BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN015A19

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593251.1|  PREDICTED: uncharacterized protein LOC104089939    323   5e-105   Nicotiana tomentosiformis
ref|XP_009788642.1|  PREDICTED: uncharacterized protein LOC104236423    322   2e-104   Nicotiana sylvestris
ref|XP_009757234.1|  PREDICTED: uncharacterized protein LOC104210124    322   2e-104   Nicotiana sylvestris
ref|XP_009604702.1|  PREDICTED: uncharacterized protein LOC104099425    320   7e-104   
ref|XP_006364820.1|  PREDICTED: uncharacterized protein LOC102595515    319   3e-103   Solanum tuberosum [potatoes]
emb|CDP04103.1|  unnamed protein product                                308   6e-103   Coffea canephora [robusta coffee]
ref|XP_004232603.1|  PREDICTED: uncharacterized protein LOC101245716    318   1e-102   Solanum lycopersicum
ref|XP_004248407.1|  PREDICTED: uncharacterized protein LOC101259294    317   1e-102   Solanum lycopersicum
ref|XP_010260816.1|  PREDICTED: uncharacterized protein LOC104599797    313   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_006352613.1|  PREDICTED: uncharacterized protein LOC102598072    313   5e-101   Solanum tuberosum [potatoes]
gb|KHN26585.1|  hypothetical protein glysoja_019824                     296   1e-98    Glycine soja [wild soybean]
ref|XP_007211819.1|  hypothetical protein PRUPE_ppa004238mg             307   2e-98    Prunus persica
ref|XP_004293801.1|  PREDICTED: uncharacterized protein LOC101301656    303   8e-97    Fragaria vesca subsp. vesca
ref|XP_008225942.1|  PREDICTED: uncharacterized protein LOC103325540    302   2e-96    Prunus mume [ume]
ref|XP_007138875.1|  hypothetical protein PHAVU_009G244900g             301   3e-96    Phaseolus vulgaris [French bean]
emb|CBI27377.3|  unnamed protein product                                290   5e-96    Vitis vinifera
gb|AGV54873.1|  hypothetical protein                                    300   7e-96    Phaseolus vulgaris [French bean]
ref|XP_011096871.1|  PREDICTED: uncharacterized protein LOC105175921    299   9e-96    Sesamum indicum [beniseed]
ref|XP_008356149.1|  PREDICTED: uncharacterized protein LOC103419837    290   9e-96    
gb|ABK94817.1|  unknown                                                 291   1e-95    Populus trichocarpa [western balsam poplar]
gb|EYU43615.1|  hypothetical protein MIMGU_mgv1a004537mg                300   1e-95    Erythranthe guttata [common monkey flower]
ref|XP_008383246.1|  PREDICTED: uncharacterized protein LOC103445969    299   3e-95    Malus domestica [apple tree]
ref|XP_009368565.1|  PREDICTED: uncharacterized protein LOC103958069    298   7e-95    Pyrus x bretschneideri [bai li]
ref|XP_002303721.1|  hypothetical protein POPTR_0003s15530g             292   2e-94    
ref|XP_010094640.1|  hypothetical protein L484_009885                   296   3e-94    Morus notabilis
ref|XP_003546382.1|  PREDICTED: uncharacterized protein LOC100787815    295   6e-94    Glycine max [soybeans]
ref|XP_003534854.1|  PREDICTED: uncharacterized protein LOC100795606    295   8e-94    Glycine max [soybeans]
ref|XP_007040980.1|  Domain of Uncharacterized protein function (...    293   4e-93    
ref|XP_002263686.1|  PREDICTED: uncharacterized protein LOC100251363    290   7e-92    Vitis vinifera
ref|XP_008364236.1|  PREDICTED: uncharacterized protein LOC103427929    290   1e-91    
ref|XP_010928822.1|  PREDICTED: uncharacterized protein LOC105050478    288   3e-91    Elaeis guineensis
ref|XP_011008216.1|  PREDICTED: uncharacterized protein LOC105113657    288   5e-91    Populus euphratica
ref|XP_002299381.2|  hypothetical protein POPTR_0001s12330g             287   9e-91    Populus trichocarpa [western balsam poplar]
ref|XP_004134511.1|  PREDICTED: uncharacterized protein LOC101220016    286   1e-90    Cucumis sativus [cucumbers]
ref|XP_010058074.1|  PREDICTED: uncharacterized protein LOC104445843    286   1e-90    Eucalyptus grandis [rose gum]
ref|XP_008439419.1|  PREDICTED: uncharacterized protein LOC103484233    286   2e-90    Cucumis melo [Oriental melon]
gb|KCW75585.1|  hypothetical protein EUGRSUZ_E04328                     286   2e-90    Eucalyptus grandis [rose gum]
ref|XP_008798470.1|  PREDICTED: uncharacterized protein LOC103713353    285   3e-90    Phoenix dactylifera
gb|KDP35088.1|  hypothetical protein JCGZ_10997                         285   7e-90    Jatropha curcas
ref|XP_003547803.1|  PREDICTED: uncharacterized protein LOC100816...    284   1e-89    Glycine max [soybeans]
gb|KHN25040.1|  hypothetical protein glysoja_049162                     283   2e-89    Glycine soja [wild soybean]
ref|XP_009363281.1|  PREDICTED: uncharacterized protein LOC103953269    284   2e-89    Pyrus x bretschneideri [bai li]
ref|XP_007156305.1|  hypothetical protein PHAVU_003G275200g             283   2e-89    Phaseolus vulgaris [French bean]
gb|KJB48060.1|  hypothetical protein B456_008G052100                    281   1e-88    Gossypium raimondii
ref|XP_011022744.1|  PREDICTED: uncharacterized protein LOC105124421    282   2e-88    Populus euphratica
ref|XP_006448575.1|  hypothetical protein CICLE_v10014882mg             281   2e-88    Citrus clementina [clementine]
ref|XP_006468595.1|  PREDICTED: uncharacterized protein LOC102614492    280   1e-87    Citrus sinensis [apfelsine]
gb|KDO77183.1|  hypothetical protein CISIN_1g009350mg                   280   1e-87    Citrus sinensis [apfelsine]
ref|XP_004488232.1|  PREDICTED: uncharacterized protein LOC101489232    279   1e-87    Cicer arietinum [garbanzo]
ref|XP_002533995.1|  conserved hypothetical protein                     279   1e-87    Ricinus communis
ref|XP_003628971.1|  hypothetical protein MTR_8g070700                  277   6e-87    Medicago truncatula
ref|XP_004509608.1|  PREDICTED: uncharacterized protein LOC101490982    276   6e-87    Cicer arietinum [garbanzo]
gb|KEH37330.1|  glycosyltransferase family 92 protein                   271   1e-84    Medicago truncatula
ref|XP_009406517.1|  PREDICTED: uncharacterized protein LOC103989411    268   1e-83    
ref|XP_010910220.1|  PREDICTED: uncharacterized protein LOC105036167    266   4e-83    Elaeis guineensis
ref|XP_006398091.1|  hypothetical protein EUTSA_v10000855mg             265   6e-82    Eutrema salsugineum [saltwater cress]
ref|XP_010529310.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    261   1e-80    
ref|XP_006413894.1|  hypothetical protein EUTSA_v10024965mg             257   3e-79    Eutrema salsugineum [saltwater cress]
emb|CDY69573.1|  BnaAnng30860D                                          257   3e-79    Brassica napus [oilseed rape]
emb|CDX78979.1|  BnaA01g10460D                                          257   3e-79    
emb|CDY31450.1|  BnaC03g63740D                                          256   3e-79    Brassica napus [oilseed rape]
ref|XP_009133537.1|  PREDICTED: uncharacterized protein LOC103858...    255   5e-79    
gb|KFK31618.1|  hypothetical protein AALP_AA6G136500                    256   6e-79    Arabis alpina [alpine rockcress]
ref|XP_002863553.1|  hypothetical protein ARALYDRAFT_494517             256   8e-79    
ref|XP_009133544.1|  PREDICTED: uncharacterized protein LOC103858...    256   8e-79    Brassica rapa
ref|XP_010441840.1|  PREDICTED: uncharacterized protein LOC104724...    254   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010441841.1|  PREDICTED: uncharacterized protein LOC104724...    254   4e-78    Camelina sativa [gold-of-pleasure]
ref|NP_199280.1|  uncharacterized protein                               254   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494514.1|  PREDICTED: uncharacterized protein LOC104771647    254   5e-78    Camelina sativa [gold-of-pleasure]
emb|CDY50064.1|  BnaCnng18710D                                          254   5e-78    Brassica napus [oilseed rape]
ref|XP_009108462.1|  PREDICTED: uncharacterized protein LOC103834153    253   5e-78    Brassica rapa
ref|XP_006280340.1|  hypothetical protein CARUB_v10026267mg             253   6e-78    Capsella rubella
ref|XP_010481723.1|  PREDICTED: uncharacterized protein LOC104760496    253   8e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010684202.1|  PREDICTED: uncharacterized protein LOC104898791    253   1e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006283465.1|  hypothetical protein CARUB_v10004512mg             254   2e-77    
ref|XP_010434312.1|  PREDICTED: uncharacterized protein LOC104718293    253   2e-77    Camelina sativa [gold-of-pleasure]
emb|CDY49028.1|  BnaAnng10220D                                          252   3e-77    Brassica napus [oilseed rape]
gb|AAL24253.1|  AT4g20170/F1C12_90                                      248   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101686.1|  PREDICTED: uncharacterized protein LOC103827882    252   4e-77    Brassica rapa
ref|XP_010439609.1|  PREDICTED: uncharacterized protein LOC104723016    251   5e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010449215.1|  PREDICTED: uncharacterized protein LOC104731515    251   5e-77    Camelina sativa [gold-of-pleasure]
ref|XP_002869945.1|  hypothetical protein ARALYDRAFT_492851             251   6e-77    
ref|XP_006855865.1|  hypothetical protein AMTR_s00037p00116470          250   2e-76    
ref|NP_193750.1|  uncharacterized protein                               249   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530546.1|  PREDICTED: uncharacterized protein LOC100795928    248   1e-75    
ref|XP_009388895.1|  PREDICTED: uncharacterized protein LOC103975...    244   3e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388894.1|  PREDICTED: uncharacterized protein LOC103975...    244   1e-74    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY71149.1|  BnaCnng71560D                                          226   4e-71    Brassica napus [oilseed rape]
gb|ACF84457.1|  unknown                                                 224   2e-68    Zea mays [maize]
ref|XP_010684201.1|  PREDICTED: uncharacterized protein LOC104898790    228   6e-68    Beta vulgaris subsp. vulgaris [field beet]
gb|EEC80517.1|  hypothetical protein OsI_22786                          221   3e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_003560772.1|  PREDICTED: uncharacterized protein LOC100838543    224   1e-66    Brachypodium distachyon [annual false brome]
ref|NP_001143123.1|  uncharacterized protein LOC100275601               224   2e-66    Zea mays [maize]
ref|XP_002436975.1|  hypothetical protein SORBIDRAFT_10g013010          223   5e-66    Sorghum bicolor [broomcorn]
ref|NP_001057533.1|  Os06g0328800                                       223   6e-66    
ref|XP_006656994.1|  PREDICTED: uncharacterized protein LOC102714566    219   7e-65    
ref|XP_010266306.1|  PREDICTED: uncharacterized protein LOC104603843    218   2e-64    Nelumbo nucifera [Indian lotus]
gb|EMT20191.1|  hypothetical protein F775_11280                         211   3e-64    
gb|KHG02318.1|  hypothetical protein F383_24787                         218   3e-64    Gossypium arboreum [tree cotton]
ref|XP_004301605.1|  PREDICTED: uncharacterized protein LOC101298030    218   4e-64    Fragaria vesca subsp. vesca
gb|EMS62496.1|  hypothetical protein TRIUR3_23927                       207   5e-64    Triticum urartu
gb|EEC73881.1|  hypothetical protein OsI_08667                          218   6e-64    Oryza sativa Indica Group [Indian rice]
ref|NP_001047907.2|  Os02g0712500                                       217   7e-64    
gb|KJB46310.1|  hypothetical protein B456_007G359700                    217   7e-64    Gossypium raimondii
ref|XP_008776506.1|  PREDICTED: uncharacterized protein LOC103696604    216   8e-64    Phoenix dactylifera
ref|XP_006647788.1|  PREDICTED: uncharacterized protein LOC102718338    216   1e-63    Oryza brachyantha
dbj|BAK07794.1|  predicted protein                                      216   2e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007208842.1|  hypothetical protein PRUPE_ppa025548mg             215   3e-63    Prunus persica
ref|NP_001145321.1|  uncharacterized protein LOC100278639               216   3e-63    Zea mays [maize]
gb|EMS60568.1|  hypothetical protein TRIUR3_26687                       208   5e-63    Triticum urartu
ref|XP_008237881.1|  PREDICTED: uncharacterized protein LOC103336601    215   5e-63    Prunus mume [ume]
ref|XP_010555291.1|  PREDICTED: uncharacterized protein LOC104824814    214   5e-63    
ref|XP_007028812.1|  Domain of Uncharacterized protein function (...    214   6e-63    
gb|EMT03263.1|  hypothetical protein F775_13698                         207   6e-63    
ref|NP_001130404.1|  uncharacterized protein LOC100191500               214   6e-63    Zea mays [maize]
ref|XP_010910409.1|  PREDICTED: uncharacterized protein LOC105036334    215   9e-63    Elaeis guineensis
ref|XP_010094491.1|  hypothetical protein L484_024782                   214   1e-62    Morus notabilis
ref|XP_010270611.1|  PREDICTED: uncharacterized protein LOC104606894    213   1e-62    Nelumbo nucifera [Indian lotus]
gb|KHG18440.1|  hypothetical protein F383_21802                         214   1e-62    Gossypium arboreum [tree cotton]
ref|XP_002879458.1|  hypothetical protein ARALYDRAFT_902431             213   2e-62    Arabidopsis lyrata subsp. lyrata
ref|XP_010927291.1|  PREDICTED: uncharacterized protein LOC105049368    213   2e-62    Elaeis guineensis
ref|XP_008796313.1|  PREDICTED: uncharacterized protein LOC103711805    213   2e-62    
gb|ACN33511.1|  unknown                                                 213   2e-62    Zea mays [maize]
ref|XP_009417284.1|  PREDICTED: uncharacterized protein LOC103997703    213   3e-62    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36038.1|  hypothetical protein B456_006G138000                    212   4e-62    Gossypium raimondii
ref|XP_011041123.1|  PREDICTED: uncharacterized protein LOC105137176    211   9e-62    Populus euphratica
gb|KDP36721.1|  hypothetical protein JCGZ_08012                         211   9e-62    Jatropha curcas
ref|XP_010509864.1|  PREDICTED: uncharacterized protein LOC104786207    211   9e-62    Camelina sativa [gold-of-pleasure]
emb|CBI40790.3|  unnamed protein product                                210   1e-61    Vitis vinifera
ref|NP_565768.1|  galactan synthase 1                                   210   2e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307008.1|  hypothetical protein POPTR_0005s28030g             210   2e-61    
emb|CDY27956.1|  BnaCnng05410D                                          207   3e-61    Brassica napus [oilseed rape]
ref|XP_002273918.1|  PREDICTED: uncharacterized protein LOC100247851    210   3e-61    
gb|EPS59182.1|  hypothetical protein M569_15627                         209   3e-61    Genlisea aurea
ref|XP_002452656.1|  hypothetical protein SORBIDRAFT_04g030080          210   4e-61    Sorghum bicolor [broomcorn]
ref|XP_011083362.1|  PREDICTED: uncharacterized protein LOC105165907    210   5e-61    
emb|CAN76802.1|  hypothetical protein VITISV_000632                     210   8e-61    Vitis vinifera
ref|XP_010666271.1|  PREDICTED: uncharacterized protein LOC104883439    209   9e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002437304.1|  hypothetical protein SORBIDRAFT_10g024570          209   1e-60    Sorghum bicolor [broomcorn]
ref|XP_006657150.1|  PREDICTED: uncharacterized protein LOC102701737    202   1e-60    
ref|XP_003563598.1|  PREDICTED: uncharacterized protein LOC100821285    208   1e-60    Brachypodium distachyon [annual false brome]
ref|XP_008782820.1|  PREDICTED: uncharacterized protein LOC103702263    208   1e-60    Phoenix dactylifera
ref|XP_010469454.1|  PREDICTED: uncharacterized protein LOC104749510    208   2e-60    Camelina sativa [gold-of-pleasure]
ref|XP_006294085.1|  hypothetical protein CARUB_v10023079mg             207   2e-60    Capsella rubella
ref|XP_010413841.1|  PREDICTED: uncharacterized protein LOC104700087    207   2e-60    Camelina sativa [gold-of-pleasure]
emb|CDY17187.1|  BnaA05g10010D                                          207   3e-60    Brassica napus [oilseed rape]
ref|XP_009143843.1|  PREDICTED: uncharacterized protein LOC103867522    207   3e-60    Brassica rapa
emb|CDX84681.1|  BnaA03g15490D                                          206   3e-60    
gb|KFK31016.1|  hypothetical protein AALP_AA6G057400                    207   3e-60    Arabis alpina [alpine rockcress]
ref|NP_001058107.1|  Os06g0624700                                       207   4e-60    
gb|EAZ37686.1|  hypothetical protein OsJ_22025                          207   6e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965848.1|  PREDICTED: uncharacterized protein LOC101759875    206   7e-60    Setaria italica
gb|EAZ01730.1|  hypothetical protein OsI_23756                          207   8e-60    Oryza sativa Indica Group [Indian rice]
emb|CDX79534.1|  BnaC03g18700D                                          205   1e-59    
gb|EYU41216.1|  hypothetical protein MIMGU_mgv1a005071mg                205   2e-59    Erythranthe guttata [common monkey flower]
gb|EMT15330.1|  hypothetical protein F775_17170                         206   2e-59    
ref|XP_002510749.1|  conserved hypothetical protein                     204   2e-59    Ricinus communis
dbj|BAJ98571.1|  predicted protein                                      207   2e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009132936.1|  PREDICTED: uncharacterized protein LOC103857495    204   3e-59    Brassica rapa
ref|XP_009415437.1|  PREDICTED: uncharacterized protein LOC103996273    204   5e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539085.1|  PREDICTED: uncharacterized protein LOC104813216    204   7e-59    Tarenaya hassleriana [spider flower]
dbj|BAK07243.1|  predicted protein                                      203   9e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010063184.1|  PREDICTED: uncharacterized protein LOC104450362    203   1e-58    Eucalyptus grandis [rose gum]
ref|XP_006410501.1|  hypothetical protein EUTSA_v10016550mg             201   5e-58    Eutrema salsugineum [saltwater cress]
ref|XP_010932160.1|  PREDICTED: uncharacterized protein LOC105052881    201   8e-58    Elaeis guineensis
ref|XP_010556045.1|  PREDICTED: uncharacterized protein LOC104825419    201   1e-57    Tarenaya hassleriana [spider flower]
ref|XP_008799144.1|  PREDICTED: uncharacterized protein LOC103713874    199   4e-57    Phoenix dactylifera
ref|XP_009778585.1|  PREDICTED: uncharacterized protein LOC104227908    196   2e-56    Nicotiana sylvestris
ref|XP_009595951.1|  PREDICTED: uncharacterized protein LOC104092135    195   6e-56    
ref|XP_003570222.1|  PREDICTED: uncharacterized protein LOC100831738    194   5e-55    Brachypodium distachyon [annual false brome]
ref|XP_004966964.1|  PREDICTED: uncharacterized protein LOC101757183    192   1e-54    Setaria italica
ref|XP_006342202.1|  PREDICTED: uncharacterized protein LOC102591298    189   1e-53    Solanum tuberosum [potatoes]
gb|AFK35556.1|  unknown                                                 178   3e-53    Lotus japonicus
ref|XP_004238474.1|  PREDICTED: uncharacterized protein LOC101247215    187   3e-53    Solanum lycopersicum
gb|EMS66628.1|  hypothetical protein TRIUR3_12773                       179   2e-52    Triticum urartu
ref|XP_002964794.1|  hypothetical protein SELMODRAFT_82649              160   4e-43    
ref|XP_002961724.1|  hypothetical protein SELMODRAFT_77156              160   8e-43    
ref|XP_001775945.1|  predicted protein                                  155   3e-41    
ref|XP_001777796.1|  predicted protein                                  148   7e-39    
ref|XP_001758982.1|  predicted protein                                  145   1e-37    
ref|NP_191658.1|  uncharacterized protein                               127   9e-34    Arabidopsis thaliana [mouse-ear cress]
ref|NP_187394.1|  uncharacterized protein                               125   8e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769268.1|  predicted protein                                  131   2e-32    
ref|XP_001759086.1|  predicted protein                                  130   6e-32    
ref|XP_001758423.1|  predicted protein                                  129   1e-31    
ref|XP_001757048.1|  predicted protein                                  123   3e-29    
ref|XP_008346109.1|  PREDICTED: uncharacterized protein LOC103409067    115   1e-26    
ref|XP_007040981.1|  Domain of Uncharacterized protein function i...    114   2e-26    
gb|KHN06995.1|  hypothetical protein glysoja_042235                     112   5e-26    Glycine soja [wild soybean]
gb|AFG70562.1|  hypothetical protein 0_12697_01                       97.1    4e-22    Pinus taeda
ref|XP_001778370.1|  predicted protein                                98.6    6e-21    
ref|XP_001785941.1|  predicted protein                                95.9    7e-20    
ref|XP_001767951.1|  predicted protein                                94.4    2e-19    
ref|XP_001777720.1|  predicted protein                                87.8    1e-16    
gb|AFG56179.1|  hypothetical protein 0_17802_01                       72.8    2e-13    Pinus taeda
gb|AEW08052.1|  hypothetical protein 0_17802_01                       68.9    5e-12    Pinus radiata
ref|XP_006435485.1|  hypothetical protein CICLE_v10003494mg           68.6    3e-11    
ref|XP_002965483.1|  hypothetical protein SELMODRAFT_406883           58.2    1e-06    Selaginella moellendorffii
ref|XP_002982958.1|  hypothetical protein SELMODRAFT_422280           57.0    2e-06    Selaginella moellendorffii
ref|XP_001784337.1|  predicted protein                                56.2    5e-06    
ref|XP_001629191.1|  predicted protein                                55.5    7e-06    Nematostella vectensis
gb|AAI63096.1|  Hypothetical protein LOC100005569                     49.7    7e-04    Danio rerio [leopard danio]
ref|NP_001116796.1|  uncharacterized protein LOC100005569             49.3    8e-04    Danio rerio [leopard danio]



>ref|XP_009593251.1| PREDICTED: uncharacterized protein LOC104089939 [Nicotiana tomentosiformis]
Length=499

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRYKFQAKWMFFFDVDEFIF+PKK+T+KSVVDSL  +TQFTIEQMPMSNKL
Sbjct  315  QFLIVNDCLHRYKFQAKWMFFFDVDEFIFVPKKSTIKSVVDSLADYTQFTIEQMPMSNKL  374

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N  G TTHKTE
Sbjct  375  CLSEDRGKSYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTE  434

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+RREPCRQLVN T + VDG  Y+VD TMRD+A  VKRFELK IG  L
Sbjct  435  GRIKYFHYHGTIAERREPCRQLVNATSITVDGTPYIVDTTMRDIAATVKRFELKMIGSTL  494

Query  543  QRTRQ  557
            QRTRQ
Sbjct  495  QRTRQ  499



>ref|XP_009788642.1| PREDICTED: uncharacterized protein LOC104236423 [Nicotiana sylvestris]
Length=496

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+FQAKWMFFFDVDEFIF+PKK+T+KSVVDSL  FTQFTIEQMPMSNKL
Sbjct  312  QFLIVNDCLHRYRFQAKWMFFFDVDEFIFVPKKSTIKSVVDSLSDFTQFTIEQMPMSNKL  371

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N  G TTHKTE
Sbjct  372  CLEEDRGKSYRKWGFEKLVYKDIKRGIRRDRKYAVQPRNVIATGVHMSQNIVGKTTHKTE  431

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+RREPCRQLVN T + VD   Y VD TMRD+AG VKRFELK IG VL
Sbjct  432  GRIKYFHYHGTIAERREPCRQLVNATAITVDRTPYAVDATMRDIAGTVKRFELKMIGSVL  491

Query  543  QRTRQ  557
            QRTRQ
Sbjct  492  QRTRQ  496



>ref|XP_009757234.1| PREDICTED: uncharacterized protein LOC104210124 [Nicotiana sylvestris]
Length=499

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRYKFQAKWMFFFDVDEFIF+PKK+T+KSVVDSL  +TQFTIEQMPMSNKL
Sbjct  315  QFLIVNDCLHRYKFQAKWMFFFDVDEFIFVPKKSTIKSVVDSLSDYTQFTIEQMPMSNKL  374

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N  G TTHKTE
Sbjct  375  CLSEDRGKSYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTE  434

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+RREPCRQLVN T + V+G  Y+VD TMRD+A  VKRFELK IG  L
Sbjct  435  GRIKYFHYHGTIAERREPCRQLVNATSITVEGTPYIVDTTMRDIAATVKRFELKMIGSTL  494

