj|BAE54833.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=276

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 44/90 (49%), Gaps = 3/90 (3%)
 Frame = +1

Query  34   TLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            T   VGT D  T   E+R  + CG V  A G+GLG  G   +I L    AYL+GG  Y+ 
Sbjct  178  TASFVGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVIALIAVVAYLVGGCAYQR  237

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWFQS  294
              +H RG    PN   W+ +   V+S   S
Sbjct  238  TVMHQRGWRQCPNYSLWAGMFDFVKSSITS  267



>gb|EIT72508.1| cation-independent mannose-6-phosphate receptor CI-MPR [Aspergillus 
oryzae 3.042]
 gb|KDE77400.1| cation-independent mannose-6-phosphate receptor CI-MPR [Aspergillus 
oryzae 100-8]
Length=326

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CG V  A G+GLG  G   +I L    AYL+GG  Y+   +H
Sbjct  182  VGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVIALIAVVAYLVGGCAYQRTVMH  241

Query  217  IRGIDIIPNLEFWSSLPHKVQSWF  288
             RG    PN   W+ +   V+  F
Sbjct  242  QRGWRQCPNYSLWAGMFDFVKDMF  265



>ref|XP_001816835.2| vacuolar sorting receptor (Mrl1) [Aspergillus oryzae RIB40]
Length=326

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CG V  A G+GLG  G   +I L    AYL+GG  Y+   +H
Sbjct  182  VGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVIALIAVVAYLVGGCAYQRTVMH  241

Query  217  IRGIDIIPNLEFWSSLPHKVQSWF  288
             RG    PN   W+ +   V+  F
Sbjct  242  QRGWRQCPNYSLWAGMFDFVKDMF  265



>ref|XP_002383235.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus flavus 
NRRL3357]
 gb|EED47055.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus flavus 
NRRL3357]
Length=326

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 3/88 (3%)
 Frame = +1

Query  34   TLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            T   VGT D  T   E+R  + CG V  A G+GLG  G   +I L    AYL+GG  Y+ 
Sbjct  178  TASFVGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVIALIAVVAYLVGGCAYQR  237

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSWF  288
              +H RG    PN   W+ +   V+  F
Sbjct  238  TVMHQRGWRQCPNYSLWAGMFDFVKDMF  265



>ref|XP_001212231.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU36327.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=324

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 43/84 (51%), Gaps = 3/84 (4%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CGG+  + G+GLG  G   +I L    AYL+GG  Y+   +H
Sbjct  178  VGTMDECTYFFEVRSSAACGGIPLSDGQGLGPGGVFGVIALIAVAAYLVGGCAYQRTVMH  237

Query  217  IRGIDIIPNLEFWSSLPHKVQSWF  288
             RG    PN   W+ +   V+  F
Sbjct  238  QRGWRQCPNYSLWAGMFDFVKDMF  261



>ref|XP_001265096.1| vacuolar sorting receptor (Mrl1), putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW23199.1| vacuolar sorting receptor (Mrl1), putative [Neosartorya fischeri 
NRRL 181]
Length=331

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CG +  A G+GLG  G   +I L    AYL+GG  Y+   +H
Sbjct  184  VGTMDQCTYFFEIRSSAACGSIGHANGEGLGPAGVFGVIALIAVAAYLVGGCAYQRTVMH  243

Query  217  IRGIDIIPNLEFWSSLPHKVQSWF  288
             RG    PN   W+ +   V+  F
Sbjct  244  QRGWRQCPNYSLWAGIFDFVKDMF  267



>dbj|GAM39181.1| hypothetical protein TCE0_034f10514 [Talaromyces cellulolyticus]
Length=371

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 40/80 (50%), Gaps = 3/80 (4%)
 Frame = +1

Query  34   TLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            T+  VGT D  T   E+R  + CGGV +A   GLG  G   +I L     YLLGG  Y+ 
Sbjct  220  TVSFVGTMDSCTYFFEVRSFAACGGVAAAPEGGLGPAGVFGVIALIAIFVYLLGGCAYQR  279

Query  205  FFLHIRGIDIIPNLEFWSSL  264
              +H RG    PN   WS L
Sbjct  280  SVMHQRGWRQCPNYSMWSDL  299



>ref|XP_002480488.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED20054.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces stipitatus 
ATCC 10500]
Length=370

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 40/80 (50%), Gaps = 3/80 (4%)
 Frame = +1