Query  543  QRTRQ  557
            QRTRQ
Sbjct  495  QRTRQ  499



>ref|XP_009604702.1| PREDICTED: uncharacterized protein LOC104099425 [Nicotiana tomentosiformis]
 ref|XP_009604703.1| PREDICTED: uncharacterized protein LOC104099425 [Nicotiana tomentosiformis]
Length=498

 Score =   320 bits (821),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+FQAKWMFFFDVDEFIF+PKK+T+K+VVDSL  FTQFTIEQMPMSNKL
Sbjct  314  QFLIVNDCLHRYRFQAKWMFFFDVDEFIFVPKKSTIKTVVDSLSDFTQFTIEQMPMSNKL  373

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N  G TTHKTE
Sbjct  374  CLEEDRGKSYRKWGFEKLVYKDIKRGIRRDRKYAVQPRNVIATGVHMSQNIVGKTTHKTE  433

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G I Y+HYHGTIA+RREPCRQLVN T + VD   Y VD TMRD+AG VKRFELK IGPVL
Sbjct  434  GLIKYFHYHGTIAERREPCRQLVNATAITVDRTPYAVDTTMRDIAGIVKRFELKMIGPVL  493

Query  543  QRTRQ  557
            QRTRQ
Sbjct  494  QRTRQ  498



>ref|XP_006364820.1| PREDICTED: uncharacterized protein LOC102595515 [Solanum tuberosum]
Length=512

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRYKFQAKWMFFFDVDE+IF+PKK+T+KSVV SL  FTQFTIEQMPMSNKL
Sbjct  328  QFLIVNDCLHRYKFQAKWMFFFDVDEYIFVPKKSTIKSVVKSLSDFTQFTIEQMPMSNKL  387

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD KTGIRRDRKYAVQPRNV A GVHMS+N  G TTHKTE
Sbjct  388  CLEEDRGKSYRKWGFEKLVYKDVKTGIRRDRKYAVQPRNVIANGVHMSQNTVGKTTHKTE  447

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+ REPCRQLVN T + VDGI Y VD TMRDVA  VKRFELK IG  L
Sbjct  448  GRIKYFHYHGTIAEHREPCRQLVNTTAITVDGIPYNVDTTMRDVAATVKRFELKMIGTTL  507

Query  543  QRTRQ  557
            QRTRQ
Sbjct  508  QRTRQ  512



>emb|CDP04103.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   308 bits (788),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHR+++ AKWMFFFDVDEF+F+PKK+TLK+V+DS   +TQFTIEQMPMSNKL
Sbjct  24   QFLVVNDCLHRHRYMAKWMFFFDVDEFLFVPKKSTLKTVMDSFSEYTQFTIEQMPMSNKL  83

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL EDAGK++RKWGFEKLV+KD K GIRRDRKY VQPRNV ATGVHMS+N  G TTHKTE
Sbjct  84   CLAEDAGKSYRKWGFEKLVYKDVKRGIRRDRKYVVQPRNVFATGVHMSQNTVGKTTHKTE  143

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRIMY+HYHGTIA RREPCR+ VN T + +DGI Y +D +MR VAG VKRFELK IG VL
Sbjct  144  GRIMYFHYHGTIADRREPCRRSVNTTDITIDGIPYSLDTSMRIVAGFVKRFELKMIGSVL  203

Query  543  QRTRQ  557
            QRTRQ
Sbjct  204  QRTRQ  208



>ref|XP_004232603.1| PREDICTED: uncharacterized protein LOC101245716 [Solanum lycopersicum]
Length=510

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRYKFQAKWMFFFDVDE+I++PKK+T+KSVV+SL  +TQFTIEQMPMSNKL
Sbjct  326  QFLIVNDCLHRYKFQAKWMFFFDVDEYIYVPKKSTIKSVVNSLSDYTQFTIEQMPMSNKL  385

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD KTGIRRDRKYAVQPRNV A GVHMS+N  G TTHKTE
Sbjct  386  CLEEDRGKSYRKWGFEKLVYKDVKTGIRRDRKYAVQPRNVIANGVHMSQNTVGKTTHKTE  445

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+ REPCRQLVN T + VDGI Y VD TMRDVA  VKRFELK IG  L
Sbjct  446  GRIKYFHYHGTIAEHREPCRQLVNTTAITVDGIPYNVDTTMRDVAATVKRFELKMIGTTL  505

Query  543  QRTRQ  557
            QRTRQ
Sbjct  506  QRTRQ  510



>ref|XP_004248407.1| PREDICTED: uncharacterized protein LOC101259294 [Solanum lycopersicum]
Length=480

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLH+Y+FQAKWMFFFDVDEFIF+PKK+T+KSVVDSL  +TQFTIEQMPMSNKL
Sbjct  296  QFLIVNDCLHKYRFQAKWMFFFDVDEFIFVPKKSTIKSVVDSLSDYTQFTIEQMPMSNKL  355

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N  G TTHKTE
Sbjct  356  CLEEDRGKSYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTE  415

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+ REPCRQLVN T + VD I Y VD TMRD+AG VKRFELK IG  L
Sbjct  416  GRIKYFHYHGTIAEHREPCRQLVNATTITVDQIPYEVDSTMRDIAGTVKRFELKMIGSTL  475

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  476  QKTRQ  480



>ref|XP_010260816.1| PREDICTED: uncharacterized protein LOC104599797 [Nelumbo nucifera]
Length=495

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F AKWMFFFDVDE++++P K+T+KSV+DSL  +TQFTIEQMPMSNKL
Sbjct  311  QFLVVNDCLHRYRFMAKWMFFFDVDEYVYVPPKSTIKSVLDSLSDYTQFTIEQMPMSNKL  370

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL EDAGKT+RKWGFEKLVFKD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  371  CLAEDAGKTYRKWGFEKLVFKDVKKGIRRDRKYAVQPRNVFATGVHMSQNVAGKTTHKTE  430

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA RREPCRQLVN T L V+GI Y +D T+RD A +VKRFELKTIG  L
Sbjct  431  GRIKYFHYHGTIADRREPCRQLVNVTHLTVEGIPYELDSTLRDAAQSVKRFELKTIGSRL  490

Query  543  QRTRQ  557
            QRTRQ
Sbjct  491  QRTRQ  495



>ref|XP_006352613.1| PREDICTED: uncharacterized protein LOC102598072 [Solanum tuberosum]
Length=503

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLH+Y+FQAKWMFFFDVDEFIF+PKK+T+KSVV+SL  +TQFTIEQMPMSNKL
Sbjct  319  QFLIVNDCLHKYRFQAKWMFFFDVDEFIFVPKKSTIKSVVNSLSDYTQFTIEQMPMSNKL  378

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GK++RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N  G TTHKTE
Sbjct  379  CLEEDRGKSYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTE  438

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+ REPCRQLVN T + VD   Y VD TMRD+AG VKRFELK IG  L
Sbjct  439  GRIKYFHYHGTIAEHREPCRQLVNATTITVDQTPYEVDTTMRDIAGTVKRFELKMIGSTL  498

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  499  QKTRQ  503



>gb|KHN26585.1| hypothetical protein glysoja_019824 [Glycine soja]
Length=209

 Score =   296 bits (759),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+T+KSV+DSL  ++QFTIEQMPMS+KL
Sbjct  24   QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKL  83

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWGFEKLV+KDSK GIRRDRKYAVQPR++ ATGVHMS+N AG TTHKTE
Sbjct  84   CLTSDYGKTYRKWGFEKLVYKDSKKGIRRDRKYAVQPRSLYATGVHMSQNLAGKTTHKTE  143

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+IMYYHYHGTIA++RE C+ L+N T +  D   YV+D TMRD+AG +K+FELK IG  L
Sbjct  144  GKIMYYHYHGTIAEKRESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGDRL  203

Query  543  Q-RTRQ  557
            Q +TRQ
Sbjct  204  QHKTRQ  209



>ref|XP_007211819.1| hypothetical protein PRUPE_ppa004238mg [Prunus persica]
 gb|EMJ13018.1| hypothetical protein PRUPE_ppa004238mg [Prunus persica]
Length=521

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+ +KSV+DSL  +TQFTIEQMPMSNKL
Sbjct  337  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKL  396

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  397  CLSSDYGKTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTE  456

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA RREPCRQLVN T   VD I YV+D TMRDVAG+VKRFEL+ IG  L
Sbjct  457  NRIKYFHYHGTIANRREPCRQLVNSTETNVDKIPYVMDTTMRDVAGSVKRFELRMIGNRL  516

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  517  QKTRQ  521



>ref|XP_004293801.1| PREDICTED: uncharacterized protein LOC101301656 [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+T+K+V+DSL  ++QFTIEQMPMSNKL
Sbjct  328  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYMPPKSTIKTVLDSLAEYSQFTIEQMPMSNKL  387

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED  KT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV  TGVHMS+N AG TTHKTE
Sbjct  388  CLLEDYHKTNRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYGTGVHMSQNIAGKTTHKTE  447

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA RREPC++L+NDT++ +D + YV+D TMRDVAGAVKRFEL+ IG  L
Sbjct  448  NRIKYFHYHGTIADRREPCKKLINDTQIYLDKVPYVIDTTMRDVAGAVKRFELRMIGSRL  507

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  508  QQTRQ  512



>ref|XP_008225942.1| PREDICTED: uncharacterized protein LOC103325540 [Prunus mume]
Length=520

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+ +KSV+DSL  +TQFTIEQMPMSNKL
Sbjct  336  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKL  395

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D  KT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  396  CLSADYRKTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTE  455

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA RREPCRQLVN T   VD I YV+D TMRDVAG+VKRFEL+ IG  L
Sbjct  456  NRIKYFHYHGTIANRREPCRQLVNATETNVDKIPYVMDTTMRDVAGSVKRFELRMIGNRL  515

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  516  QKTRQ  520



>ref|XP_007138875.1| hypothetical protein PHAVU_009G244900g [Phaseolus vulgaris]
 gb|ESW10869.1| hypothetical protein PHAVU_009G244900g [Phaseolus vulgaris]
Length=514

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF  KWMFFFDVDE+IF+P K+T+KSV+DSL  ++QFTIEQMPMS+KL
Sbjct  330  QFMVVNDCLHRYKFMTKWMFFFDVDEYIFVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKL  389

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWGFEKLV+KDSK GIRRDRKYAVQPR++ ATGVHMS+N AG TTHKTE
Sbjct  390  CLTSDYGKTYRKWGFEKLVYKDSKKGIRRDRKYAVQPRSLFATGVHMSQNLAGKTTHKTE  449

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+IMYYHYHGTIA+RRE C+ L+N T +  D   YV+D TMRD+AG +K+FELK IG  L
Sbjct  450  GKIMYYHYHGTIAERRESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGNRL  509

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  510  QKTRQ  514



>emb|CBI27377.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F AKWMFFFDVDE+I++P KNT+KSV++SL  +TQFTIEQMP+SNKL
Sbjct  24   QFLVVNDCLHRYRFMAKWMFFFDVDEYIYVPPKNTIKSVLNSLSGYTQFTIEQMPISNKL  83

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  DAGK  RKWGFEKLV++D K GIRRDRKYAVQPRNV ATGVH+S+N AG TTHKT+
Sbjct  84   CLSSDAGKAPRKWGFEKLVYRDVKRGIRRDRKYAVQPRNVFATGVHLSQNLAGKTTHKTD  143

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
              + Y+HYHGT+A+RREPCR++VN T L  DG  YV+D TMR VAG+VK FELK IG  L
Sbjct  144  HLVKYFHYHGTVAERREPCRKMVNTTELTFDGTPYVMDTTMRAVAGSVKIFELKAIGSRL  203

Query  543  QRTRQ  557
            QRT Q
Sbjct  204  QRTPQ  208



>gb|AGV54873.1| hypothetical protein [Phaseolus vulgaris]
Length=514

 Score =   300 bits (768),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF  KWMFFFDVDE+IF+P K+T+KSV+DSL  ++QFTIEQMPMS+KL
Sbjct  330  QFMVVNDCLHRYKFMTKWMFFFDVDEYIFVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKL  389

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWGFEKLV+KDSK GIRRDRKYAVQPR++ ATGVHMS+N AG TTHKTE
Sbjct  390  CLTSDYGKTYRKWGFEKLVYKDSKKGIRRDRKYAVQPRSLFATGVHMSQNLAGKTTHKTE  449

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+IMYYHYHGTIA+RRE C+ L+N T +  D   YV+D TMRD+AG +K+FELK IG  L
Sbjct  450  GKIMYYHYHGTIAERRESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGNRL  509

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  510  QKTRQ  514



>ref|XP_011096871.1| PREDICTED: uncharacterized protein LOC105175921 [Sesamum indicum]
Length=481

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+F AKW+FFFDVDEFIF+PKK T+ S++DSL  FTQFTIEQMPMSNKL
Sbjct  297  QFLIVNDCLHRYRFAAKWIFFFDVDEFIFVPKKTTINSILDSLTEFTQFTIEQMPMSNKL  356

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  +DA    RKWGFEKLV+KD K GIRRDRKYAVQP +V ATGVHMS+N  G TTHKTE
Sbjct  357  CFSQDAPTAFRKWGFEKLVYKDVKRGIRRDRKYAVQPLSVFATGVHMSQNIVGKTTHKTE  416

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA RREPC+Q +N T   VDG  Y+VD TMRD+AGAVKRFELK IG  L
Sbjct  417  GRIKYFHYHGTIAMRREPCQQFLNSTETTVDGTPYIVDTTMRDIAGAVKRFELKMIGSRL  476

Query  543  QRTRQ  557
            QRTRQ
Sbjct  477  QRTRQ  481



>ref|XP_008356149.1| PREDICTED: uncharacterized protein LOC103419837, partial [Malus 
domestica]
Length=222

 Score =   290 bits (742),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCL RYKF AKWMFFFDVDE+I++P K+ LKSV+DSL  +TQFTIEQMPMS+KL
Sbjct  38   QFMVVNDCLFRYKFMAKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKL  97

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED  KT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  98   CLLEDYHKTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTE  157

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA R EPCR+L+N T + VD + Y VD T+R VAG+VK+FEL+ IG  L
Sbjct  158  SRIQYFHYHGTIATRGEPCRRLINTTEIYVDKVPYAVDTTLRSVAGSVKKFELRMIGSRL  217

Query  543  QRTRQ  557
            Q TRQ
Sbjct  218  QNTRQ  222



>gb|ABK94817.1| unknown [Populus trichocarpa]
Length=272

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P KNT+KSV+DSL  +TQFT EQMPMS+KL
Sbjct  88   QFMVVNDCLHRYKFMAKWMFFFDVDEYIYLPPKNTIKSVLDSLSGYTQFTFEQMPMSSKL  147

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D G+ +RKWG EKLV++D K GIRRDRKYA+QPRNV ATGVHMS+N AG TT+KTE
Sbjct  148  CLSADYGRYYRKWGIEKLVYRDVKRGIRRDRKYAIQPRNVFATGVHMSQNFAGKTTYKTE  207

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+I Y+HYHGTIAQRREPCR L+N T +  + + YV+D TMRD+A +VK+FELKTIGP L
Sbjct  208  GKIKYFHYHGTIAQRREPCRNLLNVTEINFENVPYVLDTTMRDLAWSVKKFELKTIGPKL  267

Query  543  QRTRQ  557
            Q TRQ
Sbjct  268  QNTRQ  272



>gb|EYU43615.1| hypothetical protein MIMGU_mgv1a004537mg [Erythranthe guttata]
Length=522

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+F AKW+FFFDVDEFIF+PKK+ + S++DSL  FTQFT EQMPMSNKL
Sbjct  338  QFLIVNDCLHRYRFAAKWLFFFDVDEFIFVPKKSNINSILDSLSSFTQFTFEQMPMSNKL  397

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +DA    RKWGFEKLV+KD K GIR+DRKYAVQPR+V ATGVHMS+N  G TTH T+
Sbjct  398  CLSQDAPTAFRKWGFEKLVYKDVKRGIRKDRKYAVQPRSVFATGVHMSQNIVGKTTHNTD  457

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+RREPCRQ +N T + VD I YV+D TMRD+AGAVKRFELK IG  L
Sbjct  458  GRIKYFHYHGTIAERREPCRQFINSTEITVDTIPYVMDTTMRDIAGAVKRFELKMIGSAL  517

Query  543  QRTRQ  557
            QRTRQ
Sbjct  518  QRTRQ  522



>ref|XP_008383246.1| PREDICTED: uncharacterized protein LOC103445969 [Malus domestica]
Length=525

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+ +KSV+DSL  +TQFTIEQMPMSNKL
Sbjct  341  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKL  400

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED  KT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  401  CLFEDYRKTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTE  460

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA RREPCRQL+N T+  VD I YVVD TMR VAG+VK+FEL+ IG  L
Sbjct  461  RRIKYFHYHGTIATRREPCRQLINATQTNVDQIPYVVDTTMRTVAGSVKKFELRMIGDRL  520

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  521  QKTRQ  525



>ref|XP_009368565.1| PREDICTED: uncharacterized protein LOC103958069 [Pyrus x bretschneideri]
Length=520

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+ +KSV+DSL  +TQFTIEQMPMSNKL
Sbjct  336  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKL  395

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED  KT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  396  CLFEDYRKTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTE  455

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA RREPCRQL+N T   VD I YVVD TMR VAG+VK+FEL+ IG  L
Sbjct  456  RRIKYFHYHGTIATRREPCRQLINTTETNVDQIPYVVDTTMRMVAGSVKKFELRMIGDRL  515

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  516  QKTRQ  520



>ref|XP_002303721.1| hypothetical protein POPTR_0003s15530g [Populus trichocarpa]
 gb|EEE78700.1| hypothetical protein POPTR_0003s15530g [Populus trichocarpa]
Length=387

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P KNT+KSV+DSL  +TQFT EQMPMS+KL
Sbjct  203  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYLPPKNTIKSVLDSLSGYTQFTFEQMPMSSKL  262

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D G+ +RKWG EKLV++D K GIRRDRKYA+QPRNV ATGVHMS+N AG TT+KTE
Sbjct  263  CLSADYGRYYRKWGIEKLVYRDVKRGIRRDRKYAIQPRNVFATGVHMSQNFAGKTTYKTE  322

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+I Y+HYHGTIAQRREPCR L+N T +  + + YV+D TMRD+A +VK+FELKTIGP L
Sbjct  323  GKIKYFHYHGTIAQRREPCRNLLNVTEINFENVPYVLDTTMRDLAWSVKKFELKTIGPKL  382

Query  543  QRTRQ  557
            Q TRQ
Sbjct  383  QNTRQ  387



>ref|XP_010094640.1| hypothetical protein L484_009885 [Morus notabilis]
 gb|EXB56459.1| hypothetical protein L484_009885 [Morus notabilis]
Length=524

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDEFI++P+KNT+KSV+DSL  ++QFTIEQMPMS KL
Sbjct  340  QFMVVNDCLHRYKFMAKWMFFFDVDEFIYVPRKNTIKSVLDSLSEYSQFTIEQMPMSCKL  399

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +DAGKT+RKWGFEKLV++D K GIRRDRKY VQPR+V A GVHMS+N AG TTHKTE
Sbjct  400  CLSDDAGKTYRKWGFEKLVYRDVKRGIRRDRKYVVQPRSVYAAGVHMSQNLAGKTTHKTE  459

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRIMY+HYHGTIAQRREPCR L N T    +   YV+D TMR++AG VK+FELK IG  L
Sbjct  460  GRIMYFHYHGTIAQRREPCRNLGNWTETTFENNPYVLDTTMRNIAGFVKKFELKMIGSRL  519

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  520  QKTRQ  524



>ref|XP_003546382.1| PREDICTED: uncharacterized protein LOC100787815 [Glycine max]
Length=515

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+T+KSV+DSL  ++QFTIEQMPMS+KL
Sbjct  330  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKL  389

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWGFEKLV+KDSK GIRRDRKYAVQPR++ ATGVHMS+N AG TTHKTE
Sbjct  390  CLTADYGKTYRKWGFEKLVYKDSKKGIRRDRKYAVQPRSLYATGVHMSQNLAGKTTHKTE  449

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGP-V  539
            G+IMYYHYHGTIA++RE C+ L+N T +  D   YV+D TMRD+AG +K+FELK IG  V
Sbjct  450  GKIMYYHYHGTIAEKRESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGDRV  509

Query  540  LQRTRQ  557
             Q+TRQ
Sbjct  510  QQKTRQ  515



>ref|XP_003534854.1| PREDICTED: uncharacterized protein LOC100795606 [Glycine max]
Length=527

 Score =   295 bits (755),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+T+KSV+DSL  ++QFTIEQMPMS+KL
Sbjct  342  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKL  401

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWGFEKLV+KDSK GIRRDRKYAVQPR++ ATGVHMS+N AG TTHKTE
Sbjct  402  CLTSDYGKTYRKWGFEKLVYKDSKKGIRRDRKYAVQPRSLYATGVHMSQNLAGKTTHKTE  461

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+IMYYHYHGTIA++RE C+ L+N T +  D   YV+D TMRD+AG +K+FELK IG  L
Sbjct  462  GKIMYYHYHGTIAEKRESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGDRL  521

Query  543  Q-RTRQ  557
            Q +TRQ
Sbjct  522  QHKTRQ  527



>ref|XP_007040980.1| Domain of Uncharacterized protein function (DUF23) isoform 1 
[Theobroma cacao]
 gb|EOX96811.1| Domain of Uncharacterized protein function (DUF23) isoform 1 
[Theobroma cacao]
Length=516

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKW+FFFDVDEFI++P K+T++SV+DSL  ++QFTIEQMPMS+KL
Sbjct  332  QFMVVNDCLHRYKFMAKWIFFFDVDEFIYVPPKSTIRSVLDSLSDYSQFTIEQMPMSSKL  391

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   DA K +RKWGFEKLV++D K GIRRDRKYA+QPRNV ATGVHMS+N AG TTHKTE
Sbjct  392  CHTVDAAKRNRKWGFEKLVYRDVKKGIRRDRKYAIQPRNVFATGVHMSQNLAGKTTHKTE  451

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA+RREPCR L+N T +  +   YV+D T+RDVAGAVK+FELK IGP L
Sbjct  452  GRIKYFHYHGTIAERREPCRYLINSTEINYEKTPYVLDTTLRDVAGAVKKFELKMIGPRL  511

Query  543  QRTRQ  557
            Q TRQ
Sbjct  512  QNTRQ  516



>ref|XP_002263686.1| PREDICTED: uncharacterized protein LOC100251363 [Vitis vinifera]
Length=526

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F AKWMFFFDVDE+I++P KNT+KSV++SL  +TQFTIEQMP+SNKL
Sbjct  342  QFLVVNDCLHRYRFMAKWMFFFDVDEYIYVPPKNTIKSVLNSLSGYTQFTIEQMPISNKL  401

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  DAGK  RKWGFEKLV++D K GIRRDRKYAVQPRNV ATGVH+S+N AG TTHKT+
Sbjct  402  CLSSDAGKAPRKWGFEKLVYRDVKRGIRRDRKYAVQPRNVFATGVHLSQNLAGKTTHKTD  461

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
              + Y+HYHGT+A+RREPCR++VN T L  DG  YV+D TMR VAG+VK FELK IG  L
Sbjct  462  HLVKYFHYHGTVAERREPCRKMVNTTELTFDGTPYVMDTTMRAVAGSVKIFELKAIGSRL  521

Query  543  QRTRQ  557
            QRT Q
Sbjct  522  QRTPQ  526



>ref|XP_008364236.1| PREDICTED: uncharacterized protein LOC103427929 [Malus domestica]
Length=522

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCL RYKF AKWMFFFDVDE+I++P K+ LKSV+DSL  +TQFTIEQMPMS+KL
Sbjct  338  QFMVVNDCLFRYKFMAKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKL  397

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED  KT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  398  CLLEDYHKTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTE  457

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA R EPCR+L+N T + VD + Y VD T+R VAG+VK+FEL+ IG  L
Sbjct  458  SRIQYFHYHGTIATRGEPCRRLINTTEIYVDKVPYAVDTTLRSVAGSVKKFELRMIGSRL  517

Query  543  QRTRQ  557
            Q TRQ
Sbjct  518  QNTRQ  522



>ref|XP_010928822.1| PREDICTED: uncharacterized protein LOC105050478 [Elaeis guineensis]
Length=505

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F AKWMFFFDVDEFI++  K TL+SV+     +TQFTIEQMPMSNKL
Sbjct  321  QFLVVNDCLHRYRFMAKWMFFFDVDEFIYVQPKTTLQSVLALFSSYTQFTIEQMPMSNKL  380

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  DAGKT R WGFEKLV++D K G+RRDRKYA+QPRNV ATGVHMS+N AG + HKTE
Sbjct  381  CLSSDAGKTPRMWGFEKLVYRDVKRGVRRDRKYAIQPRNVFATGVHMSQNIAGRSLHKTE  440

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA RR PC+  VNDT L  +G  YV DPT+R +AG VKRFELKTIG  L
Sbjct  441  GRIKYFHYHGTIADRRYPCKVFVNDTTLTFEGTPYVFDPTLRQLAGLVKRFELKTIGSRL  500

Query  543  QRTRQ  557
            QRTRQ
Sbjct  501  QRTRQ  505



>ref|XP_011008216.1| PREDICTED: uncharacterized protein LOC105113657 [Populus euphratica]
Length=515

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF  KWMFFFDVDE+I +P+KNT+KSV+DSL  +TQFTIEQMPM+NKL
Sbjct  331  QFMVVNDCLHRYKFMTKWMFFFDVDEYIHVPQKNTIKSVLDSLSDYTQFTIEQMPMNNKL  390

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D G+ +RKWGFEKLV+KD K GIRRDRKYA+QPRNV ATGVHMS+N AG TTHKTE
Sbjct  391  CLSADYGRYYRKWGFEKLVYKDVKRGIRRDRKYAIQPRNVFATGVHMSQNVAGKTTHKTE  450

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G I Y+HYHGTIAQRREPCR L+N T +  +   YV+D TMRD+A +VK+FE + IGP L
Sbjct  451  GMIRYFHYHGTIAQRREPCRNLLNVTEINFENNPYVLDTTMRDLAWSVKKFENQMIGPKL  510

Query  543  QRTRQ  557
            + TRQ
Sbjct  511  KNTRQ  515



>ref|XP_002299381.2| hypothetical protein POPTR_0001s12330g [Populus trichocarpa]
 gb|EEE84186.2| hypothetical protein POPTR_0001s12330g [Populus trichocarpa]
Length=515

 Score =   287 bits (734),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I +P+KNT+KSV+DSL  +TQFTIEQMPM+NKL
Sbjct  331  QFMVVNDCLHRYKFMAKWMFFFDVDEYIHVPQKNTIKSVLDSLSDYTQFTIEQMPMNNKL  390

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D G+ +RKWGFEKLV+KD K GIRRDRKYA+QPRNV ATGVHMS+N AG TTHKTE
Sbjct  391  CLSADYGRYYRKWGFEKLVYKDVKRGIRRDRKYAIQPRNVFATGVHMSQNVAGKTTHKTE  450

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G I Y+HYHGT AQRREPCR L+N T +  +   YV+D TMRD+A +VK+FE + IGP L
Sbjct  451  GMIRYFHYHGTAAQRREPCRNLLNVTEINFENNPYVLDTTMRDLAWSVKKFENQMIGPKL  510

Query  543  QRTRQ  557
            + TRQ
Sbjct  511  KNTRQ  515



>ref|XP_004134511.1| PREDICTED: uncharacterized protein LOC101220016 [Cucumis sativus]
 ref|XP_004164831.1| PREDICTED: uncharacterized LOC101220016 [Cucumis sativus]
 gb|KGN49546.1| hypothetical protein Csa_6G538750 [Cucumis sativus]
Length=499

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF A+WMFFFD+DEFI++P KNT+KSV+DSL  ++QFTIEQMPM++K 
Sbjct  315  QFMVVNDCLHRYKFMARWMFFFDIDEFIYVPPKNTIKSVLDSLSEYSQFTIEQMPMNSKT  374

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL EDAG+T+RKWGFEKLV+KD K GIRRDRKYAVQPR V ATGVHMSEN  G TTHKTE
Sbjct  375  CLTEDAGRTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRRVYATGVHMSENVDGKTTHKTE  434

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G I Y+HYHGTIAQRREPCR L N T+  ++   +++D TMR VA AVKRFELK IG  L
Sbjct  435  GIIKYFHYHGTIAQRREPCRTLSNLTQFNLEDTPFLMDTTMRLVAPAVKRFELKMIGTRL  494

Query  543  QRTRQ  557
            Q TRQ
Sbjct  495  QSTRQ  499



>ref|XP_010058074.1| PREDICTED: uncharacterized protein LOC104445843 [Eucalyptus grandis]
Length=508

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 153/187 (82%), Gaps = 2/187 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF  KWMFFFDVDEFI++P KNTL+SV+DSL  ++Q TIEQMPMSNKL
Sbjct  322  QFMVVNDCLHRYKFMTKWMFFFDVDEFIYVPPKNTLRSVLDSLSEYSQITIEQMPMSNKL  381

Query  183  CLREDAG--KTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHK  356
            C  ++AG  +T+RKWGFEKLV+KD K GIRRDRKYAVQPR V ATGVHMS+N  G T HK
Sbjct  382  CFVDEAGAGRTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRAVYATGVHMSQNLKGRTNHK  441

Query  357  TEGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGP  536
            TE RI Y+HYHGTIA+RREPCR LVN T +  D + YV+D TMRD  GAVKRFE K IG 
Sbjct  442  TERRIKYFHYHGTIAERREPCRNLVNSTEITFDKVPYVLDTTMRDAGGAVKRFEFKMIGD  501

Query  537  VLQRTRQ  557
             LQRTRQ
Sbjct  502  RLQRTRQ  508



>ref|XP_008439419.1| PREDICTED: uncharacterized protein LOC103484233 [Cucumis melo]
Length=497

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFD+DEFI++P K+T+KSV+DSL  ++QFTIEQMPM++K 
Sbjct  313  QFMVVNDCLHRYKFMAKWMFFFDIDEFIYVPPKSTIKSVLDSLSEYSQFTIEQMPMNSKT  372

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL EDAG+T+RKWGFEKLV+KD K GIRRDRKYAVQPR V ATGVHMSEN  G TTHKTE
Sbjct  373  CLTEDAGRTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRRVYATGVHMSENVDGKTTHKTE  432

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G I Y+HYHGTIAQRREPCR L N T+   +   +++D TMR VA AVKRFELK IG  L
Sbjct  433  GIIKYFHYHGTIAQRREPCRTLSNLTQFTAEDTPFLLDTTMRLVAPAVKRFELKMIGTRL  492

Query  543  QRTRQ  557
            Q TRQ
Sbjct  493  QSTRQ  497



>gb|KCW75585.1| hypothetical protein EUGRSUZ_E04328 [Eucalyptus grandis]
Length=532

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 153/187 (82%), Gaps = 2/187 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF  KWMFFFDVDEFI++P KNTL+SV+DSL  ++Q TIEQMPMSNKL
Sbjct  346  QFMVVNDCLHRYKFMTKWMFFFDVDEFIYVPPKNTLRSVLDSLSEYSQITIEQMPMSNKL  405

Query  183  CLREDAG--KTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHK  356
            C  ++AG  +T+RKWGFEKLV+KD K GIRRDRKYAVQPR V ATGVHMS+N  G T HK
Sbjct  406  CFVDEAGAGRTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRAVYATGVHMSQNLKGRTNHK  465

Query  357  TEGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGP  536
            TE RI Y+HYHGTIA+RREPCR LVN T +  D + YV+D TMRD  GAVKRFE K IG 
Sbjct  466  TERRIKYFHYHGTIAERREPCRNLVNSTEITFDKVPYVLDTTMRDAGGAVKRFEFKMIGD  525

Query  537  VLQRTRQ  557
             LQRTRQ
Sbjct  526  RLQRTRQ  532



>ref|XP_008798470.1| PREDICTED: uncharacterized protein LOC103713353 [Phoenix dactylifera]
Length=505

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F AKWMFFFDVDEFI++  K TL+SV+ SL  +TQFTIEQMPMS+KL
Sbjct  321  QFLVVNDCLHRYRFMAKWMFFFDVDEFIYVQPKTTLESVLASLSGYTQFTIEQMPMSSKL  380

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   DAGKT R WGFEKLV++D K G+RRDRKYA+QPRNV ATGVHMS+N  G   HKTE
Sbjct  381  CRSSDAGKTTRMWGFEKLVYRDVKRGVRRDRKYAIQPRNVFATGVHMSQNMVGRNLHKTE  440

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIA RR PC+  +NDT L VDG  YV DPT+R +AG+VKRFELK +G  L
Sbjct  441  GRIRYFHYHGTIADRRYPCKVFINDTTLTVDGTPYVFDPTLRQLAGSVKRFELKALGSRL  500

Query  543  QRTRQ  557
            QRTRQ
Sbjct  501  QRTRQ  505



>gb|KDP35088.1| hypothetical protein JCGZ_10997 [Jatropha curcas]
Length=526

 Score =   285 bits (729),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKW+FFFDVDE+I++P KNT+KSV+DSL  +TQFTIEQMPMSNKL
Sbjct  342  QFMVVNDCLHRYKFMAKWIFFFDVDEYIYVPPKNTIKSVLDSLSDYTQFTIEQMPMSNKL  401

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D G+ +RKWGFEKLV++D K GIRRDRKYA+QPRNV ATGVHMS+N AG TTHKT+
Sbjct  402  CLSADYGRYYRKWGFEKLVYRDIKRGIRRDRKYAIQPRNVFATGVHMSQNLAGKTTHKTD  461

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             ++ Y+HYHGTIAQRREPCR L+N T +  +   YV+D TMRD+A +VK+FE K IG  L
Sbjct  462  SKVKYFHYHGTIAQRREPCRNLLNVTEINYENNPYVLDTTMRDIAWSVKKFEQKMIGTRL  521

Query  543  QRTRQ  557
            Q TRQ
Sbjct  522  QNTRQ  526



>ref|XP_003547803.1| PREDICTED: uncharacterized protein LOC100816013 isoform 1 [Glycine 
max]
Length=505

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K T+KSV+ SL  + QFTIEQMPMS+K+
Sbjct  321  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKTTIKSVLHSLSEYDQFTIEQMPMSSKI  380

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GKT+RKWGFEKLV++DS TGIRRDRKYAVQPR++ ATGVHMS + +G TTHKTE
Sbjct  381  CLSEDYGKTYRKWGFEKLVYRDSITGIRRDRKYAVQPRSLYATGVHMSMDLSGKTTHKTE  440

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTI++RRE C+ LVN T++  + I YV+D TMRD AG +K+FELK IG  L
Sbjct  441  GRIKYFHYHGTISERRETCKILVNTTQVTQNKIPYVMDTTMRDTAGVIKKFELKMIGTRL  500

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  501  QKTRQ  505



>gb|KHN25040.1| hypothetical protein glysoja_049162 [Glycine soja]
Length=505

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K T+KSV+ SL  + QFTIEQMPMS+K+
Sbjct  321  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKTTIKSVLHSLSEYDQFTIEQMPMSSKI  380

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GKT+RKWGFEKLV++DS TGIRRDRKYAVQPR++ ATGVHMS + +G TTHKTE
Sbjct  381  CLSEDYGKTYRKWGFEKLVYRDSITGIRRDRKYAVQPRSLYATGVHMSMDLSGKTTHKTE  440

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTI++RRE C+ LVN T++  + I YV+D TMRD AG +K+FELK IG  L
Sbjct  441  GRIKYFHYHGTISERRETCKILVNTTQVTQNKIPYVMDTTMRDTAGVIKKFELKMIGTRL  500

Query  543  QRTRQ  557
            Q+TRQ
Sbjct  501  QKTRQ  505



>ref|XP_009363281.1| PREDICTED: uncharacterized protein LOC103953269 [Pyrus x bretschneideri]
Length=526

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCL R+KF AKWMFFFDVDE+I++P K+ LKSV+DSL  +TQFTIEQMPMS+KL
Sbjct  342  QFMVVNDCLFRHKFMAKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKL  401

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED  KT+RKWGFEKLV+KD K GIRRDRKYAVQPRNV ATGVHMS+N AG TTHKTE
Sbjct  402  CLLEDYHKTYRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTE  461

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA R  PCR+L+N T + VD + Y VD T+R VAG+VK+FEL+ IG  L
Sbjct  462  SRIQYFHYHGTIATRGGPCRRLINATEIYVDKVPYAVDTTLRSVAGSVKKFELRMIGSRL  521

Query  543  QRTRQ  557
            Q TRQ
Sbjct  522  QNTRQ  526



>ref|XP_007156305.1| hypothetical protein PHAVU_003G275200g [Phaseolus vulgaris]
 gb|ESW28299.1| hypothetical protein PHAVU_003G275200g [Phaseolus vulgaris]
Length=500

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K T+K+V+DSL  + QFTIEQMPMS+K+
Sbjct  316  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKTTIKTVLDSLSEYDQFTIEQMPMSSKI  375

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +D GKTHRKWGFEKLV++DS +GIRRDRKYAVQPR++ ATGVHMS++ +G TTHKTE
Sbjct  376  CLSQDYGKTHRKWGFEKLVYRDSISGIRRDRKYAVQPRSLYATGVHMSQDLSGKTTHKTE  435

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTI++RRE C+ LVN T++  D I YV+D T+RD+AG +K+FE K IG  L
Sbjct  436  GRIKYFHYHGTISERRESCKILVNTTQVTNDKIPYVLDTTLRDIAGVIKKFEHKMIGSRL  495

Query  543  QRTRQ  557
              T+Q
Sbjct  496  HNTKQ  500



>gb|KJB48060.1| hypothetical protein B456_008G052100 [Gossypium raimondii]
Length=492

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 152/187 (81%), Gaps = 2/187 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRYKF AKW+FFFDVDE+IF+P K TL SV+DSL  ++Q TIEQMPMSNKL
Sbjct  306  QFLVVNDCLHRYKFMAKWIFFFDVDEYIFVPPKTTLGSVLDSLSDYSQITIEQMPMSNKL  365

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSEN--AAGNTTHK  356
            C   DA K HRKWGFEKLV++D K GIRRDRKYA+QPRNV ATGVHMS+N  A   TTHK
Sbjct  366  CHSVDAAKRHRKWGFEKLVYRDVKRGIRRDRKYAIQPRNVYATGVHMSQNLGAGAKTTHK  425

Query  357  TEGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGP  536
            TEGRI Y+HYHGTIAQRREPCR LVN T +  +   +V+D T+RD+AG+VK+FELK IG 
Sbjct  426  TEGRIKYFHYHGTIAQRREPCRNLVNSTDINFENNPFVLDTTLRDLAGSVKKFELKMIGS  485

Query  537  VLQRTRQ  557
             L  TRQ
Sbjct  486  RLYNTRQ  492



>ref|XP_011022744.1| PREDICTED: uncharacterized protein LOC105124421 [Populus euphratica]
Length=545

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFD+DE+I++P KNT+KSV+DSL  +TQFT EQMPMS+KL
Sbjct  333  QFMVVNDCLHRYKFLAKWMFFFDLDEYIYLPPKNTIKSVLDSLSGYTQFTFEQMPMSSKL  392

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D G+ +RKWGFEKLV++D K GIRRDRKYA+QPRNV ATGVHMS+N AG TT+KTE
Sbjct  393  CLSADYGRYYRKWGFEKLVYRDVKRGIRRDRKYAIQPRNVFATGVHMSQNFAGKTTYKTE  452

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGP  536
            G+I Y+HYHGTIAQRREPCR L+N T +  + + YV+D TMRD+A +VK+FELK IGP
Sbjct  453  GKIKYFHYHGTIAQRREPCRNLLNVTEINFENVPYVLDTTMRDLAWSVKKFELKMIGP  510



>ref|XP_006448575.1| hypothetical protein CICLE_v10014882mg [Citrus clementina]
 gb|ESR61815.1| hypothetical protein CICLE_v10014882mg [Citrus clementina]
Length=529

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRYKF AKWMFFFDVDE+IF+P KNT+KSV+DSL  + QFTIEQM M+++L
Sbjct  345  QFLVVNDCLHRYKFMAKWMFFFDVDEYIFVPPKNTIKSVLDSLMGYNQFTIEQMHMNSQL  404

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   D+GK HRKWGFEKLV+KD K GIRRDRKYAVQPRNV A GVHMS+N  G TTHKTE
Sbjct  405  CFAGDSGKAHRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYAAGVHMSQNLYGRTTHKTE  464

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+I YYHYHGTIAQR EPC   +N TR   +   YV+D TMR VAGAVK+FEL  IG  L
Sbjct  465  GKIKYYHYHGTIAQRTEPCTTFINWTRYNFENTPYVLDITMRAVAGAVKKFELAKIGDRL  524

Query  543  QRTRQ  557
            + TRQ
Sbjct  525  KHTRQ  529



>ref|XP_006468595.1| PREDICTED: uncharacterized protein LOC102614492 [Citrus sinensis]
Length=535

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRYKF AKWMFFFDVDE+IF+P KNT+KSV+DSL  + QFTIEQM M+++L
Sbjct  351  QFLVVNDCLHRYKFMAKWMFFFDVDEYIFVPPKNTIKSVLDSLMGYNQFTIEQMHMNSQL  410

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   D+GK HRKWGFEKLV+KD K GIRRDRKYAVQPRNV A GVHMS+N  G  THKTE
Sbjct  411  CFAGDSGKAHRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYAAGVHMSQNLYGQITHKTE  470

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+I YYHYHGTIAQR EPC   +N TR   +   YV+D TMR VAGAVK+FEL  IG  L
Sbjct  471  GKIKYYHYHGTIAQRTEPCTTFINWTRYNFENTPYVLDITMRAVAGAVKKFELAKIGDRL  530

Query  543  QRTRQ  557
            + TRQ
Sbjct  531  KHTRQ  535



>gb|KDO77183.1| hypothetical protein CISIN_1g009350mg [Citrus sinensis]
Length=537

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRYKF AKWMFFFDVDE+IF+P KNT+KSV+DSL  + QFTIEQM M+++L
Sbjct  353  QFLVVNDCLHRYKFMAKWMFFFDVDEYIFVPPKNTIKSVLDSLMGYNQFTIEQMHMNSQL  412

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   D+GK HRKWGFEKLV+KD K GIRRDRKYAVQPRNV A GVHMS+N  G  THKTE
Sbjct  413  CFAGDSGKAHRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYAAGVHMSQNLYGQITHKTE  472

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+I YYHYHGTIAQR EPC   +N TR   +   YV+D TMR VAGAVK+FEL  IG  L
Sbjct  473  GKIKYYHYHGTIAQRTEPCTTFINWTRYNFENTPYVLDITMRAVAGAVKKFELAKIGDRL  532

Query  543  QRTRQ  557
            + TRQ
Sbjct  533  KHTRQ  537



>ref|XP_004488232.1| PREDICTED: uncharacterized protein LOC101489232 [Cicer arietinum]
Length=517

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+T+KSV+DSL  ++QFTIEQMPMS+KL
Sbjct  332  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKL  391

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWG EKLV+KD K GIRRDRKYAVQPR++ ATGVHMS+N  G TTHKTE
Sbjct  392  CLSADYGKTYRKWGMEKLVYKDVKKGIRRDRKYAVQPRSLFATGVHMSQNLDGKTTHKTE  451

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G+I YYHYHGTIA+RRE C+   N T    D   Y++D TMRD+AG +K+FE K IG  +
Sbjct  452  GKIKYYHYHGTIAERRESCKMFTNSTETTFDKTPYMLDTTMRDIAGVIKKFEQKMIGNRV  511

Query  543  QRTRQ  557
            Q+T Q
Sbjct  512  QKTTQ  516



>ref|XP_002533995.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28392.1| conserved hypothetical protein [Ricinus communis]
Length=520

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKW+FFFDVDE+I+IP KNT+KSV+DSL  + QFT EQMPMS+KL
Sbjct  336  QFMVVNDCLHRYKFVAKWIFFFDVDEYIYIPPKNTIKSVLDSLSDYNQFTFEQMPMSSKL  395

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D G+ +RKWGFEKLV++D K GIRRDRKYA+QPRNV ATGVHMS+N AG T HKTE
Sbjct  396  CLSADYGRYYRKWGFEKLVYRDIKRGIRRDRKYAIQPRNVFATGVHMSQNLAGKTNHKTE  455

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             +I Y+HYHGTIAQRREPCR L+N T +  +   YV+D TMRD+A +VK+FE K IG  L
Sbjct  456  SKIKYFHYHGTIAQRREPCRNLLNVTEINFENNPYVLDTTMRDIAWSVKKFEQKMIGSRL  515

Query  543  QRTRQ  557
            Q TRQ
Sbjct  516  QSTRQ  520



>ref|XP_003628971.1| hypothetical protein MTR_8g070700 [Medicago truncatula]
 gb|AET03447.1| glycosyltransferase family 92 protein [Medicago truncatula]
Length=502

 Score =   277 bits (708),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF+++NDCLHRYKF AKWMFFFDVDE+I++P K+T+K+V+DSL  ++QFTIEQM MS K+
Sbjct  318  QFMVLNDCLHRYKFMAKWMFFFDVDEYIYVPPKSTIKTVLDSLSEYSQFTIEQMAMSVKV  377

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL  D GKT+RKWGFEKLV++D+ TGIRRDRKYAVQPR++ A G+HMSEN  G TTH TE
Sbjct  378  CLSHDYGKTYRKWGFEKLVYRDAITGIRRDRKYAVQPRSLFANGIHMSENLDGKTTHNTE  437

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHG I+QRRE C+ LVN T++  +   YV+D T+RD+AG++K+FELK IG  L
Sbjct  438  GRIKYFHYHGAISQRRETCKLLVNSTKITYEKTPYVMDTTLRDIAGSIKKFELKMIGTRL  497

Query  543  QRTRQ  557
            Q TRQ
Sbjct  498  QNTRQ  502



>ref|XP_004509608.1| PREDICTED: uncharacterized protein LOC101490982 [Cicer arietinum]
Length=486

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCL RYKF AKWMFFFDVDE+I++P K+T+K+V+ SL  ++QFTIEQMPMS+K+
Sbjct  302  QFLVVNDCLLRYKFMAKWMFFFDVDEYIYVPPKSTIKTVLHSLSEYSQFTIEQMPMSSKI  361

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +D GKT+RKWGFEKLV++D+  GIRRDRKYAVQPRN+ ATGVHMSEN  G TTHKTE
Sbjct  362  CLSDDYGKTYRKWGFEKLVYRDAIKGIRRDRKYAVQPRNLYATGVHMSENLDGKTTHKTE  421

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIAQR+E C+ LVN T +  +   YV+D T+RD+A  +K+FELK IG  L
Sbjct  422  GRIKYFHYHGTIAQRKETCKLLVNSTNVNYEKTPYVLDTTLRDIAAVIKKFELKMIGSRL  481

Query  543  QRTRQ  557
            Q T Q
Sbjct  482  QNTTQ  486



>gb|KEH37330.1| glycosyltransferase family 92 protein [Medicago truncatula]
Length=524

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P K+T+KSV+DSL  + QFTIEQMPM+ KL
Sbjct  340  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYNQFTIEQMPMNAKL  399

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   D GKT+RKWG EKLV+KD K GIRRDRKYAVQPR++ ATGVHMS+N  G TTHKTE
Sbjct  400  CHSADYGKTYRKWGIEKLVYKDVKKGIRRDRKYAVQPRSLFATGVHMSQNLDGKTTHKTE  459

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTIAQRRE C+  +N T    D   Y +D T+RD+AG +K+FE K IG  +
Sbjct  460  GRIKYFHYHGTIAQRRESCKMFLNSTATTYDKTPYELDTTLRDLAGVIKKFEQKMIGNKV  519

Query  543  QRTR  554
            Q+TR
Sbjct  520  QKTR  523



>ref|XP_009406517.1| PREDICTED: uncharacterized protein LOC103989411 [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRYKF AKW+FFFDVDEFI++  K  L S++ SL P+TQFTIEQMPMS KL
Sbjct  309  QFLVVNDCLHRYKFMAKWIFFFDVDEFIYLAPKTNLDSLLASLSPYTQFTIEQMPMSGKL  368

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   D GKT R WG EKLV++D K G+RRDRKYA+QPR+  ATGVHMS+N AG + HKT+
Sbjct  369  CRSIDHGKTARMWGIEKLVYRDVKRGVRRDRKYAIQPRSAFATGVHMSQNVAGRSLHKTD  428

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI YYHYHGTIA RR+PC + VN T +  DG  YV+D T+R VAGAV+RFE K IG  L
Sbjct  429  GRIKYYHYHGTIAARRDPCEEFVNATAVTYDGTPYVLDETLRRVAGAVRRFEHKMIGSRL  488

Query  543  QRTRQ  557
             RTRQ
Sbjct  489  ARTRQ  493



>ref|XP_010910220.1| PREDICTED: uncharacterized protein LOC105036167 [Elaeis guineensis]
Length=489

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F AKWMFFFD DEFI++  K TLKSV+DSL  +TQ T EQMPMS KL
Sbjct  305  QFLVVNDCLHRYRFMAKWMFFFDCDEFIYVQPKTTLKSVLDSLSGYTQITFEQMPMSGKL  364

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  +DAG T R W FEKLV++D K G+RRDRKYA+QPRN  ATGVH+S+N AG +  K E
Sbjct  365  CRSQDAGDTPRMWVFEKLVYRDVKRGVRRDRKYAIQPRNAFATGVHLSQNIAGRSLRKAE  424

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             RI Y+HYHGTIA+R +PC+  VNDT L  +G  YV+D T++ +AG+VKRFELKTIG  L
Sbjct  425  SRITYFHYHGTIAERSDPCKVFVNDTTLTFEGTPYVLDTTLQQLAGSVKRFELKTIGSRL  484