Query  34   TLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            T+  VGT D  T   E+R  + CGGV +A   GLG  G   +I L     YLLGG  Y+ 
Sbjct  220  TVSFVGTMDSCTYFFEVRSFAACGGVAAAPEGGLGPAGVFGVIALIAVFVYLLGGCAYQR  279

Query  205  FFLHIRGIDIIPNLEFWSSL  264
              +H RG    PN   WS L
Sbjct  280  SVMHQRGWRQCPNYSMWSDL  299



>ref|XP_002542561.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP77228.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=199

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +1

Query  52   TCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGID  231
            +C +  E+R  + CGGV ++   G+G  G   II+     AY++GG  Y+   +H RG  
Sbjct  110  SCTYVFEVRSAAACGGVAASTDGGVGPAGVFGIIVGIAIAAYMIGGCAYQRTVMHQRGWR  169

Query  232  IIPNLEFWSSL  264
              PN   W+++
Sbjct  170  QCPNFAMWNNM  180



>ref|XP_001269587.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW08161.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus clavatus 
NRRL 1]
Length=331

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 3/76 (4%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CG +  A G+GLG  G   +I L    AYL+GG  Y+   +H
Sbjct  184  VGTMDQCTYFFEVRSSAACGSIGHANGEGLGPAGVFGVIALIAVAAYLIGGCAYQRTVMH  243

Query  217  IRGIDIIPNLEFWSSL  264
             RG    PN   W+ +
Sbjct  244  QRGWRQCPNYSLWAGI  259



>ref|XP_008197150.1| PREDICTED: uncharacterized protein LOC103314060 [Tribolium castaneum]
 gb|EFA08006.1| hypothetical protein TcasGA2_TC005595 [Tribolium castaneum]
Length=243

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = +1

Query  73   LRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEF  252
            L  P  C  VI+ K  GL     LL+I    FGAY +GG++  YF    RG++ IPN++F
Sbjct  154  LGSPHAC--VITEK-SGLSTGSVLLLIFFISFGAYFVGGILILYFMRGARGLETIPNVDF  210

Query  253  WSSLPHKVQS  282
            W SLP  V+ 
Sbjct  211  WRSLPGLVKD  220



>emb|CDH52540.1| autophagy protein atg27 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=298

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 0/71 (0%)
 Frame = +1

Query  70   ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLE  249
            E   PS          +G+   G    II  L G Y +GG +Y Y   + RG+D+IP+ +
Sbjct  206  EEPPPSEPDTPAQGDSEGMSGLGIFFTIIFVLLGVYFIGGAVYNYKVYNARGLDLIPHRD  265

Query  250  FWSSLPHKVQS  282
            FW  LP+ ++ 
Sbjct  266  FWLDLPYLIKD  276



>gb|KFX50812.1| putative mannose 6-phosphate receptor-like protein [Talaromyces 
marneffei PM1]
Length=344

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 51/111 (46%), Gaps = 7/111 (6%)
 Frame = +1

Query  34   TLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            T+  VGT D  T   E+R  + CGGV +A   GLG  G   +I L     YLLGG  Y+ 
Sbjct  192  TVSFVGTMDSCTYFFEVRTFAACGGVAAAPEGGLGPAGIFGVIALIAIFVYLLGGCAYQR  251

Query  205  FFLHIRGIDIIPNLEFWSSLPHKVQSW----FQSIAQRFRGPSQHHRSTYS  345
              +H RG    PN   WS L    + +    F S+ + F G      + YS
Sbjct  252  SVMHQRGWRQCPNYSMWSELLGFFKDFAIIIFSSLTRCFTGKGSPSSAGYS  302



>ref|XP_002144095.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA27580.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX50811.1| putative mannose 6-phosphate receptor-like protein [Talaromyces 
marneffei PM1]
Length=369

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 40/80 (50%), Gaps = 3/80 (4%)
 Frame = +1

Query  34   TLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            T+  VGT D  T   E+R  + CGGV +A   GLG  G   +I L     YLLGG  Y+ 
Sbjct  217  TVSFVGTMDSCTYFFEVRTFAACGGVAAAPEGGLGPAGIFGVIALIAIFVYLLGGCAYQR  276

Query  205  FFLHIRGIDIIPNLEFWSSL  264
              +H RG    PN   WS L
Sbjct  277  SVMHQRGWRQCPNYSMWSEL  296



>gb|KIL71248.1| hypothetical protein M378DRAFT_154764 [Amanita muscaria Koide 
BX008]
Length=385

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 38/76 (50%), Gaps = 2/76 (3%)
 Frame = +1

Query  106  SAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS-  282
            ++    LG+F  L II L L  AY + G +Y  + L +RG D IP   F S   H  Q+ 
Sbjct  176  TSGNSALGFFAVLAIIALVLVVAYTVLGTLYNRYVLQLRGFDQIPQFSFESMRYHAHQAI  235

Query  283  -WFQSIAQRFRGPSQH  327
             WF+ I   F   SQH
Sbjct  236  DWFRDIMSNFYEQSQH  251



>emb|CEI91741.1| hypothetical protein RMCBS344292_06022 [Rhizopus microsporus]
Length=393

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 37/78 (47%), Gaps = 4/78 (5%)
 Frame = +1

Query  94   GGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHK  273
            GG    K +G+        II  L   Y +GG  Y Y   + RG+D+IP+ EFW  LP+ 
Sbjct  309  GGNEEPKKEGMSGIRIFFTIIFVLLAVYFIGGAFYNYRVYNARGLDLIPHREFWLDLPYL  368

Query  274  VQSW----FQSIAQRFRG  315
            ++        SI  R RG
Sbjct  369  IRDLIAHIIDSIMSRRRG  386



>gb|KDO68854.1| hypothetical protein CISIN_1g037714mg, partial [Citrus sinensis]
Length=204

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  25   GPQTLEKVGTCDFATELRHPSGCGGVISAK  114
            GPQ++EK+GTC++ATE+RHPSGC  +I A+
Sbjct  165  GPQSMEKLGTCNYATEIRHPSGCATIIPAE  194



>gb|EHJ65657.1| hypothetical protein KGM_06525 [Danaus plexippus]
Length=275

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 42/88 (48%), Gaps = 2/88 (2%)
 Frame = +1

Query  85   SGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  264
              C   I   G  LG   TLLII+      YL  G+  + F +   GI++IPNL FWS L
Sbjct  182  EACLKQIEELGPSLGT--TLLIILFSFVALYLALGICTKIFLMGATGIEVIPNLSFWSDL  239

Query  265  PHKVQSWFQSIAQRFRGPSQHHRSTYSP  348
            P+ V+  +      F+ P++      SP
Sbjct  240  PNLVRDGWAFALNGFKLPNRSQGPVTSP  267



>emb|CEG71777.1| hypothetical protein RMATCC62417_07449 [Rhizopus microsporus]
Length=287

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 37/78 (47%), Gaps = 4/78 (5%)
 Frame = +1

Query  94   GGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHK  273
            GG    K +G+        II  L   Y +GG  Y Y   + RG+D+IP+ EFW  LP+ 
Sbjct  203  GGNEEPKKEGMSGIRIFFTIIFVLLAVYFIGGAFYNYRVYNARGLDLIPHREFWLDLPYL  262

Query  274  VQSW----FQSIAQRFRG  315
            ++        SI  R RG
Sbjct  263  IRDLIAHIIDSIMSRRRG  280



>emb|CEI92604.1| hypothetical protein RMCBS344292_06858 [Rhizopus microsporus]
Length=287

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 37/78 (47%), Gaps = 4/78 (5%)
 Frame = +1

Query  94   GGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHK  273
            GG    K +G+        II  L   Y +GG  Y Y   + RG+D+IP+ EFW  LP+ 
Sbjct  203  GGNEEPKKEGMSGIRIFFTIIFVLLAVYFIGGAFYNYRVYNARGLDLIPHREFWLDLPYL  262

Query  274  VQSW----FQSIAQRFRG  315
            ++        SI  R RG
Sbjct  263  IRDLIAHIIDSIMSRRRG  280



>gb|EPB85865.1| hypothetical protein HMPREF1544_07364 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=292

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +1

Query  118  KGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF---  288
            KG+   G    I+  L   Y +GG  Y +   + RG+D+IP+ EFW  LP+ ++  F   
Sbjct  216  KGMSGIGIFFTIVFVLAAVYFVGGAFYNFKMYNARGLDLIPHREFWFDLPYLIRDLFAHV  275

Query  289  -QSIAQRFRG  315
              S+  R RG
Sbjct  276  VDSVMSRRRG  285



>gb|ELU12794.1| hypothetical protein CAPTEDRAFT_127669 [Capitella teleta]
Length=187