Query  543  QRTRQ  557
            QRTRQ
Sbjct  485  QRTRQ  489



>ref|XP_006398091.1| hypothetical protein EUTSA_v10000855mg [Eutrema salsugineum]
 gb|ESQ39544.1| hypothetical protein EUTSA_v10000855mg [Eutrema salsugineum]
Length=524

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 149/186 (80%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F+AKW+FFFDVDEFI+IP KNT+ SV++SL  ++QFTIEQMPMS++L
Sbjct  339  QFMVVNDCLHRYRFEAKWIFFFDVDEFIYIPPKNTISSVMESLEEYSQFTIEQMPMSSQL  398

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H+ 
Sbjct  399  CFSGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVYATGVHMSQNLQGKTYHRA  458

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            EG+I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRD+  AVK FE++TIG  
Sbjct  459  EGKIRYFHYHGSISQRREPCRHLFNGTRIVFDNNPYVLDTTMRDIGLAVKTFEIRTIGDR  518

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  519  LLRTRQ  524



>ref|XP_010529310.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104806225 
[Tarenaya hassleriana]
Length=516

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F  KWMFFFDVDEFI++P KNT+ SV++S+  ++QFTIEQMPMS++L
Sbjct  331  QFMVVNDCLHRYRFMTKWMFFFDVDEFIYVPPKNTIASVMESMDEYSQFTIEQMPMSSEL  390

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   R DRKYAVQPRNV ATGVHMS+N  G T HK 
Sbjct  391  CFSGDGPARTYRKWGFEKLAYRDVKKVPRMDRKYAVQPRNVFATGVHMSQNLQGRTYHKA  450

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            EG+I Y+HYHG+I+QRREPCR L NDTR+   G  YV+D T+RDV  +VK FEL+TIG  
Sbjct  451  EGKIRYFHYHGSISQRREPCRHLFNDTRIVFRGNPYVLDTTLRDVGLSVKTFELRTIGDR  510

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  511  LLRTRQ  516



>ref|XP_006413894.1| hypothetical protein EUTSA_v10024965mg [Eutrema salsugineum]
 gb|ESQ55347.1| hypothetical protein EUTSA_v10024965mg [Eutrema salsugineum]
Length=505

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEFI++P  N++ SV++SL  ++QFTIEQMPMS+KL
Sbjct  320  QFMVVNDCLHRYRFSAKWIFFFDVDEFIYVPANNSISSVMESLEEYSQFTIEQMPMSSKL  379

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  380  CYSGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKA  439

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  AVK FE++TIG  
Sbjct  440  ESKIRYFHYHGSISQRREPCRNLFNDSRVVFENNPYVLDTTIRDVGLAVKTFEMRTIGDR  499

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  500  LLRTRQ  505



>emb|CDY69573.1| BnaAnng30860D [Brassica napus]
Length=495

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEFI++P+K T+KSV++SL  ++QFTIEQMPMS+K+
Sbjct  310  QFMVVNDCLHRYRFAAKWMFFFDVDEFIYVPEKETIKSVMESLEEYSQFTIEQMPMSSKI  369

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+R WGFEK+ ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  370  CYSGDGPARTYRNWGFEKMAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKA  429

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  AVK FE++TIG  
Sbjct  430  ESKIRYFHYHGSISQRREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAVKTFEMRTIGNR  489

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  490  LLRTRQ  495



>emb|CDX78979.1| BnaA01g10460D [Brassica napus]
Length=497

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F+AKWMFFFDVDEF+++P+K T+KSV++SL  ++QFTIEQMPMS+++
Sbjct  312  QFMVVNDCLHRYRFKAKWMFFFDVDEFMYVPEKETIKSVMESLEEYSQFTIEQMPMSSRI  371

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEK+ ++D K   RRDRKYAVQP+NV ATGVHMS+N  G T HK 
Sbjct  372  CYSGDGPARTYRKWGFEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKA  431

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  AVK FE++TIG  
Sbjct  432  ESKIRYFHYHGSISQRREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAVKMFEMRTIGDR  491

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  492  LLRTRQ  497



>emb|CDY31450.1| BnaC03g63740D [Brassica napus]
Length=495

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEFI++P+K T+KSV++SL  ++QFTIEQMPMS+K+
Sbjct  310  QFMVVNDCLHRYRFAAKWMFFFDVDEFIYVPEKETIKSVMESLEEYSQFTIEQMPMSSKI  369

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+R WGFEK+ ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  370  CYSGDGPARTYRNWGFEKMAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKA  429

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  AVK FE++TIG  
Sbjct  430  ESKIRYFHYHGSISQRREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAVKTFEMRTIGNR  489

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  490  LLRTRQ  495



>ref|XP_009133537.1| PREDICTED: uncharacterized protein LOC103858013 isoform X1 [Brassica 
rapa]
Length=468

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F+AKWMFFFDVDEF+++P++ T+KSV++SL  ++QFTIEQMPMS+++
Sbjct  283  QFMVVNDCLHRYRFKAKWMFFFDVDEFMYVPEEETIKSVMESLEEYSQFTIEQMPMSSRI  342

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEK+ ++D K   RRDRKYAVQP+NV ATGVHMS+N  G T HK 
Sbjct  343  CYSGDGPARTYRKWGFEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKA  402

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  AVK FE++TIG  
Sbjct  403  ESKIRYFHYHGSISQRREPCRHLSNDSRVVFENNPYVLDTTIRDVGLAVKMFEMRTIGDR  462

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  463  LLRTRQ  468



>gb|KFK31618.1| hypothetical protein AALP_AA6G136500 [Arabis alpina]
Length=509

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF+IVNDCLHRY+F AKW+FFFDVDEF+++P K ++ SV++SL  ++QFTIEQMPMS+++
Sbjct  324  QFMIVNDCLHRYRFMAKWIFFFDVDEFVYVPVKESIDSVMESLKEYSQFTIEQMPMSSQI  383

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T HK 
Sbjct  384  CYSGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLLGKTYHKA  443

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            EG+I Y+HYHG+I+QRREPCR L NDTR+  +   YV+D TMRD+  AVK FE++ IG  
Sbjct  444  EGKIRYFHYHGSISQRREPCRHLFNDTRIVFNNNPYVLDTTMRDIGLAVKTFEIRKIGDR  503

Query  540  LQRTRQ  557
            L RT+Q
Sbjct  504  LLRTKQ  509



>ref|XP_002863553.1| hypothetical protein ARALYDRAFT_494517 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39812.1| hypothetical protein ARALYDRAFT_494517 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 145/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF+IVNDCLHRY+F  KWMFFFDVDEF+ +P K T+ SV++SL  ++QFTIEQMPMS++L
Sbjct  334  QFMIVNDCLHRYRFMTKWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSQL  393

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H+ 
Sbjct  394  CYDGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRA  453

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            EG+I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRD+  AVK FE++TIG  
Sbjct  454  EGKIRYFHYHGSISQRREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDR  513

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  514  LLRTRQ  519



>ref|XP_009133544.1| PREDICTED: uncharacterized protein LOC103858013 isoform X2 [Brassica 
rapa]
Length=499

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F+AKWMFFFDVDEF+++P++ T+KSV++SL  ++QFTIEQMPMS+++
Sbjct  314  QFMVVNDCLHRYRFKAKWMFFFDVDEFMYVPEEETIKSVMESLEEYSQFTIEQMPMSSRI  373

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEK+ ++D K   RRDRKYAVQP+NV ATGVHMS+N  G T HK 
Sbjct  374  CYSGDGPARTYRKWGFEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKA  433

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  AVK FE++TIG  
Sbjct  434  ESKIRYFHYHGSISQRREPCRHLSNDSRVVFENNPYVLDTTIRDVGLAVKMFEMRTIGDR  493

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  494  LLRTRQ  499



>ref|XP_010441840.1| PREDICTED: uncharacterized protein LOC104724962 isoform X1 [Camelina 
sativa]
Length=493

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS++L
Sbjct  308  QFMVVNDCLHRYRFMAKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQL  367

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H+ 
Sbjct  368  CYDGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRA  427

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRD+  AVK FE++TIG  
Sbjct  428  EKQIRYFHYHGSISQRREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDR  487

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  488  LLRTRQ  493



>ref|XP_010441841.1| PREDICTED: uncharacterized protein LOC104724962 isoform X2 [Camelina 
sativa]
Length=519

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS++L
Sbjct  334  QFMVVNDCLHRYRFMAKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQL  393

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H+ 
Sbjct  394  CYDGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRA  453

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRD+  AVK FE++TIG  
Sbjct  454  EKQIRYFHYHGSISQRREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDR  513

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  514  LLRTRQ  519



>ref|NP_199280.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK32745.1|AF361577_1 AT5g44670/K15C23_12 [Arabidopsis thaliana]
 dbj|BAA98120.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN72243.1| At5g44670/K15C23_12 [Arabidopsis thaliana]
 gb|AED95145.1| uncharacterized protein AT5G44670 [Arabidopsis thaliana]
 gb|AHL38590.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=519

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEFI++P K+++ SV+ SL  ++QFTIEQMPMS++L
Sbjct  334  QFMVVNDCLHRYRFMAKWMFFFDVDEFIYVPAKSSISSVMVSLEEYSQFTIEQMPMSSQL  393

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS++  G T H+ 
Sbjct  394  CYDGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQHLQGKTYHRA  453

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            EG+I Y+HYHG+I+QRREPCR L N TR+  +   YV+D TMRD+  AVK FE++TIG  
Sbjct  454  EGKIRYFHYHGSISQRREPCRHLYNGTRIVHENNPYVLDTTMRDIGLAVKTFEIRTIGDR  513

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  514  LLRTRQ  519



>ref|XP_010494514.1| PREDICTED: uncharacterized protein LOC104771647 [Camelina sativa]
Length=502

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS++L
Sbjct  317  QFMVVNDCLHRYRFMAKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQL  376

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H+ 
Sbjct  377  CYDGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRA  436

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRD+  AVK FE++TIG  
Sbjct  437  EKQIRYFHYHGSISQRREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEVRTIGDR  496

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  497  LLRTRQ  502



>emb|CDY50064.1| BnaCnng18710D [Brassica napus]
Length=498

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 148/186 (80%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEF+++P+K T+KSV++SL  ++QFTIEQMPMS+K+
Sbjct  313  QFMVVNDCLHRYRFAAKWVFFFDVDEFMYVPEKETIKSVMESLEEYSQFTIEQMPMSSKI  372

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEK+ ++D K   RRDRKYAVQP+NV ATGVHMS+N  G T HK 
Sbjct  373  CYSGDGPARTYRKWGFEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKA  432

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  A K FE++TIG  
Sbjct  433  ESKIRYFHYHGSISQRREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAAKMFEMRTIGDR  492

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  493  LLRTRQ  498



>ref|XP_009108462.1| PREDICTED: uncharacterized protein LOC103834153 [Brassica rapa]
Length=495

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEFI++P+K T+ SV++SL  ++QFTIEQMPMS+K+
Sbjct  310  QFMVVNDCLHRYRFAAKWMFFFDVDEFIYVPEKETISSVMESLEEYSQFTIEQMPMSSKI  369

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+R WGFEK+ ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  370  CYSGDGPARTYRNWGFEKMAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKA  429

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+R+V  AVK FE++TIG  
Sbjct  430  ESKIRYFHYHGSISQRREPCRHLFNDSRVVFENNPYVLDTTIRNVGLAVKTFEMRTIGNR  489

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  490  LLRTRQ  495



>ref|XP_006280340.1| hypothetical protein CARUB_v10026267mg [Capsella rubella]
 gb|EOA13238.1| hypothetical protein CARUB_v10026267mg [Capsella rubella]
Length=502

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS++L
Sbjct  317  QFMVVNDCLHRYRFMAKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQL  376

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H+ 
Sbjct  377  CYNGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRA  436

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L N TR+  +   YV+D TMRD+  AVK FE++TIG  
Sbjct  437  EKQIRYFHYHGSISQRREPCRHLYNGTRIVHENNPYVLDTTMRDIGLAVKTFEIRTIGDR  496

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  497  LIRTRQ  502



>ref|XP_010481723.1| PREDICTED: uncharacterized protein LOC104760496 [Camelina sativa]
Length=502

 Score =   253 bits (646),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY++ AKW+FFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS++L
Sbjct  317  QFMVVNDCLHRYRYMAKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQL  376

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H+ 
Sbjct  377  CYGGDGPARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRA  436

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRD+  AVK FE++TIG  
Sbjct  437  EKQIRYFHYHGSISQRREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDR  496

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  497  LLRTRQ  502



>ref|XP_010684202.1| PREDICTED: uncharacterized protein LOC104898791 [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+F  +WMFFFDVDE+I++P K +L+SVVDSL  FTQFTIEQ+P+SN+L
Sbjct  309  QFLIVNDCLHRYRFDTRWMFFFDVDEYIYVPSKFSLRSVVDSLGDFTQFTIEQIPISNQL  368

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +DAGKT +KW  EKLV+++ K  IRRDRKYAVQPRNV ATGVH+S+N  G + HKTE
Sbjct  369  CLTQDAGKTSKKWVMEKLVYRNVKKVIRRDRKYAVQPRNVFATGVHLSKNFQGESAHKTE  428

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
              I Y+HYHGTIA RR+ C+  +NDT + +    YV D +MR +A  VKRFEL TIG  L
Sbjct  429  KFIKYFHYHGTIATRRDTCKDFINDTSVTLGDTPYVRDTSMRSIAAFVKRFELHTIGSKL  488

Query  543  QRTRQ  557
            Q T+Q
Sbjct  489  QFTKQ  493



>ref|XP_006283465.1| hypothetical protein CARUB_v10004512mg, partial [Capsella rubella]
 gb|EOA16363.1| hypothetical protein CARUB_v10004512mg, partial [Capsella rubella]
Length=553

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 145/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS+++
Sbjct  368  QFMVVNDCLHRYRFMAKWMFFFDVDEFVYVPAKETISSVMESLEGYSQFTIEQMPMSSRI  427

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWG EKL ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  428  CYSGDGPARTYRKWGIEKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKA  487

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND++L  +   YV+D T+RDV  AVK FEL+TIG  
Sbjct  488  ESKIRYFHYHGSISQRREPCRYLFNDSKLVFENTPYVLDTTIRDVGLAVKTFELRTIGNR  547

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  548  LLRTRQ  553



>ref|XP_010434312.1| PREDICTED: uncharacterized protein LOC104718293 [Camelina sativa]
Length=513

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS+++
Sbjct  328  QFMVVNDCLHRYRFMAKWMFFFDVDEFVYVPAKETISSVMESLEGYSQFTIEQMPMSSRI  387

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWG EKLV++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  388  CYDGDGPARTYRKWGIEKLVYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKA  447

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCRQL ND+ +  +   YV+D T+R+V  AV+ FEL+TIG  
Sbjct  448  ESKIRYFHYHGSISQRREPCRQLFNDSNVFFENTPYVLDTTIREVGLAVRTFELRTIGDR  507

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  508  LLRTRQ  513



>emb|CDY49028.1| BnaAnng10220D [Brassica napus]
Length=519

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEFI IP  NT+ SV+++L  ++QFTIEQMPMS++L
Sbjct  334  QFMVVNDCLHRYRFDAKWIFFFDVDEFIGIPPNNTISSVMETLEEYSQFTIEQMPMSSQL  393

Query  183  CLRED-AGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D A +T+RKWGFEKL ++D K   RRDRKYAVQPR+V ATGVHMS+N  G T H T
Sbjct  394  CFSGDGAARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRHVFATGVHMSQNVQGKTYHGT  453

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
               I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRDV  AVK FE++TIG  
Sbjct  454  GSLIRYFHYHGSISQRREPCRHLFNGTRIMFDNNPYVLDTTMRDVGLAVKTFEIRTIGDR  513

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  514  LIRTRQ  519



>gb|AAL24253.1| AT4g20170/F1C12_90 [Arabidopsis thaliana]
 gb|AAN18139.1| At4g20170/F1C12_90 [Arabidopsis thaliana]
Length=388

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 143/186 (77%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF+IVNDCLHRY+F  KWMFFFDVDEF+ +P K T+ SV++SL  ++QFTIEQMPMS+++
Sbjct  203  QFMIVNDCLHRYRFMTKWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSRI  262

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWG EKL ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  263  CYSGDGPARTYRKWGIEKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGKTYHKA  322

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCRQL ND+R+  +   YV+D T+ DV  AV+ FEL+TIG  
Sbjct  323  ESKIRYFHYHGSISQRREPCRQLFNDSRVVFENTPYVLDTTICDVGLAVRTFELRTIGDR  382

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  383  LLRTRQ  388



>ref|XP_009101686.1| PREDICTED: uncharacterized protein LOC103827882 [Brassica rapa]
Length=532

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKW+FFFDVDEFI IP  NT+ SV+++L  ++QFTIEQMPMS++L
Sbjct  347  QFMVVNDCLHRYRFDAKWIFFFDVDEFIGIPPNNTISSVMETLEEYSQFTIEQMPMSSQL  406

Query  183  CLRED-AGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D A +T+RKWGFEKL ++D K   RRDRKYAVQPR+V ATGVHMS+N  G T H T
Sbjct  407  CFSGDGAARTYRKWGFEKLAYRDVKKVPRRDRKYAVQPRHVFATGVHMSQNVQGKTYHGT  466

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
               I Y+HYHG+I+QRREPCR L N TR+  D   YV+D TMRDV  AVK FE++TIG  
Sbjct  467  GSLIRYFHYHGSISQRREPCRHLFNGTRIMFDNNPYVLDTTMRDVGLAVKTFEIRTIGDR  526

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  527  LIRTRQ  532



>ref|XP_010439609.1| PREDICTED: uncharacterized protein LOC104723016 [Camelina sativa]
Length=511

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 145/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS+++
Sbjct  326  QFMVVNDCLHRYRFMAKWMFFFDVDEFVYVPAKETISSVMESLQGYSQFTIEQMPMSSRI  385

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWG EKLV++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  386  CYDGDGPARTYRKWGIEKLVYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKA  445

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCRQL ND+ +  +   YV+D T+ DV  AV+ FEL+TIG  
Sbjct  446  ESKIRYFHYHGSISQRREPCRQLFNDSNVFFENTPYVLDTTIGDVGLAVRTFELRTIGDR  505

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  506  LLRTRQ  511



>ref|XP_010449215.1| PREDICTED: uncharacterized protein LOC104731515 [Camelina sativa]
Length=513

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 145/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F AKWMFFFDVDEF+++P K T+ SV++SL  ++QFTIEQMPMS+++
Sbjct  328  QFMVVNDCLHRYRFMAKWMFFFDVDEFVYVPAKETISSVMESLEGYSQFTIEQMPMSSRI  387

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWG EKLV++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  388  CYDGDGPARTYRKWGIEKLVYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKA  447

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+ +  +   YV+D T+RDV  AV+ FEL+TIG  
Sbjct  448  ESKIRYFHYHGSISQRREPCRYLFNDSNVFFENTPYVLDTTIRDVGLAVRTFELRTIGDR  507

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  508  LLRTRQ  513



>ref|XP_002869945.1| hypothetical protein ARALYDRAFT_492851 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46204.1| hypothetical protein ARALYDRAFT_492851 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 143/186 (77%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF+IVNDCLHRY+F  KWMFFFDVDEF+ +P K T+ SV++SL  ++QFTIEQMPMS+++
Sbjct  310  QFMIVNDCLHRYRFMTKWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSRI  369

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWG EKL ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  370  CYSGDGPARTYRKWGIEKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGKTYHKA  429

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCR L ND+R+  +   YV+D T+RDV  AV+ FEL+TIG  
Sbjct  430  ESKIHYFHYHGSISQRREPCRHLFNDSRVVFENTPYVLDTTIRDVGLAVRTFELRTIGDR  489

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  490  LLRTRQ  495



>ref|XP_006855865.1| hypothetical protein AMTR_s00037p00116470 [Amborella trichopoda]
 gb|ERN17332.1| hypothetical protein AMTR_s00037p00116470 [Amborella trichopoda]
Length=513

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F ++W+FFFDVDE+I++P  NTL S++ SL  +TQFTIEQMPMSNKL
Sbjct  329  QFLVVNDCLHRYRFMSRWIFFFDVDEYIYVPPGNTLPSLLSSLSNYTQFTIEQMPMSNKL  388

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +D  +  R+WG EKLVF++ K GIRRDRKYA+Q RN  ATGVHMSEN  G   HKTE
Sbjct  389  CLLQDYRRAPREWGIEKLVFRNVKRGIRRDRKYAIQARNAFATGVHMSENVVGKAQHKTE  448

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            GRI Y+HYHGTI+ RREPCR+ VN + L  +   +V+D TMR +A ++K+FELKTIG  L
Sbjct  449  GRIKYFHYHGTISTRREPCRKFVNASELIFESSPFVLDTTMRALAPSIKKFELKTIGERL  508

Query  543  QRTRQ  557
            + TRQ
Sbjct  509  RSTRQ  513



>ref|NP_193750.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAA18242.1| putative protein [Arabidopsis thaliana]
 emb|CAB79017.1| putative protein [Arabidopsis thaliana]
 gb|AEE84282.1| uncharacterized protein AT4G20170 [Arabidopsis thaliana]
 gb|AHL38683.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=504

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 143/186 (77%), Gaps = 1/186 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF+IVNDCLHRY+F  KWMFFFDVDEF+ +P K T+ SV++SL  ++QFTIEQMPMS+++
Sbjct  319  QFMIVNDCLHRYRFMTKWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSRI  378

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   +T+RKWG EKL ++D K   RRDRKYAVQP NV ATGVHMS+N  G T HK 
Sbjct  379  CYSGDGPARTYRKWGIEKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGKTYHKA  438

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            E +I Y+HYHG+I+QRREPCRQL ND+R+  +   YV+D T+ DV  AV+ FEL+TIG  
Sbjct  439  ESKIRYFHYHGSISQRREPCRQLFNDSRVVFENTPYVLDTTICDVGLAVRTFELRTIGDR  498

Query  540  LQRTRQ  557
            L RTRQ
Sbjct  499  LLRTRQ  504



>ref|XP_003530546.1| PREDICTED: uncharacterized protein LOC100795928 [Glycine max]
Length=522

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 145/185 (78%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P  NT+K+VVDSL  + QF    MPM+NK+
Sbjct  339  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPNNTIKTVVDSLSKYDQFIFNMMPMNNKI  398

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL ED GKT RKWGFEKLV++DS T IRR++KYAVQPR++ ATGVH S++ AG  T+KTE
Sbjct  399  CLYEDYGKTCRKWGFEKLVYRDSTTNIRRNKKYAVQPRSLYATGVHFSQHLAGK-TYKTE  457

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
             R+ Y+HYHG IA+RRE C+     T++    I+YV+D TMRD+A  +K+FE K IG  L
Sbjct  458  DRMKYFHYHGIIAKRRESCKIFATSTQVTQAKITYVIDTTMRDIARVIKKFEFKMIGSRL  517

Query  543  QRTRQ  557
            ++TRQ
Sbjct  518  EKTRQ  522



>ref|XP_009388895.1| PREDICTED: uncharacterized protein LOC103975608 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=415

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 143/185 (77%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL++NDCLHRYKF AKW+F FD+DEFI++P +  L+ +++S   +TQFTIEQMPMSN L
Sbjct  231  QFLVLNDCLHRYKFMAKWIFVFDMDEFIYLPSETKLEPLLESFSGYTQFTIEQMPMSNTL  290

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  +D GKT R WG EKLV++D++  +RRD KYA+QPR+ +ATGVH+S+N AG +  +T 
Sbjct  291  CQFKDYGKTSRMWGIEKLVYRDARRKVRRDHKYAIQPRSASATGVHLSQNVAGPSLSETG  350

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G I Y+HYHGT+A RR+PCR+L+N T++  D   YV+D T+R VAG V+ FELK IGP L
Sbjct  351  GMIKYFHYHGTLAMRRDPCRELLNVTKIFFDNTPYVLDETLRSVAGEVRMFELKMIGPRL  410

Query  543  QRTRQ  557
              TR+
Sbjct  411  AHTRE  415



>ref|XP_009388894.1| PREDICTED: uncharacterized protein LOC103975608 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 143/185 (77%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL++NDCLHRYKF AKW+F FD+DEFI++P +  L+ +++S   +TQFTIEQMPMSN L
Sbjct  306  QFLVLNDCLHRYKFMAKWIFVFDMDEFIYLPSETKLEPLLESFSGYTQFTIEQMPMSNTL  365

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  +D GKT R WG EKLV++D++  +RRD KYA+QPR+ +ATGVH+S+N AG +  +T 
Sbjct  366  CQFKDYGKTSRMWGIEKLVYRDARRKVRRDHKYAIQPRSASATGVHLSQNVAGPSLSETG  425

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
            G I Y+HYHGT+A RR+PCR+L+N T++  D   YV+D T+R VAG V+ FELK IGP L
Sbjct  426  GMIKYFHYHGTLAMRRDPCRELLNVTKIFFDNTPYVLDETLRSVAGEVRMFELKMIGPRL  485

Query  543  QRTRQ  557
              TR+
Sbjct  486  AHTRE  490



>emb|CDY71149.1| BnaCnng71560D, partial [Brassica napus]
Length=175

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = +3

Query  36   YKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCLREDA-GKTH  212
            Y+F AKW+FFFDVDEFI IP  NT+ SV+++L  ++QFTI QMPMS++LC   D   +T+
Sbjct  1    YRFDAKWIFFFDVDEFIGIPPNNTISSVMETLEEYSQFTIGQMPMSSQLCFSGDGPARTY  60

Query  213  RKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTEGRIMYYHYHG  392
            RKWGFEKL ++D K   RRDRKYAVQPRNV ATGVHMS+N  G T H T   I Y+HYHG
Sbjct  61   RKWGFEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHGTGSLIRYFHYHG  120

Query  393  TIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVLQRTRQ  557
            +I+QRREPCR L N TR+  D   YV+D TMRDV  AVK FE++TIG  L RTRQ
Sbjct  121  SISQRREPCRHLFNGTRIMFDNNPYVLDTTMRDVGFAVKTFEIRTIGDRLIRTRQ  175



>gb|ACF84457.1| unknown [Zea mays]
 gb|ACF86839.2| unknown [Zea mays]
 gb|AFW77063.1| hypothetical protein ZEAMMB73_000862 [Zea mays]
Length=332

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 133/183 (73%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P   TL+ V+  L P+TQFTIEQ PMS+KL
Sbjct  148  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPDGRTLQEVLGQLEPYTQFTIEQNPMSSKL  207

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +   +  RKWGFEKLVF++S T +RRDRKYA++ RN  +TGVHMS+N  G TTHKTE
Sbjct  208  CVEDPTMEYSRKWGFEKLVFRNSITRVRRDRKYAIRARNAYSTGVHMSQNVIGRTTHKTE  267

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I+YYHYH +I    EPCR+ V    N +++  +GI YV D  M  VAG +KRFE +T+
Sbjct  268  SLILYYHYHNSINVMGEPCREFVPRPNNGSKVMFEGIPYVYDDNMERVAGEIKRFEEETL  327

Query  531  GPV  539
            G V
Sbjct  328  GTV  330



>ref|XP_010684201.1| PREDICTED: uncharacterized protein LOC104898790 [Beta vulgaris 
subsp. vulgaris]
Length=506

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 137/184 (74%), Gaps = 1/184 (1%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            Q LI+NDCLHR++F  KWMFFFDVDE+I++P K++L+S++DSL  +T F IEQ+ MSN+L
Sbjct  323  QMLILNDCLHRHRFATKWMFFFDVDEYIYLPGKSSLQSIMDSLKDYTLFVIEQVSMSNRL  382

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL EDA +  +KWGFEKLV+K++K   RRD KYA+QPRNV ATGVHMSEN  G +T    
Sbjct  383  CLSEDAAQISKKWGFEKLVYKNAKKA-RRDNKYAIQPRNVYATGVHMSENFVGKSTRLPN  441

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPVL  542
              + Y+HY GT+A R EPCRQ +++  + V+   YV D ++R VA  VKRFEL TIG  L
Sbjct  442  TLMKYFHYQGTVADRHEPCRQFLDNPSIKVENTPYVQDTSIRSVAPFVKRFELDTIGSRL  501

Query  543  QRTR  554
            Q T+
Sbjct  502  QSTK  505



>gb|EEC80517.1| hypothetical protein OsI_22786 [Oryza sativa Indica Group]
Length=332

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 132/183 (72%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P    L+ V+  L P+TQFTIEQ PMS+KL
Sbjct  148  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPDGRALEDVLAQLQPYTQFTIEQNPMSSKL  207

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      R+WGFEKLVF++S TG+RRDRKYA+Q RN  +TGVHMS+N  G TTHKTE
Sbjct  208  CIDDPTEDYSREWGFEKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVYGRTTHKTE  267

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPC++ V    N +++  +GI YV D  M+ +AG ++RFE +TI
Sbjct  268  SLIRYYHYHNSINVMGEPCQKFVPKPANGSKVMFEGIPYVYDDNMKRLAGEIRRFEKQTI  327

Query  531  GPV  539
            G V
Sbjct  328  GDV  330



>ref|XP_003560772.1| PREDICTED: uncharacterized protein LOC100838543 [Brachypodium 
distachyon]
Length=502

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 131/183 (72%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P   TL+ V+  L  +TQFTIEQ PMS+KL
Sbjct  319  QFLVVNDCLHRYRHAANWTFFFDVDEYMYLPDGRTLEEVLGQLQRYTQFTIEQNPMSSKL  378

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + A +  RKWGFEKLVF++S TG+RRDRKYAVQ RN  + GVHMS+N  G TTH+TE
Sbjct  379  CLEDPAKEYSRKWGFEKLVFRNSITGVRRDRKYAVQARNAYSAGVHMSQNVYGRTTHRTE  438

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH TI    EPCR+ V    N +++  +GI YV D  M+ +AG +K FE  T+
Sbjct  439  SLIRYYHYHNTINVMGEPCREFVSKPTNGSKVTFEGIPYVYDDNMKRLAGDIKHFEEATV  498

Query  531  GPV  539
            GP 
Sbjct  499  GPT  501



>ref|NP_001143123.1| uncharacterized protein LOC100275601 [Zea mays]
 gb|ACG29169.1| hypothetical protein [Zea mays]
 gb|AFW77062.1| hypothetical protein ZEAMMB73_000862 [Zea mays]
Length=522

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 133/183 (73%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P   TL+ V+  L P+TQFTIEQ PMS+KL
Sbjct  338  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPDGRTLQEVLGQLEPYTQFTIEQNPMSSKL  397

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +   +  RKWGFEKLVF++S T +RRDRKYA++ RN  +TGVHMS+N  G TTHKTE
Sbjct  398  CVEDPTMEYSRKWGFEKLVFRNSITRVRRDRKYAIRARNAYSTGVHMSQNVIGRTTHKTE  457

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I+YYHYH +I    EPCR+ V    N +++  +GI YV D  M  VAG +KRFE +T+
Sbjct  458  SLILYYHYHNSINVMGEPCREFVPRPNNGSKVMFEGIPYVYDDNMERVAGEIKRFEEETL  517

Query  531  GPV  539
            G V
Sbjct  518  GTV  520



>ref|XP_002436975.1| hypothetical protein SORBIDRAFT_10g013010 [Sorghum bicolor]
 gb|EER88342.1| hypothetical protein SORBIDRAFT_10g013010 [Sorghum bicolor]
Length=522

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 132/183 (72%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P   TL+ V+  L  +TQFTIEQ PMS+KL
Sbjct  338  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPDGRTLQEVLGQLEAYTQFTIEQNPMSSKL  397

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +   +  RKWGFEKLVF++S TG+RRDRKYA+Q RN  +TGVHMS+N  G TTHKTE
Sbjct  398  CVEDPTMEYSRKWGFEKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVIGRTTHKTE  457

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V    N +++  +GI YV D  M+ + G +KRFE +T+
Sbjct  458  SLIRYYHYHNSINVMGEPCREFVPTPTNGSKVMFEGIPYVYDDNMKRITGEIKRFEEETL  517

Query  531  GPV  539
            G +
Sbjct  518  GTI  520



>ref|NP_001057533.1| Os06g0328800 [Oryza sativa Japonica Group]
 dbj|BAD33290.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19447.1| Os06g0328800 [Oryza sativa Japonica Group]
 dbj|BAG89758.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65624.1| hypothetical protein OsJ_21187 [Oryza sativa Japonica Group]
Length=521

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 132/183 (72%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P    L+ V+  L P+TQFTIEQ PMS+KL
Sbjct  337  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPDGRALEDVLAQLQPYTQFTIEQNPMSSKL  396

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      R+WGFEKLVF++S TG+RRDRKYA+Q RN  +TGVHMS+N  G TTHKTE
Sbjct  397  CIDDPTEDYSREWGFEKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVYGRTTHKTE  456

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V    N +++  +GI YV D  M+ +AG ++RFE +TI
Sbjct  457  SLIRYYHYHNSINVMGEPCRKFVPKPANGSKVMFEGIPYVYDDNMKRLAGEIRRFEKQTI  516

Query  531  GPV  539
            G V
Sbjct  517  GDV  519



>ref|XP_006656994.1| PREDICTED: uncharacterized protein LOC102714566 [Oryza brachyantha]
Length=477

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 132/181 (73%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P   TL+ V+  L  +TQFTIEQ PMS+KL
Sbjct  293  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPDGRTLEQVLGPLERYTQFTIEQNPMSSKL  352

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      R+WGFEKLVF++S TG+RRDRKYA+Q RN  +TGVHMS+N  G TTHKTE
Sbjct  353  CVDDPTEDYSREWGFEKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVYGRTTHKTE  412

Query  363  GRIMYYHYHGTIAQRREPCRQL----VNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+     VN +++  +GI+YV D  M+ +AG ++RFE +TI
Sbjct  413  TLIRYYHYHNSINVMGEPCRKFVPKPVNGSKVMFEGIAYVYDDKMKRLAGEIRRFEKQTI  472

Query  531  G  533
            G
Sbjct  473  G  473



>ref|XP_010266306.1| PREDICTED: uncharacterized protein LOC104603843 [Nelumbo nucifera]
Length=478

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W F+FDVDE+I++P  NTL+SV++    +TQFTIEQ PMS+ L
Sbjct  294  QFLVVNDCLHRYRYAANWTFYFDVDEYIYLPDGNTLESVLEEFSNYTQFTIEQNPMSSSL  353

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F++S+TGIRRDRKYA+Q +N  +TGVHMSEN  G T HKTE
Sbjct  354  CLNDSTQDYSRQWGFEKLIFRESRTGIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTE  413

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I+   EPCR+ +     +    VD + YV D  M+ +A  +K+ E K I
Sbjct  414  TKIRYYHYHNSISLEGEPCREFLPISAKNNVTWVDKLPYVYDDNMKKLADTIKQLEKKMI  473

Query  531  GPV  539
            G V
Sbjct  474  GDV  476



>gb|EMT20191.1| hypothetical protein F775_11280 [Aegilops tauschii]
Length=245

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHR++  A W FFFDVDE+I++P   +L+ V+  L  +TQFTIEQ PMS+KL
Sbjct  61   QFMVVNDCLHRHRHAANWTFFFDVDEYIYLPDGRSLEEVLGQLERYTQFTIEQNPMSSKL  120

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      R+WGFEKLVF++S TG+RRDRKYA++ RN  +TGVHMS+N  G TTHKTE
Sbjct  121  CVEDPTKGYSRQWGFEKLVFRNSITGVRRDRKYAIRARNAYSTGVHMSQNVYGRTTHKTE  180

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V    N +++  + + Y  D  M+ +AG +KRFE +T+
Sbjct  181  SLIRYYHYHNSINVMEEPCREFVPKPTNGSKVMFEEVPYFYDDNMKRLAGDIKRFEEETV  240

Query  531  GPV  539
            G V
Sbjct  241  GVV  243



>gb|KHG02318.1| hypothetical protein F383_24787 [Gossypium arboreum]
Length=509

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W FFFDVDE+I++P  NTL+SV++    +TQFTI+Q PMS+ L
Sbjct  323  QFLVVNDCLHRYRYAANWTFFFDVDEYIYLPNGNTLESVLNEFSGYTQFTIQQNPMSSML  382

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL   + +  R+WGFEKL+F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G + HKTE
Sbjct  383  CLNGSSQEYSRQWGFEKLLFRESRTKIRRDRKYAIQAKNAFATGVHMSENIVGKSLHKTE  442

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLA----VDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI Q +E CR+ +  T +      + + YV D  M+ +A  +K+FEL+TI
Sbjct  443  TKIHYYHYHNTITQHQELCREYLPSTAVKQVTWFNKLPYVYDNNMKKLANTIKQFELQTI  502

Query  531  G  533
            G
Sbjct  503  G  503



>ref|XP_004301605.1| PREDICTED: uncharacterized protein LOC101298030 [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLH+Y++ A W F+FDVDE+I++P  NTL+SV++    +TQFTIEQ PMS+ L
Sbjct  313  QFLVVNDCLHKYRYAANWTFYFDVDEYIYLPDGNTLESVLNEFLDYTQFTIEQNPMSSAL  372

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F+DS+TG+RRDRKYA+Q +   ATGVHMSEN AG T HKTE
Sbjct  373  CLNDSTQDYSRQWGFEKLLFRDSRTGLRRDRKYAIQAKQAYATGVHMSENVAGKTLHKTE  432

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    E CR+LV     +     + + YV D  M+ +A  VK FE KTI
Sbjct  433  DKIRYYHYHNSITVPGEVCRELVPMSAKNNVTMYNNLPYVFDDNMKKLASTVKEFERKTI  492

Query  531  GPV  539
            G V
Sbjct  493  GDV  495



>gb|EMS62496.1| hypothetical protein TRIUR3_23927 [Triticum urartu]
Length=183

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  9    LIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCL  188
            ++VNDCLHR++  A W FFFDVDE+I++P   +L+ V+  L  +TQFTIEQ PMS+KLC+
Sbjct  1    MVVNDCLHRHRHAANWTFFFDVDEYIYLPDGRSLEEVLGQLERYTQFTIEQNPMSSKLCV  60

Query  189  REDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTEGR  368
             +      R+WGFEKLVF++S TG+RRDRKYA+Q R+  +TGVHMS+N  G TTHKTE  
Sbjct  61   EDPTKAYSRQWGFEKLVFRNSITGVRRDRKYAIQARHAYSTGVHMSQNVYGRTTHKTESL  120

Query  369  IMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGP  536
            I YYHYH TI    EPCR+ V    N +++  + + +V D  M+ +AG +KRFE  T+G 
Sbjct  121  IRYYHYHNTINVMEEPCREFVPKPTNGSKVMSEEVPFVYDDNMKRLAGDIKRFEEDTVGV  180

Query  537  V  539
            V
Sbjct  181  V  181



>gb|EEC73881.1| hypothetical protein OsI_08667 [Oryza sativa Indica Group]
Length=518

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P   TL  V+  L  ++QFTIEQ PMS+KL
Sbjct  334  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPNGQTLDQVLGKLSGYSQFTIEQNPMSSKL  393

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+++ +    R+WGFEKLVF++S T +RRDRKYA+Q RN  + GVHMS+N  G TTHKTE
Sbjct  394  CVQDPSKDYSREWGFEKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNVYGRTTHKTE  453

Query  363  GRIMYYHYHGTIAQRREPCRQL----VNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+     VN ++L  +GI YV D  M+ +AG +KRFE + I
Sbjct  454  SLIRYYHYHNSINVMGEPCREFVPVPVNGSKLMFEGIPYVYDDNMKRLAGQIKRFEKEAI  513

Query  531  G  533
            G
Sbjct  514  G  514



>ref|NP_001047907.2| Os02g0712500 [Oryza sativa Japonica Group]
 dbj|BAD72474.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE57676.1| hypothetical protein OsJ_08123 [Oryza sativa Japonica Group]
 dbj|BAF09821.2| Os02g0712500 [Oryza sativa Japonica Group]
Length=518

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P   TL  V+  L  ++QFTIEQ PMS+KL
Sbjct  334  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPNGQTLDQVLGKLSGYSQFTIEQNPMSSKL  393

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+++ +    R+WGFEKLVF++S T +RRDRKYA+Q RN  + GVHMS+N  G TTHKTE
Sbjct  394  CVQDPSKDYSREWGFEKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNVYGRTTHKTE  453

Query  363  GRIMYYHYHGTIAQRREPCRQL----VNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+     VN ++L  +GI YV D  M+ +AG +KRFE + I
Sbjct  454  SLIRYYHYHNSINVMGEPCREFVPVPVNGSKLMFEGIPYVYDDNMKRLAGQIKRFEKEAI  513

Query  531  G  533
            G
Sbjct  514  G  514



>gb|KJB46310.1| hypothetical protein B456_007G359700 [Gossypium raimondii]
Length=511

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W FFFDVDE+I++P  NTL+SV++    +TQFTI+Q PMS+ L
Sbjct  323  QFLVVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLNEFSGYTQFTIQQNPMSSML  382

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL   + +  R+WGFEKL+F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G + HKTE
Sbjct  383  CLNGSSQEYSRQWGFEKLLFRESRTKIRRDRKYAIQAKNAFATGVHMSENIVGKSLHKTE  442

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLA----VDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI Q +E CR+ +  T +      + + YV D  M+ +A  +K+FEL+TI
Sbjct  443  TKIHYYHYHNTITQHQELCREYLPSTAVKQVTWFNKLPYVYDDNMKKLANTIKQFELETI  502

Query  531  G  533
            G
Sbjct  503  G  503



>ref|XP_008776506.1| PREDICTED: uncharacterized protein LOC103696604 [Phoenix dactylifera]
Length=467

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 127/183 (69%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P  NTL++V+  L  +TQFTIEQ PMS+KL
Sbjct  283  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPDGNTLETVLGELADYTQFTIEQNPMSSKL  342

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      R+WGFEKLVF++S TG+RRDRKYA+Q RN  ATGVHMS N  G TTHKTE
Sbjct  343  CVLDPKRDYSREWGFEKLVFRNSITGVRRDRKYAIQARNALATGVHMSANVIGKTTHKTE  402

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V           + I YV D  M  +A  +KRFE +TI
Sbjct  403  SMIRYYHYHDSINVLGEPCREFVPMPAKGNVTWFEKIPYVYDDNMTRLAATIKRFEEQTI  462

Query  531  GPV  539
            GPV
Sbjct  463  GPV  465



>ref|XP_006647788.1| PREDICTED: uncharacterized protein LOC102718338 [Oryza brachyantha]
Length=519

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P   TL  V+  L  ++QFTIEQ PMS+KL
Sbjct  335  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPNGQTLDQVLGKLSGYSQFTIEQNPMSSKL  394

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+++ +    R+WGFEKLVF++S T +RRDRKYA+Q RN  + GVHMS+N  G TTHKTE
Sbjct  395  CVQDPSKDYSREWGFEKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNVYGRTTHKTE  454

Query  363  GRIMYYHYHGTIAQRREPCRQL----VNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH  I    EPCR+     VN ++L  +G+ YV D  M+ +AG +K FE +TI
Sbjct  455  SLIRYYHYHNAINVMGEPCREFVSVPVNGSKLMFEGVPYVYDDNMKRLAGEIKHFETETI  514

Query  531  G  533
            G
Sbjct  515  G  515



>dbj|BAK07794.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 131/183 (72%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHR++  A W FFFDVDE+I++P    L+ V+  L  +TQFTIEQ PMS+KL
Sbjct  329  QFLVVNDCLHRHRHAANWTFFFDVDEYIYLPDGRPLEEVLGQLERYTQFTIEQNPMSSKL  388

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ E   +  R+WGFEKLVF++S TG+RRDRKYA++ RN  +TGVHMS+N  G TTHKTE
Sbjct  389  CVEEPTKEYSRQWGFEKLVFRNSITGVRRDRKYAIRARNAYSTGVHMSQNVYGRTTHKTE  448

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V    N +++  + + YV D  M+ +AG +KRFE +TI
Sbjct  449  NLIRYYHYHNSINVMEEPCREFVPKPSNGSKVMFEEVPYVYDDNMKRLAGDIKRFEAETI  508

Query  531  GPV  539
            G V
Sbjct  509  GAV  511



>ref|XP_007208842.1| hypothetical protein PRUPE_ppa025548mg [Prunus persica]
 gb|EMJ10041.1| hypothetical protein PRUPE_ppa025548mg [Prunus persica]
Length=516

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W F+FDVDE+I++P  NTL+SV+     +TQFTIEQ PMS+ L
Sbjct  308  QFLVVNDCLHRYRYAANWTFYFDVDEYIYLPHGNTLESVLSDFSDYTQFTIEQNPMSSGL  367

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F+DS+TG+RRDRKYA+Q +N  +TGVHMSEN  G T H TE
Sbjct  368  CLNDPTQDYSRQWGFEKLLFRDSRTGLRRDRKYAIQAKNAFSTGVHMSENVTGKTLHDTE  427

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I  + E CR+LV           + + YV D  M+ +A  +K+FELKTI
Sbjct  428  TKIRYYHYHNSITVQGEICRELVPMSAKKNVTWFNKLPYVYDDNMKKLASTIKQFELKTI  487

Query  531  GPV  539
            G V
Sbjct  488  GNV  490



>ref|NP_001145321.1| uncharacterized protein LOC100278639 [Zea mays]
 gb|ACG46771.1| hypothetical protein [Zea mays]
Length=525

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P    L  V+  L  ++QFTIEQ PMS+KL
Sbjct  341  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPNGQKLAEVIGQLSGYSQFTIEQNPMSSKL  400

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL++ +    R+WGFEKLVF++S T +RRDRKYA+Q RNV + GVHMS+N  G TTHKTE
Sbjct  401  CLQDPSRNYSREWGFEKLVFRNSITKVRRDRKYAIQARNVYSAGVHMSQNLYGRTTHKTE  460

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
            G I YYHYH +I    EPCR+ V    N ++   +G+ YV D  M+ +AG +KRFE  T+
Sbjct  461  GLIRYYHYHDSINVMGEPCREFVPMPANGSKTMFEGVPYVYDDNMKRLAGEIKRFEKVTL  520

Query  531  G  533
            G
Sbjct  521  G  521



>gb|EMS60568.1| hypothetical protein TRIUR3_26687 [Triticum urartu]
Length=271

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 125/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P    L  V+  L  +TQFTIEQ PMS KL
Sbjct  86   QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPNGQALDQVLGRLSGYTQFTIEQNPMSTKL  145

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C++       R+WGFEK VF++S T +RRDRKYA+Q RN  ATGVHMS+N  G +THKTE
Sbjct  146  CVKNPRNDYSREWGFEKFVFRNSITRVRRDRKYAIQARNAYATGVHMSQNIYGRSTHKTE  205

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPC++ V    +  ++  +G+ YV D  M+ +AG V+RFE +TI
Sbjct  206  ALIRYYHYHNSINVLGEPCQEFVPRPGSGRKVTFEGVPYVYDDAMKRLAGEVRRFENETI  265

Query  531  G  533
            G
Sbjct  266  G  266



>ref|XP_008237881.1| PREDICTED: uncharacterized protein LOC103336601 [Prunus mume]
Length=508

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W F+FDVDE+I++P  N+L+SV+     +TQFTIEQ PMS+ L
Sbjct  300  QFLVVNDCLHRYRYAANWTFYFDVDEYIYLPHGNSLESVLSDFSDYTQFTIEQNPMSSAL  359

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F+DS+TG+RRDRKYA+Q +N  +TGVHMSEN  G T H TE
Sbjct  360  CLNDPTQDYSRQWGFEKLLFRDSRTGLRRDRKYAIQAKNAFSTGVHMSENVTGKTLHDTE  419

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I  + E CR+LV           + + YV D  M+ +A  +K+FELKTI
Sbjct  420  TKIRYYHYHNSITVQGEVCRELVPMSAKKNVTWFNKLPYVYDDNMKKLASTIKQFELKTI  479

Query  531  GPV  539
            G V
Sbjct  480  GNV  482



>ref|XP_010555291.1| PREDICTED: uncharacterized protein LOC104824814 [Tarenaya hassleriana]
Length=479

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 132/188 (70%), Gaps = 25/188 (13%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY+F  KWMFFFDVDEFI++P KNT+ SV++S+  ++QFTIEQMPMS++L
Sbjct  314  QFMVVNDCLHRYRFMTKWMFFFDVDEFIYVPPKNTIASVMESMEKYSQFTIEQMPMSSEL  373

Query  183  CLREDA-GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            C   D   KT+RKWG EKL ++D K   RRDRKYAVQPR+V ATGVHMS+N  G TTHK 
Sbjct  374  CFSGDGPAKTYRKWGIEKLAYRDVKKVHRRDRKYAVQPRSVYATGVHMSQNLEGKTTHKV  433

Query  360  EGRIMYYHYHGTIAQ--RREPCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIG  533
            EG+I Y+HYHG+I+Q  +++ C                      RDV   V+ FEL+TIG
Sbjct  434  EGKIRYFHYHGSISQLIKKQGC----------------------RDVGLTVRTFELRTIG  471

Query  534  PVLQRTRQ  557
              L RTRQ
Sbjct  472  DRLLRTRQ  479



>ref|XP_007028812.1| Domain of Uncharacterized protein function (DUF23) [Theobroma 
cacao]
 gb|EOY09314.1| Domain of Uncharacterized protein function (DUF23) [Theobroma 
cacao]
Length=501

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P  NTL+SV++    +TQFTIEQ PMS+ L
Sbjct  316  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPDGNTLESVLNEFSDYTQFTIEQNPMSSVL  375

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL   + +  R+WGFEKL+F++S+TGIRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  376  CLNNSSEQYSRQWGFEKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTLHKTE  435

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI   +E CR+ +     +     + + YV D  M+ +A  +K FE KTI
Sbjct  436  TKIRYYHYHNTITVHQELCREFLPLSAKNNVTWFNKLPYVYDDNMKKLANTIKEFERKTI  495