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 38/78 (49%), Gaps = 3/78 (4%)
 Frame = +1

Query  31   QTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFF  210
            +   K   C +  EL H + C   +++  +GL     + I+   L   YLLGG IY+ F 
Sbjct  66   ENNNKTQDCFYLFELEHKAAC---MTSASEGLSIGSIVCIVFFSLLACYLLGGFIYQRFV  122

Query  211  LHIRGIDIIPNLEFWSSL  264
            +  +G++ IPN  FW   
Sbjct  123  VGAKGMEQIPNYSFWQDF  140



>ref|XP_750322.1| vacuolar sorting receptor (Mrl1) [Aspergillus fumigatus Af293]
 gb|EAL88284.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus fumigatus 
Af293]
 gb|EDP55909.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus fumigatus 
A1163]
 gb|KEY82967.1| vacuolar sorting receptor Mrl1 [Aspergillus fumigatus var. RP-2014]
Length=351

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 38/76 (50%), Gaps = 3/76 (4%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CG +  A G GLG  G   +I L    AYL+GG  Y+   +H
Sbjct  184  VGTMDQCTYFFEVRSAAACGSIGHAHGDGLGPGGVFGVIALIAVAAYLVGGCAYQRTVMH  243

Query  217  IRGIDIIPNLEFWSSL  264
             RG    PN   W+ +
Sbjct  244  QRGWRQCPNYSLWAGI  259



>ref|XP_007579807.1| putative vacuolar sorting receptor protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD52723.1| putative vacuolar sorting receptor protein [Neofusicoccum parvum 
UCRNP2]
Length=346

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +1

Query  55   CDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDI  234
            C +  E R  + CGG I  + + LG  G   +I+L  F  Y +GG +Y+   +H RG   
Sbjct  220  CTYFFEARSKAACGG-IEKETQQLGPGGVFGVIVLIAFLVYFVGGCVYQRTVMHQRGWRQ  278

Query  235  IPNLEFWSSL  264
            IPN  FW S+
Sbjct  279  IPNFSFWESI  288



>gb|KDQ57471.1| hypothetical protein JAAARDRAFT_177653 [Jaapia argillacea MUCL 
33604]
Length=289

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = +1

Query  70   ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLE  249
            E + P   G    + G G+GWF    +++L  FGAY   G  Y Y     RG+D+IP+ +
Sbjct  199  ESKGPGDGGKEEESVGSGIGWF---FLVLLIAFGAYFGLGAYYNYSTYGARGLDLIPHRD  255

Query  250  FWSSLPHKVQSWFQSIAQRFRGPSQHHRS  336
            FW  +P+ ++     +    R P +  RS
Sbjct  256  FWREVPYMLRDVVSHLCSTVR-PRRSSRS  283



>ref|XP_009067010.1| hypothetical protein LOTGIDRAFT_134805 [Lottia gigantea]
 gb|ESO82350.1| hypothetical protein LOTGIDRAFT_134805 [Lottia gigantea]
Length=180

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 37/73 (51%), Gaps = 1/73 (1%)
 Frame = +1

Query  43   KVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIR  222
            K   C +  E+ H   CG  I  K K L     +LI++  +   YLL G +Y+ F LH +
Sbjct  63   KYTDCYYLFEISHKDACGVPIDIK-KSLSVGSIVLIVMASVIALYLLLGFLYQRFVLHAK  121

Query  223  GIDIIPNLEFWSS  261
            G++ IPN  FW  
Sbjct  122  GMEQIPNYAFWQD  134



>gb|EEQ83764.1| vacuolar sorting receptor [Blastomyces dermatitidis ER-3]
Length=410

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 8/107 (7%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CGGV   +G GLG  G   +I L     Y+LGG  Y+   +H
Sbjct  239  VGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVIALIAIAVYILGGCAYQRTVMH  297

Query  217  IRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPSQHHRSTYS  345
             RG    PN   W+     V+      F S+++ FR  +    + YS
Sbjct  298  QRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSNFKSPTGYS  344



>gb|EQL29309.1| hypothetical protein BDFG_08039 [Blastomyces dermatitidis ATCC 
26199]
Length=409

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 8/107 (7%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CGGV   +G GLG  G   +I L     Y+LGG  Y+   +H
Sbjct  239  VGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVIALIAIAVYILGGCAYQRTVMH  297

Query  217  IRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPSQHHRSTYS  345
             RG    PN   W+     V+      F S+++ FR  +    + YS
Sbjct  298  QRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSNFKSPTGYS  344