Query  531  G  533
            G
Sbjct  496  G  496



>gb|EMT03263.1| hypothetical protein F775_13698 [Aegilops tauschii]
Length=246

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P    L  V+  L  +TQFTIEQ PMS KL
Sbjct  61   QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPNGQALDQVLGRLSGYTQFTIEQNPMSTKL  120

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C++       R+WGFEK VF++S T +RRDRKYA+Q RN  ATGVHMS+N  G +THKTE
Sbjct  121  CVKNPRNDYSREWGFEKFVFRNSITRVRRDRKYAIQARNAYATGVHMSQNVYGRSTHKTE  180

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPC++ V       ++  +G+ YV D  M+ +AG ++RFE +TI
Sbjct  181  ALIRYYHYHNSINVLGEPCQEFVPRPGGGRKVTFEGVPYVYDDAMKRLAGEIRRFENETI  240

Query  531  G  533
            G
Sbjct  241  G  241



>ref|NP_001130404.1| uncharacterized protein LOC100191500 [Zea mays]
 gb|ACF78602.1| unknown [Zea mays]
 gb|ACF84215.1| unknown [Zea mays]
 gb|ACF85531.1| unknown [Zea mays]
 gb|ACN26644.1| unknown [Zea mays]
 gb|ACN34683.1| unknown [Zea mays]
 gb|AFW87401.1| hypothetical protein ZEAMMB73_107903 [Zea mays]
Length=501

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 130/185 (70%), Gaps = 6/185 (3%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  AKW FFFDVDE++F+P    L+ V+  L P+TQFTIEQ PMS+KL
Sbjct  315  QFLVVNDCLHRYRHAAKWTFFFDVDEYMFLPDGRALEDVLAELEPYTQFTIEQNPMSSKL  374

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ + A     +WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTHKTE
Sbjct  375  CVDDPAADYSNQWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTE  434

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGIS------YVVDPTMRDVAGAVKRFELK  524
              I YYHYH TI    E CR+ V+       G++      +  D +M+ VAGAV+ FE +
Sbjct  435  HLIRYYHYHNTINVLGEVCREFVSVPPKKGGGLTWSEKTPWYYDGSMKRVAGAVREFERE  494

Query  525  TIGPV  539
            TIG V
Sbjct  495  TIGDV  499



>ref|XP_010910409.1| PREDICTED: uncharacterized protein LOC105036334 [Elaeis guineensis]
Length=542

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P  NTL++V+  L  +TQFTIEQ PMS+KL
Sbjct  358  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPDGNTLETVLGRLAEYTQFTIEQNPMSSKL  417

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +       +WGFEKLVF++S TGIRRDRKYA+Q RN  ATGVHMSEN  G TTHKTE
Sbjct  418  CVLDPKRDYSSEWGFEKLVFRNSITGIRRDRKYAIQARNAFATGVHMSENVIGKTTHKTE  477

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V      +    + I YV D  M  +A  +K+FE +TI
Sbjct  478  SMIRYYHYHDSINVLGEPCREFVLMPAKGSVTWFEKIPYVYDDNMTRLAATIKQFEKQTI  537

Query  531  GPV  539
            GPV
Sbjct  538  GPV  540



>ref|XP_010094491.1| hypothetical protein L484_024782 [Morus notabilis]
 gb|EXB56245.1| hypothetical protein L484_024782 [Morus notabilis]
Length=492

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 128/184 (70%), Gaps = 4/184 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F A W F+FDVDE+I++P  N L+SV+  L  +TQFTIEQ PMS+ L
Sbjct  304  QFLVVNDCLHRYRFAANWTFYFDVDEYIYLPDGNGLESVLSELSDYTQFTIEQNPMSSSL  363

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL        R+WGFEKL+F++S+TGIRRDRKYA+Q +N  ATGVHMSEN  G T H TE
Sbjct  364  CLNVSTHNYSREWGFEKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTQHNTE  423

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I+   EPCR+ +     D     + + YV D  M+ +A  +K+FE  +I
Sbjct  424  TKIRYYHYHNSISVMGEPCREWLALTAKDNVTWHNKLPYVYDDNMKKLAKTIKQFERDSI  483

Query  531  GPVL  542
            G +L
Sbjct  484  GTLL  487



>ref|XP_010270611.1| PREDICTED: uncharacterized protein LOC104606894 [Nelumbo nucifera]
Length=462

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NTL+SV+     +TQF+IEQ PMS+ L
Sbjct  278  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGNTLESVLQEFSDYTQFSIEQYPMSSNL  337

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      ++WGFEKL+FK+S+TGI RDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  338  CLNDSTQNYSKQWGFEKLLFKESRTGIWRDRKYAIQAKNAYATGVHMSENVIGKTLHKTE  397

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I+ + E CR+L+     +    +D + YV D  M+ +A  +K+FE K I
Sbjct  398  TKIRYYHYHNSISVQGELCRKLLPVSAKNNVTWIDDLPYVYDDNMKKLADKIKQFEQKAI  457

Query  531  GPV  539
            G V
Sbjct  458  GAV  460



>gb|KHG18440.1| hypothetical protein F383_21802 [Gossypium arboreum]
Length=502

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NTL+SV++    +TQFTIEQ PMS+ L
Sbjct  317  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGNTLESVLNEFSAYTQFTIEQNPMSSLL  376

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + + +  R+WGFEKL+F++S+TGIRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  377  CLNDSSQQYSRQWGFEKLLFRESRTGIRRDRKYAIQAKNAFATGVHMSENVIGKTLHKTE  436

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI   +E CR+ +     +     + + YV D  M+ +A  +K FE KTI
Sbjct  437  TKIRYYHYHNTITVHQELCREYLPPSAKNNVTWFNKLPYVYDDNMKKLANTIKEFEHKTI  496

Query  531  G  533
            G
Sbjct  497  G  497



>ref|XP_002879458.1| hypothetical protein ARALYDRAFT_902431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55717.1| hypothetical protein ARALYDRAFT_902431 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY++ A W FFFDVDE+I++P  NTL+SV+D     TQFTIEQ PMS+ L
Sbjct  308  QFLIVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVL  367

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKLVFKDS+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  368  CLNDSSQDYPRQWGFEKLVFKDSRTNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTE  427

Query  363  GRIMYYHYHGTIAQRREPCRQLV-NDTRLAV---DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++ N  +  V   + + YV D  M+ +   +K FE K +
Sbjct  428  TKIRYYHYHNTITVHEELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKL  487

Query  531  G  533
            G
Sbjct  488  G  488



>ref|XP_010927291.1| PREDICTED: uncharacterized protein LOC105049368 [Elaeis guineensis]
Length=503

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P+  TL SV+D L  +TQFTIEQ PMS+KL
Sbjct  319  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPEGRTLASVLDKLSGYTQFTIEQNPMSSKL  378

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      ++WGFEKLVF++S TG+RRDRKYA+Q R   ATGVHMSEN  G TTHKTE
Sbjct  379  CVLDPKKDYSKEWGFEKLVFRNSITGVRRDRKYAIQARKAYATGVHMSENVIGKTTHKTE  438

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ +           + I YV D  M+ +AG +K+FE +TI
Sbjct  439  DMIRYYHYHNSINVLGEPCREFIPLPPKGNVTWFEKIPYVYDDNMKRIAGTIKQFEKETI  498

Query  531  GPV  539
            G +
Sbjct  499  GSI  501



>ref|XP_008796313.1| PREDICTED: uncharacterized protein LOC103711805 [Phoenix dactylifera]
 ref|XP_008796320.1| PREDICTED: uncharacterized protein LOC103711805 [Phoenix dactylifera]
Length=503

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P+  TL SV+D L  +TQFTIEQ PMS+KL
Sbjct  319  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPEGRTLASVLDKLSGYTQFTIEQNPMSSKL  378

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      ++WGFEKLVF++S TG+RRDRKYA+Q R   ATGVHMS+N  G TTHKTE
Sbjct  379  CVLDPKKDYSKEWGFEKLVFRNSITGVRRDRKYAIQARKAYATGVHMSQNVIGKTTHKTE  438

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ +           + I YV D  M+ VAG +K+FE +TI
Sbjct  439  DMIRYYHYHNSINVLGEPCREFIPVPPKGNATWFEKIPYVYDDNMKRVAGTIKQFEKETI  498

Query  531  GPV  539
            G +
Sbjct  499  GSI  501



>gb|ACN33511.1| unknown [Zea mays]
 gb|AFW73082.1| hypothetical protein ZEAMMB73_523261 [Zea mays]
Length=523

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P    L  V+  L  ++QFTIEQ PMS+KL
Sbjct  339  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPNGQKLAEVIGQLSGYSQFTIEQNPMSSKL  398

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL++ +    R+WGFEKLVF++S T +RRDRKY +Q RNV + GVHMS+N  G TTHKTE
Sbjct  399  CLQDPSRNYSREWGFEKLVFRNSITKVRRDRKYVIQGRNVYSAGVHMSQNLYGRTTHKTE  458

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
            G I YYHYH +I    EPCR+ V    N ++   +G+ YV D  M+ +AG +KRFE  T+
Sbjct  459  GLIRYYHYHDSINVMGEPCREFVPMPANGSKTMFEGVPYVYDDNMKRLAGEIKRFEKVTL  518

Query  531  G  533
            G
Sbjct  519  G  519



>ref|XP_009417284.1| PREDICTED: uncharacterized protein LOC103997703 [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+I++P+  TL+SV+ +L  +TQFTIEQ PMS+KL
Sbjct  335  QFLVVNDCLHRYRHAANWTFFFDVDEYIYLPQGRTLESVLRNLSDYTQFTIEQNPMSSKL  394

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+++      ++WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  G TTHKTE
Sbjct  395  CVQDPKKDYSKEWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGKTTHKTE  454

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLA----VDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V           + I YV D  M+ VA  ++RFE +TI
Sbjct  455  DMIRYYHYHNSINVLGEPCREFVPLPAAGNVTWFEKIPYVYDDNMKRVADTIRRFEKQTI  514

Query  531  GPV  539
            G +
Sbjct  515  GTI  517



>gb|KJB36038.1| hypothetical protein B456_006G138000 [Gossypium raimondii]
Length=502

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NTL+SV++    +TQFTIEQ PMS+ L
Sbjct  317  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGNTLESVLNEFSAYTQFTIEQNPMSSLL  376

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + + +  R+WGFEKL+F++S+TGIRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  377  CLNDFSQQYSRQWGFEKLLFRESRTGIRRDRKYAIQAKNAFATGVHMSENVIGKTLHKTE  436

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI   +E CR+ +     +     + + YV D  M+ +A  +K FE KTI
Sbjct  437  TKIRYYHYHNTITVHQELCREYLPPSAKNNVTWFNKLPYVYDDNMKKLANTIKEFERKTI  496

Query  531  G  533
            G
Sbjct  497  G  497



>ref|XP_011041123.1| PREDICTED: uncharacterized protein LOC105137176 [Populus euphratica]
Length=495

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 127/183 (69%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W FFFDVDE+I++P+ NTL+SV+     +TQFTIEQ PMS+ L
Sbjct  309  QFLVVNDCLHRYRYSANWTFFFDVDEYIYLPEGNTLESVLKDFSNYTQFTIEQNPMSSAL  368

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  +      R+WGFEKL+F++S+TGIRRDRKYA+Q +N  ATGVHMSEN  G T H+TE
Sbjct  369  CFNDSTQDYPRQWGFEKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTLHQTE  428

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    E CR+ +     +     +G+ YV D  M+ +A  +K FE  TI
Sbjct  429  TKIRYYHYHNSIQVLGELCREFLPLSAKNNVTWYNGLPYVYDDNMKKLASTIKDFERNTI  488

Query  531  GPV  539
            G V
Sbjct  489  GNV  491



>gb|KDP36721.1| hypothetical protein JCGZ_08012 [Jatropha curcas]
Length=498

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W F+FDVDE+I++P  NTL+SV+     +TQFTIEQ PMS+ L
Sbjct  312  QFLVVNDCLHRYRYAANWTFYFDVDEYIYLPLGNTLESVLKEFSDYTQFTIEQNPMSSVL  371

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F++S+TGIRRDRKYA+Q +   ATGVHMSEN  G T HKTE
Sbjct  372  CLNDSTRDYSREWGFEKLLFRESRTGIRRDRKYAIQAKKAFATGVHMSENVVGKTLHKTE  431

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    E CR+ +  +        D + YV D  M+ +A  +K FE KTI
Sbjct  432  DKIRYYHYHNSITVPGELCREFLPPSAKKNVTLYDKLPYVYDDNMKKLAATIKEFERKTI  491

Query  531  GPV  539
            G V
Sbjct  492  GTV  494



>ref|XP_010509864.1| PREDICTED: uncharacterized protein LOC104786207 [Camelina sativa]
Length=508

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY++ A W FFFDVDE+I++P  NTL+SV+D     TQFTIEQ PMS+ L
Sbjct  321  QFLIVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVL  380

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+FKDS+  IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  381  CLNDSSQDYPRQWGFEKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTE  440

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDT---RLAV-DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++ D+   R+ + + + YV D  M+ +   +K FE K +
Sbjct  441  TKIRYYHYHNTITVHEELCREMLPDSAKKRVTLYNKLPYVYDDNMKKLVKTIKEFEQKKL  500

Query  531  G  533
            G
Sbjct  501  G  501



>emb|CBI40790.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P   TL+SV++    +TQFTIEQ PMS+ L
Sbjct  286  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGRTLESVMEEFSDYTQFTIEQNPMSSVL  345

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+F+DS+T IRRDRKYA+Q +N  +TGVHMSEN  G T HKTE
Sbjct  346  CLNDSSRNYSREWGFEKLLFRDSRTRIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTE  405

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I+ + EPCR+ +     +     D + YV D  M  +A  +K+FE  TI
Sbjct  406  TKIRYYHYHNSISVQGEPCREFLPISAKNNVTWFDKLPYVYDDNMTKLANTIKQFERNTI  465

Query  531  GPV  539
            G +
Sbjct  466  GSI  468



>ref|NP_565768.1| galactan synthase 1 [Arabidopsis thaliana]
 gb|AAB80674.2| expressed protein [Arabidopsis thaliana]
 gb|AAM61399.1| unknown [Arabidopsis thaliana]
 gb|AAM98200.1| expressed protein [Arabidopsis thaliana]
 gb|AAP68307.1| At2g33570 [Arabidopsis thaliana]
 gb|AEC08854.1| uncharacterized protein AT2G33570 [Arabidopsis thaliana]
 gb|AHL38815.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=496

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY++ A W FFFDVDE+I++P  NTL+SV+D     TQFTIEQ PMS+ L
Sbjct  309  QFLIVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVL  368

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ + +    R+WGFEKL+FKDS+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  369  CINDSSQDYPRQWGFEKLLFKDSRTKIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTE  428

Query  363  GRIMYYHYHGTIAQRREPCRQLV-NDTRLAV---DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++ N  +  V   + + YV D  M+ +   +K FE K +
Sbjct  429  TKIRYYHYHNTITVHEELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKL  488

Query  531  G  533
            G
Sbjct  489  G  489



>ref|XP_002307008.1| hypothetical protein POPTR_0005s28030g [Populus trichocarpa]
 gb|EEE94004.1| hypothetical protein POPTR_0005s28030g [Populus trichocarpa]
Length=495

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY++ A W F+FDVDE+I++P+ NTL+SV+     +TQFTIEQ PMS+ L
Sbjct  309  QFLVVNDCLHRYRYSANWTFYFDVDEYIYLPEGNTLESVLKDFSNYTQFTIEQNPMSSAL  368

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  +      R+WGFEKL+F++S+TGIRRDRKYA+Q +N  ATGVHMSEN  G T H+TE
Sbjct  369  CFNDSTQDYPRQWGFEKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTLHQTE  428

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    E CR+ +     +     +G+ YV D  M+ +A  +K FE  TI
Sbjct  429  TKIRYYHYHNSIQVPGELCREFLPLSAKNNVTWYNGLPYVYDDNMKKLASTIKDFERNTI  488

Query  531  GPV  539
            G V
Sbjct  489  GNV  491



>emb|CDY27956.1| BnaCnng05410D [Brassica napus]
Length=383

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A+W FFFDVDE+I++P  NTL++V++    +TQFTIEQ PMSN L
Sbjct  195  QFLIVNDCLHRYRHAARWTFFFDVDEYIYLPDGNTLEAVLNEFSRYTQFTIEQNPMSNVL  254

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEK++F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  255  CLNDSTQDYPRQWGFEKMLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  314

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++     D       + YV D  M+ +   VK FE K +
Sbjct  315  RKIRYYHYHNTITVHEELCREMLPVSAKDNVTFYKKLPYVYDDKMKKLVNTVKEFEEKKL  374

Query  531  G  533
            G
Sbjct  375  G  375



>ref|XP_002273918.1| PREDICTED: uncharacterized protein LOC100247851 [Vitis vinifera]
Length=504

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P   TL+SV++    +TQFTIEQ PMS+ L
Sbjct  318  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGRTLESVMEEFSDYTQFTIEQNPMSSVL  377

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+F+DS+T IRRDRKYA+Q +N  +TGVHMSEN  G T HKTE
Sbjct  378  CLNDSSRNYSREWGFEKLLFRDSRTRIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTE  437

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I+ + EPCR+ +     +     D + YV D  M  +A  +K+FE  TI
Sbjct  438  TKIRYYHYHNSISVQGEPCREFLPISAKNNVTWFDKLPYVYDDNMTKLANTIKQFERNTI  497

Query  531  GPV  539
            G +
Sbjct  498  GSI  500



>gb|EPS59182.1| hypothetical protein M569_15627, partial [Genlisea aurea]
Length=480

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NTL+SV+     +TQFTIEQ PMS+ L
Sbjct  299  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPAGNTLESVLGDFSNYTQFTIEQNPMSSLL  358

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKLVF+DS+T IRRDRKYA+Q +N  ATGVHMSEN  G + H TE
Sbjct  359  CLNDSSRDYSREWGFEKLVFRDSRTRIRRDRKYAIQAKNAFATGVHMSENVIGKSLHATE  418

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             RI YYH+H +I    E CR+++     +    +D   YV D +MR +A  +K+FEL +I
Sbjct  419  SRIRYYHFHNSITVHEELCRKMLPASAANATTWIDKTPYVYDDSMRKLAPIIKQFELDSI  478

Query  531  G  533
            G
Sbjct  479  G  479



>ref|XP_002452656.1| hypothetical protein SORBIDRAFT_04g030080 [Sorghum bicolor]
 gb|EES05632.1| hypothetical protein SORBIDRAFT_04g030080 [Sorghum bicolor]
Length=524

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 127/183 (69%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P    L  V+  L  ++QFTIEQ PMS+KL
Sbjct  340  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPSGQKLDEVLGQLSGYSQFTIEQNPMSSKL  399

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL++ +    R+WGFEKLVF++S T +RRDRKYA+Q RN  + GVHMS+N  G TTHKTE
Sbjct  400  CLQDPSRNYSREWGFEKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNLYGRTTHKTE  459

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V    N ++   +G+ YV D  M+ +A  +KRFE  T+
Sbjct  460  SLIRYYHYHNSINVMGEPCREFVPMPANGSKTMFEGVPYVYDDNMKRLADEIKRFEKVTL  519

Query  531  GPV  539
            G V
Sbjct  520  GSV  522



>ref|XP_011083362.1| PREDICTED: uncharacterized protein LOC105165907 [Sesamum indicum]
 ref|XP_011083363.1| PREDICTED: uncharacterized protein LOC105165907 [Sesamum indicum]
 ref|XP_011083364.1| PREDICTED: uncharacterized protein LOC105165907 [Sesamum indicum]
Length=544

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 124/186 (67%), Gaps = 4/186 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NTL+SV+      TQFTIEQ  MS+ L
Sbjct  355  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGNTLESVLRDFSNNTQFTIEQNAMSSVL  414

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WG EKLVF+DS+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  415  CLNDSPQGYSRQWGLEKLVFRDSRTRIRRDRKYAIQAKNAYATGVHMSENVIGGTLHKTE  474

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             RI YYHYH TI    E CR LV     +    +D I +V D  MR +A  +K FE KTI
Sbjct  475  SRIRYYHYHNTITVHEELCRNLVPVSAKNATTWLDKIPFVYDDNMRKLAPTIKEFERKTI  534

Query  531  GPVLQR  548
            G   QR
Sbjct  535  GVGSQR  540



>emb|CAN76802.1| hypothetical protein VITISV_000632 [Vitis vinifera]
Length=556

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P   TL+SV++    +TQFTIEQ PMS+ L
Sbjct  370  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGRTLESVMEEFSDYTQFTIEQNPMSSVL  429

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+F+DS+T IRRDRKYA+Q +N  +TGVHMSEN  G T HKTE
Sbjct  430  CLNDSSRNYSREWGFEKLLFRDSRTRIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTE  489

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I+ + EPCR+ +     +     D + YV D  M  +A  +K+FE  TI
Sbjct  490  TKIRYYHYHNSISVQGEPCREFLPISAKNNVTWFDKLPYVYDDNMTKLANTIKQFERNTI  549

Query  531  GPV  539
            G +
Sbjct  550  GSI  552



>ref|XP_010666271.1| PREDICTED: uncharacterized protein LOC104883439 [Beta vulgaris 
subsp. vulgaris]
Length=511

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 132/185 (71%), Gaps = 4/185 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+F AKW F+FDVDE+I++P+ N+LK+V++    FTQFTIEQ PMS+ L
Sbjct  324  QFLVVNDCLHRYRFAAKWTFYFDVDEYIYVPQGNSLKNVMEEFDGFTQFTIEQNPMSSSL  383

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKLVF+D +T IRRDRKYA+Q RN  ATGVHMSEN  G   H+T+
Sbjct  384  CLNDSSQDYSRQWGFEKLVFRDWRTRIRRDRKYAIQARNALATGVHMSENIVGKALHRTD  443

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDT---RLAV-DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    EPCR  +  +   ++ + + + YV D  M+++A  +KR E +T+
Sbjct  444  KKIRYYHYHNSIQVPGEPCRVFLPPSAKKKITIHEKLPYVYDDNMKNLADTIKRSERETL  503

Query  531  GPVLQ  545
            G   Q
Sbjct  504  GSYHQ  508



>ref|XP_002437304.1| hypothetical protein SORBIDRAFT_10g024570 [Sorghum bicolor]
 gb|EER88671.1| hypothetical protein SORBIDRAFT_10g024570 [Sorghum bicolor]
Length=509

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 127/183 (69%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  AKW FFFDVDE+IF+P   +L+ V+  L P+TQFTIEQ PMS+KL
Sbjct  325  QFLVVNDCLHRYRHAAKWTFFFDVDEYIFLPDGRSLEDVLAELEPYTQFTIEQNPMSSKL  384

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +       +WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTHKTE
Sbjct  385  CVDDPEADYSNQWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTE  444

Query  363  GRIMYYHYHGTIAQRREPCRQLVN----DTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH TI    E CR+ V+          +   +  D +M+ VA AV+ FE +TI
Sbjct  445  HLIRYYHYHNTINVLGEVCREFVSVPPKGGLTWSEKTPWYYDNSMKRVADAVREFERETI  504

Query  531  GPV  539
            G V
Sbjct  505  GDV  507



>ref|XP_006657150.1| PREDICTED: uncharacterized protein LOC102701737 [Oryza brachyantha]
Length=288

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 127/186 (68%), Gaps = 7/186 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  AKW FFFDVDE+IF+P   TL++V+  L P+TQFTIEQ PMS++L
Sbjct  101  QFLVVNDCLHRYRHAAKWTFFFDVDEYIFLPDGRTLEAVLADLEPYTQFTIEQNPMSSRL  160

Query  183  CLRE-DAGKT--HRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTH  353
            C R  D  +T    +WGFEKL F++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTH
Sbjct  161  CARNPDDPETDYSNQWGFEKLAFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTH  220

Query  354  KTEGRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFEL  521
            KTE  I YYHYH TI    E CR+ V           +   +  D +M+ +A  V+ FE 
Sbjct  221  KTEHLIRYYHYHNTINVLGEVCREFVPIPPKGGLTWSEKTPWYYDDSMKRLADTVREFER  280

Query  522  KTIGPV  539
            KTIG V
Sbjct  281  KTIGDV  286



>ref|XP_003563598.1| PREDICTED: uncharacterized protein LOC100821285 [Brachypodium 
distachyon]
Length=508

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 126/186 (68%), Gaps = 7/186 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  AKW FFFDVDE+IFIP   TL+SV+  L P+TQFTIEQ PMS++L
Sbjct  321  QFLVVNDCLHRYRHAAKWTFFFDVDEYIFIPGGRTLESVMAELEPYTQFTIEQNPMSSRL  380

Query  183  CLREDA---GKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTH  353
            C R+          +WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTH
Sbjct  381  CARDPGDPKADYSNQWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTH  440

Query  354  KTEGRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFEL  521
            KTE  I YYHYH TI    E CR+ V           +   +  D +M+ VA AV+ FE 
Sbjct  441  KTEHLIRYYHYHNTINVLGEVCREFVPVPPKGGVTWSEKTPWYYDDSMKRVANAVREFER  500

Query  522  KTIGPV  539
             TIG V
Sbjct  501  NTIGNV  506



>ref|XP_008782820.1| PREDICTED: uncharacterized protein LOC103702263 [Phoenix dactylifera]
Length=504

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRY++ A W FFFDVDE++++P  +TL+SV+  L  +TQFTIEQ PMSN L
Sbjct  320  QFMVVNDCLHRYRYAANWTFFFDVDEYLYLPDGSTLESVLGKLSGYTQFTIEQNPMSNML  379

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      R+WGFEKLVF++S TG+RRDRKYA+Q RN  ATGVHMSEN  G TTH TE
Sbjct  380  CVLDPKRNYSREWGFEKLVFRNSITGVRRDRKYAIQARNAFATGVHMSENVVGKTTHNTE  439

Query  363  GRIMYYHYHGTIAQRREPCRQLVN----DTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPC+  V           + I YV D  M   A  +++FE +TI
Sbjct  440  SMIRYYHYHNSINVLGEPCQVFVQMPDKGNVTWFEKIPYVYDDNMTRQADTIRQFEEETI  499

Query  531  GPV  539
            GPV
Sbjct  500  GPV  502



>ref|XP_010469454.1| PREDICTED: uncharacterized protein LOC104749510 [Camelina sativa]
Length=508

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 126/181 (70%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY++ A W FFFDVDE+I++P  NTL+SV++     TQFTIEQ PMS+ L
Sbjct  321  QFLIVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLEEFSVNTQFTIEQNPMSSVL  380

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+FKDS+  IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  381  CLNDSSQDYPRQWGFEKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTE  440

Query  363  GRIMYYHYHGTIAQRREPCRQLV-NDTRLAV---DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++ N  +  V   + + YV D  M+ +   +K FE K +
Sbjct  441  TKIRYYHYHNTITVHEELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKL  500

Query  531  G  533
            G
Sbjct  501  G  501



>ref|XP_006294085.1| hypothetical protein CARUB_v10023079mg [Capsella rubella]
 gb|EOA26983.1| hypothetical protein CARUB_v10023079mg [Capsella rubella]
Length=495

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A W FFFDVDE+I++P  NTL+SV+D     TQFTIEQ PMS+ L
Sbjct  308  QFLIVNDCLHRYRHAANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVL  367

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+FKDS+  IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  368  CLNDSSQDYPRQWGFEKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTE  427

Query  363  GRIMYYHYHGTIAQRREPCRQLV-NDTRLAV---DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++ N  +  V   + + YV D  M+ +   +K FE K +
Sbjct  428  TKIRYYHYHNTITVHEELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKL  487

Query  531  G  533
            G
Sbjct  488  G  488



>ref|XP_010413841.1| PREDICTED: uncharacterized protein LOC104700087 [Camelina sativa]
Length=504

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 126/181 (70%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY++ A W FFFDVDE+I++P  NTL+SV++     TQFTIEQ PMS+ L
Sbjct  317  QFLIVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLEEFSVNTQFTIEQNPMSSVL  376

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+FKDS+  IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  377  CLNDSSQDYPRQWGFEKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTE  436

Query  363  GRIMYYHYHGTIAQRREPCRQLV-NDTRLAV---DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++ N  +  V   + + YV D  M+ +   +K FE K +
Sbjct  437  TKIRYYHYHNTITVHEELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKL  496

Query  531  G  533
            G
Sbjct  497  G  497



>emb|CDY17187.1| BnaA05g10010D [Brassica napus]
Length=490

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLH+Y+  A W FFFDVDE+I++P  NTL+SV++    +TQFTIEQ PMSN L
Sbjct  302  QFLIVNDCLHKYRHAANWTFFFDVDEYIYLPDGNTLESVLNEFSRYTQFTIEQNPMSNVL  361

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEK++F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  362  CLNDSSQDYPRQWGFEKMLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  421

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++     D       + YV D  M+ +   VK FE K +
Sbjct  422  RKIRYYHYHNTITVHEELCREMLPVSAKDNVTFYKKLPYVYDDKMKKLVNTVKEFEEKKL  481

Query  531  G  533
            G
Sbjct  482  G  482



>ref|XP_009143843.1| PREDICTED: uncharacterized protein LOC103867522 [Brassica rapa]
Length=491

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLH+Y+  A W FFFDVDE+I++P  NTL+SV++    +TQFTIEQ PMSN L
Sbjct  303  QFLIVNDCLHKYRHAANWTFFFDVDEYIYLPDGNTLESVLNEFSRYTQFTIEQNPMSNVL  362

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEK++F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  363  CLNDSSQDYPRQWGFEKMLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  422

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++     D       + YV D  M+ +   VK FE K +
Sbjct  423  RKIRYYHYHNTITVHEELCREMLPVSAKDNVTFYKKLPYVYDDKMKKLVNTVKEFEEKKL  482

Query  531  G  533
            G
Sbjct  483  G  483



>emb|CDX84681.1| BnaA03g15490D [Brassica napus]
Length=449

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A+W FFFDVDE+I++P  NTLKSV+     +TQFTIEQ PMS+ L
Sbjct  261  QFLIVNDCLHRYRHAAEWTFFFDVDEYIYLPGGNTLKSVLAEFSDYTQFTIEQNPMSSVL  320

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  321  CLNDSTQDYPRQWGFEKLLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  380

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++  +          + YV D  M+ +   +K FE K +
Sbjct  381  TKIRYYHYHNTITVHEELCREMLPVSAKKKVTLYKKLPYVYDDNMKKLVNTIKEFEQKKL  440

Query  531  G  533
            G
Sbjct  441  G  441



>gb|KFK31016.1| hypothetical protein AALP_AA6G057400 [Arabis alpina]
Length=500

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY++ A W FFFDVDE+I++P  NTL+SV+D     TQFTIEQ PMS+ L
Sbjct  312  QFLIVNDCLHRYRYAANWTFFFDVDEYIYLPDGNTLESVLDGFSDNTQFTIEQNPMSSVL  371

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+FK+S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  372  CLNDSSQDYPRQWGFEKLLFKESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  431

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++     +       + +V D  M+ +   +K FE K I
Sbjct  432  KKIRYYHYHNTITVHEELCREMLPASAKNNVTFYKKLPFVFDDNMKKLVKTIKEFEQKKI  491

Query  531  G  533
            G
Sbjct  492  G  492



>ref|NP_001058107.1| Os06g0624700 [Oryza sativa Japonica Group]
 dbj|BAD35683.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20021.1| Os06g0624700 [Oryza sativa Japonica Group]
Length=489

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 128/186 (69%), Gaps = 7/186 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A+W FFFDVDE+IF+P   +L++V+  L P+TQFTIEQ PMS++L
Sbjct  302  QFLVVNDCLHRYRHAARWTFFFDVDEYIFLPDGRSLEAVLAELEPYTQFTIEQNPMSSRL  361

Query  183  CLR---EDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTH  353
            C R   E       +WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTH
Sbjct  362  CARNPDEPETDYSNEWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTH  421

Query  354  KTEGRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFEL  521
            KTE  I YYHYH TI    E CR+ V    N   +  +   +  D +M+ +A  V+ FE 
Sbjct  422  KTEHLIRYYHYHNTINVIGEVCREFVPIPPNGGLIWSEKTPWYYDDSMKRIADTVREFER  481

Query  522  KTIGPV  539
            KTIG V
Sbjct  482  KTIGDV  487



>gb|EAZ37686.1| hypothetical protein OsJ_22025 [Oryza sativa Japonica Group]
Length=522

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 128/186 (69%), Gaps = 7/186 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A+W FFFDVDE+IF+P   +L++V+  L P+TQFTIEQ PMS++L
Sbjct  335  QFLVVNDCLHRYRHAARWTFFFDVDEYIFLPDGRSLEAVLAELEPYTQFTIEQNPMSSRL  394

Query  183  CLR---EDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTH  353
            C R   E       +WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTH
Sbjct  395  CARNPDEPETDYSNEWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTH  454

Query  354  KTEGRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFEL  521
            KTE  I YYHYH TI    E CR+ V    N   +  +   +  D +M+ +A  V+ FE 
Sbjct  455  KTEHLIRYYHYHNTINVIGEVCREFVPIPPNGGLIWSEKTPWYYDDSMKRIADTVREFER  514

Query  522  KTIGPV  539
            KTIG V
Sbjct  515  KTIGDV  520



>ref|XP_004965848.1| PREDICTED: uncharacterized protein LOC101759875 [Setaria italica]
Length=512

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  AKW FFFDVDE+IF+P    L+ V+  L P+TQFTIEQ PMS++L
Sbjct  328  QFLVVNDCLHRYRHAAKWTFFFDVDEYIFLPDGRKLEDVLAELEPYTQFTIEQNPMSSRL  387

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +       +WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTHKTE
Sbjct  388  CVDDPEADYSNQWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTE  447

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH TI    E CR+ V           +   +  D +M+ VA AV+ FE +TI
Sbjct  448  HLIRYYHYHNTINVLDEVCREFVPIPPKGGLTWSEKTPWYYDDSMKRVANAVREFERETI  507

Query  531  GPV  539
            G V
Sbjct  508  GDV  510



>gb|EAZ01730.1| hypothetical protein OsI_23756 [Oryza sativa Indica Group]
Length=522

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 128/186 (69%), Gaps = 7/186 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A+W FFFDVDE+IF+P   +L++V+  L P+TQFTIEQ PMS++L
Sbjct  335  QFLVVNDCLHRYRHAARWTFFFDVDEYIFLPDGRSLEAVLAELEPYTQFTIEQNPMSSRL  394

Query  183  CLR---EDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTH  353
            C R   E       +WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTH
Sbjct  395  CARNPDEPETDYSNEWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTH  454

Query  354  KTEGRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFEL  521
            KTE  I YYHYH TI    E CR+ V    N   +  +   +  D +M+ +A  V+ FE 
Sbjct  455  KTEHLIRYYHYHNTINVIGEVCREFVPIPPNGGLIWSEKTPWYYDDSMKRIADTVREFER  514

Query  522  KTIGPV  539
            KTIG V
Sbjct  515  KTIGDV  520



>emb|CDX79534.1| BnaC03g18700D [Brassica napus]
Length=488

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A+W FFFDVDE+I++P  NTL+SV+     +TQFTIEQ PMS+ L
Sbjct  300  QFLIVNDCLHRYRHAAEWTFFFDVDEYIYLPDGNTLESVLAEFSDYTQFTIEQNPMSSVL  359

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  360  CLNDSTQGYPRQWGFEKLLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  419

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++     +       + +V D +M+ +   +K FE K I
Sbjct  420  TKIRYYHYHNTITVHEELCREMLPASAKEKVTLYKKLPFVYDDSMKKLVNTIKEFEQKKI  479

Query  531  G  533
            G
Sbjct  480  G  480



>gb|EYU41216.1| hypothetical protein MIMGU_mgv1a005071mg [Erythranthe guttata]
Length=498

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHR++  A W F+FDVDE+I+IP  ++L+SV+      TQFTIEQ  +S+ L
Sbjct  306  QFLVVNDCLHRHRHSANWTFYFDVDEYIYIPDGDSLESVLHDFSNNTQFTIEQNAISSVL  365

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEK+VF+DS+T IRRDRKYA+Q RN  ATGVHMSEN  G T H TE
Sbjct  366  CLNDSTQDYSRQWGFEKMVFRDSRTKIRRDRKYAIQARNAYATGVHMSENVVGGTLHDTE  425

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             RI YYHYH TI    E CR ++          +D I YV D  M+ +A  VK+FE  TI
Sbjct  426  SRIRYYHYHSTITVHEELCRNMLPMSAKKATTYLDKIPYVYDDNMKKLAPTVKKFERDTI  485

Query  531  GPVLQRTRQ  557
            G   QR R+
Sbjct  486  GVGSQRRRR  494



>gb|EMT15330.1| hypothetical protein F775_17170 [Aegilops tauschii]
Length=576

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 127/184 (69%), Gaps = 7/184 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A+W FFFDVDE+IF+P   TL+ V+  L P+TQFTIEQ PMS++L
Sbjct  317  QFLVVNDCLHRYRHAARWTFFFDVDEYIFLPDGRTLEGVLAELDPYTQFTIEQNPMSSRL  376

Query  183  CLR---EDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTH  353
            C R   +      ++WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTH
Sbjct  377  CARGANDSEADFSKQWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTH  436

Query  354  KTEGRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFEL  521
            KTE  I YYHYH TI    E CR+LV           +   +  D +M+ VA AV+ FE 
Sbjct  437  KTEHLIRYYHYHNTINVPGELCRELVPVPPKGGVTWSEKTPWYYDDSMKRVANAVREFEK  496

Query  522  KTIG  533
            +TIG
Sbjct  497  RTIG  500



>ref|XP_002510749.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52936.1| conserved hypothetical protein [Ricinus communis]
Length=487

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 128/185 (69%), Gaps = 4/185 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  +TL+SV+     +TQFTIEQ PMS+ L
Sbjct  301  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGSTLQSVLAEFSDYTQFTIEQNPMSSVL  360

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+F++S++GIRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  361  CLNDSSHDYPREWGFEKLLFRESRSGIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  420

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I  + E CRQL+  +        + + YV D  M+ +   ++ FE  TI
Sbjct  421  TKIRYYHYHNSITVQGELCRQLLPASAKHNVTWYNKLPYVYDDNMKKLVTTIRDFERNTI  480

Query  531  GPVLQ  545
            G V Q
Sbjct  481  GNVRQ  485



>dbj|BAJ98571.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=623

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 125/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P    L  V+  L  +TQFTIEQ PMS KL
Sbjct  438  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPDGQALDQVLAKLSGYTQFTIEQNPMSTKL  497

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C++       R+WGFEK VF++S T +RRDRKYA+Q RN  ATGVHMS+N  G +THKTE
Sbjct  498  CVKNPRNDYSREWGFEKFVFRNSITRVRRDRKYAIQARNAYATGVHMSQNVYGRSTHKTE  557

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPC++ V       ++  +G+ YV D TM+ +AG ++RFE +TI
Sbjct  558  TLIRYYHYHNSINVLGEPCQEFVPRPGRGRKVMFEGVPYVYDDTMKRLAGEIRRFENETI  617

Query  531  G  533
            G
Sbjct  618  G  618



>ref|XP_009132936.1| PREDICTED: uncharacterized protein LOC103857495 [Brassica rapa]
Length=493

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A+W FFFDVDE+I++P  NTL+SV+     +TQFTIEQ PMS+ L
Sbjct  305  QFLIVNDCLHRYRHAAEWTFFFDVDEYIYLPGGNTLESVLAEFSDYTQFTIEQNPMSSVL  364

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +      R+WGFEKL+F++S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  365  CLNDSTQDYPRQWGFEKLLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  424

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+++  +          + YV D  M+ +   +K FE K +
Sbjct  425  TKIRYYHYHNTITVHEELCREMLPVSAKKKVTLYKKLPYVYDDNMKKLVNTIKEFEQKKL  484

Query  531  G  533
            G
Sbjct  485  G  485



>ref|XP_009415437.1| PREDICTED: uncharacterized protein LOC103996273 [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 127/183 (69%), Gaps = 5/183 (3%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE++++P+  TL+SV+ +L  +TQFTIEQ PMS+KL
Sbjct  323  QFLVVNDCLHRYRHAANWTFYFDVDEYLYLPEGRTLESVLANLSAYTQFTIEQNPMSSKL  382

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C   D+    R WGFEKLVF++S T +RRDRKYA+Q +N  ATGVHMSEN  G TTH+TE
Sbjct  383  CAL-DSKDYSRDWGFEKLVFRNSITRVRRDRKYAIQAKNAYATGVHMSENIIGKTTHRTE  441

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLA----VDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPCR+ V           + I YV D  M+ +A  +KRFE +TI
Sbjct  442  DMIRYYHYHNSINVLGEPCREFVPSPAQGNVTWFEKIPYVYDDNMKRLAETIKRFEKQTI  501

Query  531  GPV  539
            G +
Sbjct  502  GSI  504



>ref|XP_010539085.1| PREDICTED: uncharacterized protein LOC104813216 [Tarenaya hassleriana]
Length=493

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 122/181 (67%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A W FFFDVDE+I++P  NTL+S++      TQFTIEQ PMS+ L
Sbjct  304  QFLIVNDCLHRYRHAANWTFFFDVDEYIYLPNGNTLESILAEFSDNTQFTIEQNPMSSVL  363

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL +       +WGFEKLVF++S+TGIRRDRKYA+Q RN  ATGVHMSENA G T H+TE
Sbjct  364  CLNDSTQDYAGQWGFEKLVFRESRTGIRRDRKYAIQARNTYATGVHMSENAIGKTLHRTE  423

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH TI    E CR+L+  +        + + Y  D  M  +   VK FE +T+
Sbjct  424  TKIRYYHYHNTITFHEELCRELLPASAKKKVTLYNKLPYNYDDNMNKLVKTVKEFEQRTL  483

Query  531  G  533
            G
Sbjct  484  G  484



>dbj|BAK07243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 126/186 (68%), Gaps = 7/186 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A+W FFFDVDE+IF+P   TL  V+  L P+TQFTIEQ PMS++L
Sbjct  318  QFLVVNDCLHRYRHAARWTFFFDVDEYIFLPDGRTLDGVLAELDPYTQFTIEQNPMSSRL  377

Query  183  CLR---EDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTH  353
            C R   +      ++WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTH
Sbjct  378  CARGANDSMADYSKQWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTH  437

Query  354  KTEGRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFEL  521
            KTE  I YYHYH TI    E CR++V           +   +  D +M+ VA AV+ FE 
Sbjct  438  KTEHLIRYYHYHNTINVPGELCREIVPVPPKGGLTWSEKTPWYYDDSMKLVANAVREFEK  497

Query  522  KTIGPV  539
            + IG V
Sbjct  498  RNIGNV  503



>ref|XP_010063184.1| PREDICTED: uncharacterized protein LOC104450362 [Eucalyptus grandis]
 gb|KCW70384.1| hypothetical protein EUGRSUZ_F03619 [Eucalyptus grandis]
Length=504

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE+IF+P  ++L+SV+     +TQFTIEQ PMS+ L
Sbjct  315  QFLVVNDCLHRYRHAANWTFFFDVDEYIFLPDGSSLESVLTEFGNYTQFTIEQNPMSSVL  374

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+F+DS+TGIRRDRKYA+Q +N  ATGVHMSEN  G   HKTE
Sbjct  375  CLNDSSQDYSREWGFEKLLFRDSRTGIRRDRKYAIQAKNAFATGVHMSENVVGEALHKTE  434

Query  363  GRIMYYHYHGTIAQRREPCRQLVN-DTRLAV---DGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    E CR+L+    R  V   D   +V D  M+ +A  +K FE   I
Sbjct  435  DKIRYYHYHNSITVPGELCRELLPMSARRNVTWYDKRPFVYDDHMKKLAPVIKEFERNAI  494

Query  531  GPV  539
            G V
Sbjct  495  GNV  497



>ref|XP_006410501.1| hypothetical protein EUTSA_v10016550mg [Eutrema salsugineum]
 gb|ESQ51954.1| hypothetical protein EUTSA_v10016550mg [Eutrema salsugineum]
Length=502

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 125/183 (68%), Gaps = 8/183 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A W FFFDVDE+I++P  NTL+SV+      TQFTIEQ PMSN L
Sbjct  314  QFLIVNDCLHRYRHAANWTFFFDVDEYIYLPDGNTLESVLAEFSVNTQFTIEQNPMSNVL  373

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + +    R+WGFEKL+FK+S+T IRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  374  CLNDASQDYPRQWGFEKLLFKESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTE  433

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGIS------YVVDPTMRDVAGAVKRFELK  524
             +I YYHYH TI    E CR+++  +  A + ++      +V D  M+ +   VK FE K
Sbjct  434  KKIRYYHYHNTITVHEELCREMLPVS--AKNNVTFYKKRPFVYDDNMKKLVKTVKEFEKK  491

Query  525  TIG  533
             +G
Sbjct  492  KLG  494



>ref|XP_010932160.1| PREDICTED: uncharacterized protein LOC105052881 [Elaeis guineensis]
Length=527

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P+   L SV+D L  +TQFTIEQ  MS+KL
Sbjct  345  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPEGRRLASVLDKLSQYTQFTIEQNSMSSKL  404

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      ++WG EKLVF++S TG+RRDRKYA+Q RN  ATGVHMSEN  G TTH TE
Sbjct  405  CVLDPNKDYSKEWGLEKLVFRNSITGVRRDRKYAIQARNAYATGVHMSENVIGKTTHNTE  464

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
                YYHYH +I    EPC++ +           +GI YV D  M+ +A  VK+FE +TI
Sbjct  465  DMFRYYHYHNSINVLGEPCQEFMPMPAKGKVTWFEGIPYVYDNNMKRMAEVVKQFEKETI  524

Query  531  GPV  539
            G V
Sbjct  525  GSV  527



>ref|XP_010556045.1| PREDICTED: uncharacterized protein LOC104825419 [Tarenaya hassleriana]
Length=505

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 121/181 (67%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCLHRY+  A W F+FDVDE+I++P  NTL+SV+      TQFTIEQ PMS+ L
Sbjct  315  QFLIVNDCLHRYRHAANWTFYFDVDEYIYLPGGNTLESVLSEFSDNTQFTIEQNPMSSVL  374

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL + A     +WGFEKL F++S+TGIRRDRKYA+Q +N  ATGVHMSEN  G T HKTE
Sbjct  375  CLNDSAQDYAGQWGFEKLQFRESRTGIRRDRKYAIQAKNAYATGVHMSENVVGKTLHKTE  434

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH TI    E CR+L+  +        +   YV D  M+ +   V+ FE +T+
Sbjct  435  TNIRYYHYHNTITVHEELCRELLPVSAKKKVTLFNKHPYVYDDNMKKLVKTVREFEQRTL  494

Query  531  G  533
            G
Sbjct  495  G  495



>ref|XP_008799144.1| PREDICTED: uncharacterized protein LOC103713874 [Phoenix dactylifera]
Length=503

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P+  TL SV+D L  +TQFTI Q PMS+KL
Sbjct  321  QFLVVNDCLHRYRHAANWTFFFDVDEYLYLPEGRTLASVLDKLSQYTQFTIVQNPMSSKL  380

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C+ +      ++WGFEKLVF++S TG+RRDRKYA+Q RN  ATGVHMSEN  G TTH T+
Sbjct  381  CVLDLNKDYSKEWGFEKLVFRNSITGVRRDRKYAIQARNAFATGVHMSENVIGKTTHNTK  440

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYHYH +I    EPC + +           + I YV D  M+ +A  VK+FE + I
Sbjct  441  DMIRYYHYHSSINVLGEPCHEFMPMPAKGKVTWFEKIPYVYDDNMKRMAEVVKQFEKEAI  500

Query  531  GPV  539
            G +
Sbjct  501  GSI  503



>ref|XP_009778585.1| PREDICTED: uncharacterized protein LOC104227908 [Nicotiana sylvestris]
Length=480

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NTL+SV+      TQFTIEQ  MS+ L
Sbjct  291  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGNTLESVLREFSNNTQFTIEQNAMSSML  350

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  + +    R+WGFEKL+F+DS+T IRRDRKYA+Q +N  ATGVHMSEN  G T H+TE
Sbjct  351  CFNDSSQDYSRQWGFEKLLFRDSRTNIRRDRKYAIQAKNAYATGVHMSENVIGGTLHQTE  410

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    E CR+ V  +        D   YV D  M+ +A  +K FE  TI
Sbjct  411  TKIRYYHYHNSITVHEELCREFVPSSSKHNITWFDKRPYVYDDNMKKLAQTIKDFERHTI  470



>ref|XP_009595951.1| PREDICTED: uncharacterized protein LOC104092135 [Nicotiana tomentosiformis]
 ref|XP_009595953.1| PREDICTED: uncharacterized protein LOC104092135 [Nicotiana tomentosiformis]
Length=468

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NTL+SV+      TQFTIEQ  MS+ L
Sbjct  279  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDGNTLESVLREFSNNTQFTIEQNAMSSML  338

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            C  + +    R+WGFEKL+F+DS+T IRRDRKYA+Q +N  ATGVHMSEN  G T H+TE
Sbjct  339  CFNDSSQDYSRQWGFEKLLFRDSRTNIRRDRKYAIQAKNAYATGVHMSENVIGGTLHQTE  398

Query  363  GRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKTI  530
             +I YYHYH +I    E CR+ V  +        D   YV D  M+ +A  +K FE  TI
Sbjct  399  TKIRYYHYHNSITVHEELCREFVPLSSKHNITWFDKRPYVYDDNMKKLAQTIKDFERNTI  458



>ref|XP_003570222.1| PREDICTED: uncharacterized protein LOC100831738 [Brachypodium 
distachyon]
Length=528

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCLHRY+  A W FFFDVDE++++P   TL  V+ +L  +TQ TI+Q PMS+KL
Sbjct  344  QFLVVNDCLHRYRHAANWTFFFDVDEYMYLPNGRTLDQVLGNLSGYTQLTIKQNPMSSKL  403