>ref|XP_002625151.1| vacuolar sorting receptor [Blastomyces dermatitidis SLH14081]
 gb|EEQ78362.1| vacuolar sorting receptor [Blastomyces dermatitidis SLH14081]
Length=409

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 8/107 (7%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CGGV   +G GLG  G   +I L     Y+LGG  Y+   +H
Sbjct  239  VGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVIALIAIAVYILGGCAYQRTVMH  297

Query  217  IRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPSQHHRSTYS  345
             RG    PN   W+     V+      F S+++ FR  +    + YS
Sbjct  298  QRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSNFKSPTGYS  344



>gb|EGE80100.1| vacuolar sorting receptor [Blastomyces dermatitidis ATCC 18188]
Length=410

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 8/107 (7%)
 Frame = +1

Query  46   VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLH  216
            VGT D  T   E+R  + CGGV   +G GLG  G   +I L     Y+LGG  Y+   +H
Sbjct  239  VGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVIALIAIAVYILGGCAYQRTVMH  297

Query  217  IRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPSQHHRSTYS  345
             RG    PN   W+     V+      F S+++ FR  +    + YS
Sbjct  298  QRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSNFKSPTGYS  344



>gb|EZF30130.1| hypothetical protein H101_06229 [Trichophyton interdigitale H6]
 gb|KDB22554.1| hypothetical protein H109_05547 [Trichophyton interdigitale MR816]
Length=382

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +1

Query  52   TCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGID  231
            +C +  E+R  + CGGV ++   G+G  G   II      AYL+GG  Y+   +H RG  
Sbjct  229  SCSYFFEVRTAAACGGVAASTDGGVGPAGIFGIIAGIAVAAYLIGGCAYQRTVMHQRGWR  288

Query  232  IIPNLEFWSSLPHKVQSWF----QSIAQRFR  312
              PN   WS     V   F     S+A  FR
Sbjct  289  QCPNYGMWSGAASFVGDMFIILWSSMANCFR  319



>gb|EKG17326.1| Mannose-6-phosphate receptor binding protein [Macrophomina phaseolina 
MS6]
Length=344

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +1

Query  55   CDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDI  234
            C +  E R  + CGG I  + + LG  G   +I++  F  Y +GG +Y+   +H RG   
Sbjct  218  CTYFFEARSKAACGG-IEKERQQLGPGGVFGVIVMIAFLVYFVGGCVYQRTVMHQRGWRQ  276

Query  235  IPNLEFWSSL  264
            IPN  FW S+
Sbjct  277  IPNFSFWESI  286



>emb|CDS08563.1| hypothetical protein LRAMOSA09924 [Absidia idahoensis var. thermophila]
Length=298

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  118  KGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS  282
            +G+   G    I+  L G Y +GG  Y Y   + RG+D+IP+ +FW  LP+ ++ 
Sbjct  222  EGMSGLGIFFTIVFVLLGVYFVGGAFYNYKVYNARGLDLIPHRDFWLDLPYLIKD  276



>gb|KIV88105.1| hypothetical protein, variant [Exophiala mesophila]
Length=297

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +1

Query  55   CDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCL-FGAYLLGGMIYRYFFLHIRGID  231
            C +  E+R  + CGG   ++ KG    G +  +IL +    YL+GG++Y+   +H RG  
Sbjct  190  CTYVFEVRSRNACGGTTQSEEKGTLGPGAVFAVILGIALLVYLIGGIVYQRNVMHQRGWR  249

Query  232  IIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQ  324
             +PN   W+ L   V S      +R R P+ 
Sbjct  250  QLPNYAVWAGLVSFVSSPLSLHNRRKRRPTN  280



>ref|XP_001244449.1| hypothetical protein CIMG_03890 [Coccidioides immitis RS]
Length=402

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 39/80 (49%), Gaps = 3/80 (4%)
 Frame = +1

Query  34   TLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRY  204
            T+  VGT   C +  E+R  + CGGV ++   GL   G   +I+      YL+GG  Y+ 
Sbjct  215  TVSYVGTLDSCSYYFEVRTAAACGGVAASTDGGLSPAGVFGVIVGIAVAVYLIGGCAYQR  274

Query  205  FFLHIRGIDIIPNLEFWSSL  264
              +H RG    PN   WS +
Sbjct  275  TVMHQRGWRQCPNYAMWSGM  294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875