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTE  362
            CL+  +  + R+WGFEK VF ++    RRDRKYAVQ RN  + GVH+S+N  G +TH TE
Sbjct  404  CLKNPSKDSSREWGFEKFVFFNAVVKPRRDRKYAVQARNTYSAGVHLSQNLYGRSTHDTE  463

Query  363  GRIMYYHYHGTIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTI  530
              I YYH+H +I    EPC++ V    N +++  +G  +V D  ++ +AG +KRFE +TI
Sbjct  464  NVIRYYHFHNSINVLGEPCKKFVAKPANGSQIMFEGAPFVYDYNLKRLAGEIKRFEKETI  523

Query  531  G  533
            G
Sbjct  524  G  524



>ref|XP_004966964.1| PREDICTED: uncharacterized protein LOC101757183 [Setaria italica]
Length=490

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +3

Query  33   RYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCLREDAGKTH  212
            RY+  A W FFFDVDE+I++P   TL+ V+  L  +TQFTIEQ PMS+KLC+ +   +  
Sbjct  316  RYRHAANWTFFFDVDEYIYLPDGRTLQEVLGQLERYTQFTIEQNPMSSKLCVEDPNKEYS  375

Query  213  RKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTEGRIMYYHYHG  392
            R+WGFEKLVF++S TG+RRDRKYA+Q RN  +TGVHMS+N  G T+HKTE  I YYHYH 
Sbjct  376  REWGFEKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVIGRTSHKTERLIRYYHYHN  435

Query  393  TIAQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
            +I    EPCR+ V    N +++  +GI YV D  M+ +   +KRFE +TIG +
Sbjct  436  SINIMGEPCREFVQKPTNGSKVMFEGIPYVYDDNMKRLTVEIKRFEEETIGAI  488



>ref|XP_006342202.1| PREDICTED: uncharacterized protein LOC102591298 [Solanum tuberosum]
Length=460

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 119/190 (63%), Gaps = 5/190 (3%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNT-LKSVVDSLFPFTQFTIEQMPMSNK  179
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NT L+SV+      TQFTIEQ  MS+ 
Sbjct  270  QFLVVNDCLHRYRHAANWTFYFDVDEYIYLPDANTTLESVLRDFSNNTQFTIEQNAMSSI  329

Query  180  LCLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            LCL + +    R WGFEKL+F+DS++ IRRDRKYA+Q +N  ATGVHMSEN  G T H+T
Sbjct  330  LCLNDSSQNYSRLWGFEKLLFRDSRSNIRRDRKYAIQAKNAYATGVHMSENVVGGTLHQT  389

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKT  527
            E +I YYHYH +I    E CR+ +  +        D + Y  D  M+ +   +K FE  T
Sbjct  390  ETKIRYYHYHNSITVHEELCREFLPISAKHNITWFDKVPYEYDDNMKKLTQTIKDFERNT  449

Query  528  IGPVLQRTRQ  557
            I      T  
Sbjct  450  INAAPDHTNN  459



>gb|AFK35556.1| unknown [Lotus japonicus]
Length=126

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +3

Query  48   AKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCLREDAGKTHRKWGF  227
             KWMFFFDVDEFI++P K+T+K+V+DSL  + QFTIEQMPMS+KLCL  D GKT+RKWGF
Sbjct  2    GKWMFFFDVDEFIYVPPKSTIKTVLDSLSEYNQFTIEQMPMSSKLCLSSDYGKTYRKWGF  61

Query  228  EKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTEGRIMYYHYHGTIAQR  407
            EK V+KD K GIRRDRKYAVQPR++ ATGVHMS+N  G TTHKTEG+I  +     I  R
Sbjct  62   EKFVYKDVKKGIRRDRKYAVQPRSLYATGVHMSQNLEGKTTHKTEGKIKKFELK-MIGDR  120

Query  408  REPCRQ  425
             +  RQ
Sbjct  121  LQKTRQ  126



>ref|XP_004238474.1| PREDICTED: uncharacterized protein LOC101247215 [Solanum lycopersicum]
Length=448

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 118/182 (65%), Gaps = 5/182 (3%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNT-LKSVVDSLFPFTQFTIEQMPMSNK  179
            QFL+VNDCLHRY+  A W F+FDVDE+I++P  NT L+SV+      TQFTIEQ  MS+ 
Sbjct  256  QFLVVNDCLHRYRHSAYWTFYFDVDEYIYLPDANTTLESVLRDFSNNTQFTIEQNAMSSI  315

Query  180  LCLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            LCL   +    R WGFEKL+F+DS++ IRRDRKYA+Q +N  ATGVHMSEN  G T H+T
Sbjct  316  LCLNNSSQNYSRLWGFEKLLFRDSRSNIRRDRKYAIQAKNAYATGVHMSENVVGGTLHQT  375

Query  360  EGRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKRFELKT  527
            E +I YYHYH +I    E CR+ +  +        D + Y  D +M+ +   +K FE  T
Sbjct  376  ETKIRYYHYHNSITVHEELCREFLPMSAKHNITWFDKVPYEYDDSMKKLTQTIKDFERNT  435

Query  528  IG  533
            I 
Sbjct  436  IN  437



>gb|EMS66628.1| hypothetical protein TRIUR3_12773 [Triticum urartu]
Length=224

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 115/171 (67%), Gaps = 7/171 (4%)
 Frame = +3

Query  48   AKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCLR---EDAGKTHRK  218
            A+W FFFDVDE+IF+P   TL  V+  L P+TQFTIEQ PMS++LC R   +      ++
Sbjct  52   ARWTFFFDVDEYIFLPDGRTLDGVLAELDPYTQFTIEQNPMSSRLCARGANDSEADYSKQ  111

Query  219  WGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTEGRIMYYHYHGTI  398
            WGFEKLVF++S TG+RRDRKYA+Q +N  ATGVHMSEN  GNTTHKTE  I YYHYH TI
Sbjct  112  WGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTI  171

Query  399  AQRREPCRQLV----NDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
                E CR+LV        +  +   +  D +M+ +A AV+ FE +TIG V
Sbjct  172  NVPGELCRELVPVPPKGGVMWSEKTPWYHDDSMKRLANAVREFEKRTIGNV  222



>ref|XP_002964794.1| hypothetical protein SELMODRAFT_82649 [Selaginella moellendorffii]
 gb|EFJ33632.1| hypothetical protein SELMODRAFT_82649 [Selaginella moellendorffii]
Length=441

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 118/185 (64%), Gaps = 7/185 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLF-PFTQFTIEQMPMSNK  179
            QFL+VNDCL RYK  A W FFFDVDE++ +P  +TL SV++ L   ++Q   +Q PM + 
Sbjct  256  QFLVVNDCLFRYKHAANWTFFFDVDEYVHVPGPSTLGSVLNELGQKYSQIIFKQTPMGHN  315

Query  180  LCLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            +C+  +     R+WGFEKLVF + +  +R DRKY ++     + GVH+SEN  G + + +
Sbjct  316  VCIDSNRTNLSRQWGFEKLVFINVQKSVRLDRKYVLRAPLADSAGVHLSENVRGKSLY-S  374

Query  360  EGRIMYYHYHGTIAQRREPCRQLVN-----DTRLAVDGISYVVDPTMRDVAGAVKRFELK  524
             G+I Y+H+H TI + +E CR+ V       +++ ++ I Y+ D  +  +A  VK+FEL+
Sbjct  375  RGQISYFHFHNTITEHQENCREFVKVPKNRTSKVWLNKIPYLYDDKLSTLADEVKQFELQ  434

Query  525  TIGPV  539
            TIGPV
Sbjct  435  TIGPV  439



>ref|XP_002961724.1| hypothetical protein SELMODRAFT_77156 [Selaginella moellendorffii]
 gb|EFJ36984.1| hypothetical protein SELMODRAFT_77156 [Selaginella moellendorffii]
Length=441

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 118/185 (64%), Gaps = 7/185 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLF-PFTQFTIEQMPMSNK  179
            QFL+VNDCL RYK  A W FFFDVDE++ +P  +TL SV++ L   ++Q   +Q PM + 
Sbjct  256  QFLVVNDCLFRYKHAANWTFFFDVDEYVHVPGPSTLDSVLNELGQKYSQIIFKQTPMGHN  315

Query  180  LCLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKT  359
            +C+  +     R+WGFEKLVF + +  +R DRKY ++     + GVH+SEN  G + + +
Sbjct  316  VCIDSNRTNLSRQWGFEKLVFINVQKSVRLDRKYVLRAPLADSAGVHLSENVRGKSLY-S  374

Query  360  EGRIMYYHYHGTIAQRREPCRQLVN-----DTRLAVDGISYVVDPTMRDVAGAVKRFELK  524
             G+I Y+H+H TI + +E CR+ V       +++ ++ + Y+ D  +  +A  VK+FEL+
Sbjct  375  RGQISYFHFHNTITEHQENCREFVKVPKNRTSKVWLNKVPYLYDDKLSTLADEVKQFELQ  434

Query  525  TIGPV  539
            TIGPV
Sbjct  435  TIGPV  439



>ref|XP_001775945.1| predicted protein [Physcomitrella patens]
 gb|EDQ59310.1| predicted protein, partial [Physcomitrella patens]
Length=397

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 114/185 (62%), Gaps = 8/185 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCL R +F A W FFFDVDE++++    TL  V++     TQ TIEQ+PM+  +
Sbjct  212  QFLIVNDCLFRSRFMANWTFFFDVDEYMYVEPTTTLSQVLNENPNITQITIEQVPMAKDI  271

Query  183  CLREDA--GKTHRKWGFEKLVFKDS-KTGIRRDRKYAVQPRNVAATGVHMSENA-AGNTT  350
            C+ ++A  G     WGFEKLV++   K G+R DRKYAVQ R+  A G+HMS N   G   
Sbjct  272  CVADNATRGDLKSSWGFEKLVYRKVLKPGLRYDRKYAVQARHAEAAGIHMSMNMLKGQNL  331

Query  351  HKTEGRIMYYHYHGTIAQRREPCRQLV---NDTRLAV-DGISYVVDPTMRDVAGAVKRFE  518
            +    +I YYHYHGTI +R E C++ V   N T L   D   + ++ T+  +A  VK +E
Sbjct  332  YPKGDKIRYYHYHGTINKRGEVCKKFVDAGNKTALQTHDNHYHRLEETIAKMAKDVKLYE  391

Query  519  LKTIG  533
            L T+G
Sbjct  392  LNTVG  396



>ref|XP_001777796.1| predicted protein [Physcomitrella patens]
 gb|EDQ57334.1| predicted protein [Physcomitrella patens]
Length=382

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 109/180 (61%), Gaps = 3/180 (2%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCL R +F A W FFFD+DE++++    TL  V++     +Q  I+Q+P+ + L
Sbjct  197  QFMVVNDCLFRSRFLANWTFFFDIDEYMYVDPSTTLSDVLNEKPDVSQIVIKQVPIESGL  256

Query  183  CLREDAGKTHRKWGFEKLVFKDS-KTGIRRDRKYAVQPRNVAATGVHMSENA-AGNTTHK  356
            C+ ++    H +W  E+L+++   K GI  DRKYAVQ R+  ATG+HMS N   G T   
Sbjct  257  CVADNTRDQHERWLTERLIYRRVLKHGIHYDRKYAVQARHAEATGIHMSMNLRRGKTRVL  316

Query  357  TEGRIMYYHYHGTIAQRREPCRQLVND-TRLAVDGISYVVDPTMRDVAGAVKRFELKTIG  533
             + R+ YYHYHGTI  R   C + V+   + AV  +   +D TM  +A  VK +ELK IG
Sbjct  317  QDERLRYYHYHGTITNRGNLCNKFVDSKNKTAVKSVQLRLDETMMKMAKDVKSYELKMIG  376



>ref|XP_001758982.1| predicted protein [Physcomitrella patens]
 gb|EDQ76051.1| predicted protein, partial [Physcomitrella patens]
Length=386

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 110/185 (59%), Gaps = 8/185 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFL+VNDCL R +F A W FFFDVDE++ +P   TL  V++     TQ T EQ+P+SN L
Sbjct  201  QFLVVNDCLFRSRFMANWTFFFDVDEYLHVPPTTTLDKVLNDNPNVTQITFEQVPISNNL  260

Query  183  CLRED--AGKTHRKWGFEKLVFKDS-KTGIRRDRKYAVQPRNVAATGVHMSENA-AGNTT  350
            C+ ++       RKW  EKL+++   ++G+R DRKYAVQ R  AATGVHMS N   G   
Sbjct  261  CVADNITTDGHARKWAIEKLMYRKVLRSGVRYDRKYAVQARYAAATGVHMSMNMRKGKNM  320

Query  351  HKTEGRIMYYHYHGTIAQRREPCRQLV---NDTRLAV-DGISYVVDPTMRDVAGAVKRFE  518
            +    +I YYHYH TI +R E C+  V   N T L      +Y +D T+      +K +E
Sbjct  321  YPKGYKIRYYHYHDTINKREELCQAFVSPQNKTSLQRHQRQNYRLDETLAMTTQLIKDYE  380

Query  519  LKTIG  533
             +TIG
Sbjct  381  RRTIG  385



>ref|NP_191658.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_199630.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB94135.1| putative protein [Arabidopsis thaliana]
 dbj|BAA96999.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95631.1| uncharacterized protein AT5G48190 [Arabidopsis thaliana]
 gb|AEE80135.1| uncharacterized protein AT3G60990 [Arabidopsis thaliana]
Length=102

 Score =   127 bits (319),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +3

Query  51   KWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCLREDA-GKTHRKWGF  227
            KWMFFFDVDEF+ +P K T+ SV++SL  + QFTIE MPMS+++C   D   +T+RKWG 
Sbjct  3    KWMFFFDVDEFLHVPVKETISSVMESLEEYFQFTIELMPMSSRVCYSGDGPARTYRKWGI  62

Query  228  EKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNT  347
            EKL ++D K   RRDRKYAVQP NV A GVHMS+N  G T
Sbjct  63   EKLAYRDVKKVPRRDRKYAVQPENVFAIGVHMSQNLQGKT  102



>ref|NP_187394.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF02147.1|AC009853_7 unknown protein [Arabidopsis thaliana]
 gb|AEE74536.1| uncharacterized protein AT3G07380 [Arabidopsis thaliana]
Length=102

 Score =   125 bits (313),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +3

Query  51   KWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCLREDA-GKTHRKWGF  227
            KWMFF DVDEF+ +P K T+ SV++SL  + QFTIE MPMS+++C   D   +T+RKWG 
Sbjct  3    KWMFFVDVDEFLHVPVKETISSVMESLEEYFQFTIELMPMSSQVCYSGDGPARTYRKWGI  62

Query  228  EKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNT  347
            EKL ++D K   RRDRKYAVQP NV A GVHMS+N  G T
Sbjct  63   EKLAYRDVKKVPRRDRKYAVQPENVFAIGVHMSQNLQGKT  102



>ref|XP_001769268.1| predicted protein [Physcomitrella patens]
 gb|EDQ65980.1| predicted protein, partial [Physcomitrella patens]
Length=414

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 100/188 (53%), Gaps = 10/188 (5%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIP-KKNTLKSVVDSLFPFTQFTIEQMPMSNK  179
            QFL+VNDC HR +  A W+FFFDVDE+I+ P   N+L S++      +Q  I Q PMS  
Sbjct  222  QFLVVNDCFHRARRLAHWLFFFDVDEYIWAPPNDNSLASILARFEDQSQIIIWQKPMSKS  281

Query  180  LCLREDAGKTH-----RKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGN  344
            LC ++    ++      KW FEKLVFK  K     D KYA++     ATG+H S    G+
Sbjct  282  LCAQDQGAASNDSSFASKWTFEKLVFKSIKWRESHDCKYAIRGLKAMATGIHRSGYLIGS  341

Query  345  TTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGIS----YVVDPTMRDVAGAVKR  512
                    + YYHYH TI +R E C Q ++   + V+  +    +  D  +  +A  +K 
Sbjct  342  NATTYADPLNYYHYHNTINKREEVCEQFIDSNSVYVNPRNRTDKFAYDDGLAVLADHIKE  401

Query  513  FELKTIGP  536
            FEL  IGP
Sbjct  402  FELDVIGP  409



>ref|XP_001759086.1| predicted protein [Physcomitrella patens]
 gb|EDQ76155.1| predicted protein, partial [Physcomitrella patens]
Length=414

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 102/188 (54%), Gaps = 10/188 (5%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIP-KKNTLKSVVDSLFPFTQFTIEQMPMSNK  179
            QF++VNDC HR +  A+W+FFFDVDEFI+ P   N+L +++      +Q  I Q PMS  
Sbjct  222  QFMVVNDCFHRARHLARWIFFFDVDEFIWAPPNDNSLPAILARYENQSQIIIWQKPMSKS  281

Query  180  LCLRE--DAGKTH---RKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGN  344
            LC +E  +AG      RKW FEKLVFK  K     D KYA+Q +    TG+H S +  G 
Sbjct  282  LCAQEQGEAGNDSSFSRKWTFEKLVFKSIKWRESHDCKYAIQGQKAMGTGIHRSGHLIGG  341

Query  345  TTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDGIS----YVVDPTMRDVAGAVKR  512
                    + YYHYH TI +R E C   ++ + + V+  +    Y  D  +  +A  +K 
Sbjct  342  NATTYADPLNYYHYHNTINKRDEVCEDFIDKSVVYVNPRNRTDIYTHDDGLAVLADHIKE  401

Query  513  FELKTIGP  536
            FE   IGP
Sbjct  402  FERDVIGP  409



>ref|XP_001758423.1| predicted protein [Physcomitrella patens]
 gb|EDQ76825.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 117/185 (63%), Gaps = 8/185 (4%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QFLIVNDCL R +F A W FFFD+DEFIF+    TL +V++     TQ TIEQ PM+  L
Sbjct  282  QFLIVNDCLFRSRFLANWTFFFDIDEFIFVEPTTTLSAVLNENPNITQITIEQTPMAKDL  341

Query  183  CLRED--AGKTHRKWGFEKLVFKDS-KTGIRRDRKYAVQPRNVAATGVHMS-ENAAGNTT  350
            C+ ++  +G+   +WGFEKL+++   K GIR DRK+ VQ R+  ATG+HMS +   G   
Sbjct  342  CVADNTTSGEHESRWGFEKLIYRKVLKRGIRYDRKFVVQARHAEATGIHMSMDTRHGQNL  401

Query  351  HKTEGRIMYYHYHGTIAQRREPCRQLVN-DTRLAV---DGISYVVDPTMRDVAGAVKRFE  518
            +    +I YYHYHGTI +R+E C + V+   + AV   +   + +D +M  +A  VK FE
Sbjct  402  YPKGDKIRYYHYHGTINKRQEVCTRFVDAGNKTAVQRHEKHYHRLDESMAKLAKDVKLFE  461

Query  519  LKTIG  533
            L T+G
Sbjct  462  LNTVG  466



>ref|XP_001757048.1| predicted protein [Physcomitrella patens]
 gb|EDQ78279.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 100/195 (51%), Gaps = 20/195 (10%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSL--FPFTQFTIEQMPMSN  176
            QF ++NDC+ R +  + W FFFDVDE+++IP    L+ ++D      FTQ  ++ + M++
Sbjct  307  QFTMLNDCMFRAQTLSNWTFFFDVDEYLYIPPNKILQQILDESERMNFTQIRMKTIKMND  366

Query  177  KLCLREDA--------GKTHRKWGFEKLVFKDSKTGIR--RDRKYAVQPRNVAATGVHMS  326
             LC + D             RKW  EKLV+ +   G      RKYA++PR   ATGVH  
Sbjct  367  ALCTKPDPPLDDAARDAYWRRKWAIEKLVYANCDYGWEPVESRKYALKPRAAWATGVHYC  426

Query  327  EN-AAGNTTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTR-----LAVDGISYVVDPTMR  488
            E    G      E  +  YHYHGT    +E CR   N T      L V   +  VD TM 
Sbjct  427  EYLKEGGLMDADENLLRLYHYHGTTPGPKEVCRDFTNGTNGEPNYLGVKNCT--VDRTMT  484

Query  489  DVAGAVKRFELKTIG  533
             +A  VK+FEL+TIG
Sbjct  485  TLANPVKQFELQTIG  499



>ref|XP_008346109.1| PREDICTED: uncharacterized protein LOC103409067 [Malus domestica]
Length=411

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCL RYKF AKWMFFFDVDE+I++P K+ LKSV+DSL  +TQFTIEQMPMS+KL
Sbjct  338  QFMVVNDCLFRYKFMAKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKL  397

Query  183  CLREDAGKTHRK  218
            CL ED  KT+ +
Sbjct  398  CLLEDYHKTYSE  409



>ref|XP_007040981.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
 gb|EOX96812.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
Length=427

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKW+FFFDVDEFI++P K+T++SV+DSL  ++QFTIEQMPMS+KL
Sbjct  332  QFMVVNDCLHRYKFMAKWIFFFDVDEFIYVPPKSTIRSVLDSLSDYSQFTIEQMPMSSKL  391

Query  183  CLREDAGKTHR-KW-GFE  230
            C   DA K +R  W GF+
Sbjct  392  CHTVDAAKRNRWNWSGFQ  409



>gb|KHN06995.1| hypothetical protein glysoja_042235 [Glycine soja]
Length=293

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF++VNDCLHRYKF AKWMFFFDVDE+I++P  NT+K+VVDSL  + QF    MPM+NK+
Sbjct  202  QFMVVNDCLHRYKFMAKWMFFFDVDEYIYVPPNNTIKTVVDSLSKYDQFIFNMMPMNNKI  261

Query  183  CLREDAGKTHR  215
            CL ED GKT R
Sbjct  262  CLYEDYGKTCR  272



>gb|AFG70562.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70563.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70564.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70565.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70566.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
Length=95

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = +3

Query  264  RRDRKYAVQPRNVAATGVHMSENAAGNTTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTR  443
            RRDRKYAVQ RNV ATGVH SEN  G T  +TEG+I YYHYH TI+ R EPC + V  + 
Sbjct  1    RRDRKYAVQARNVYATGVHFSENLMGETQRRTEGKIRYYHYHNTISNREEPCMEWVKPSM  60

Query  444  ----LAVDGISYVVDPTMRDVAGAVKRFELKTIG  533
                  ++GI Y  D +++ V   VK+FE   IG
Sbjct  61   KKNVTVLEGIPYKYDGSIKAVTSLVKQFERLAIG  94



>ref|XP_001778370.1| predicted protein [Physcomitrella patens]
 gb|EDQ56821.1| predicted protein, partial [Physcomitrella patens]
Length=356

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 80/150 (53%), Gaps = 14/150 (9%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFP-----FTQFTIEQMP  167
            QF ++NDCL R +  + W FFFDVDEF+F    +  K  VD L        TQF  + + 
Sbjct  210  QFTMLNDCLLRSQTLSNWTFFFDVDEFLF---SSGDKKPVDLLAENARNNVTQFLFKTVK  266

Query  168  MSNKLCLREDAGKTHRKWGFEKLVFKDSKTGIR--RDRKYAVQPRNVAATGVHMSENA-A  338
            MS+ LCL+E+      KW FEKLV+     G      RKYAVQP+ V ATGVH SE+   
Sbjct  267  MSDGLCLKENK---REKWAFEKLVYAKCDYGWTTVESRKYAVQPQMVWATGVHYSEHMKQ  323

Query  339  GNTTHKTEGRIMYYHYHGTIAQRREPCRQL  428
            G         +  YHYH T+  R E C++ 
Sbjct  324  GKRIDMDPDVLRSYHYHNTVNGRTELCKEF  353



>ref|XP_001785941.1| predicted protein [Physcomitrella patens]
 gb|EDQ49246.1| predicted protein [Physcomitrella patens]
Length=412

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 99/194 (51%), Gaps = 19/194 (10%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFP-------FTQFTIEQ  161
            QF+I+NDCL R K  AKW +FFDVDE+I  P  + L  V+  +           + +I+Q
Sbjct  213  QFVILNDCLFRAKSMAKWTWFFDVDEYIHRPAGSNLNEVIKRIETENFWGKRLQRVSIKQ  272

Query  162  MPMSNKLCLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVH----MSE  329
            M M    CLR     ++ +WG  K+V++ +  G   DRK  V   +  ATG H    MS 
Sbjct  273  MSMDYSHCLRGSQPNSN-EWGISKMVYRKTDVGEYPDRKNFVLSDSCLATGPHEPMAMSM  331

Query  330  NAAGNTTH---KTEGRIM-YYHYHGTIAQRR-EPCRQLVN-DTRL-AVDGISYVVDPTMR  488
                N TH   K EG ++ YYH+HG I +   E C  L++ D  + + + +++  D  ++
Sbjct  332  PPGANQTHHVTKWEGELLQYYHFHGAIGKAEGEICVDLLDPDVNVTSFNNVTHQFDDALK  391

Query  489  DVAGAVKRFELKTI  530
             +   V  FE + I
Sbjct  392  SLVDDVMAFEHRMI  405



>ref|XP_001767951.1| predicted protein [Physcomitrella patens]
 gb|EDQ67226.1| predicted protein, partial [Physcomitrella patens]
Length=349

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 8/143 (6%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            QF I+NDCL R +  A W FFFD+DE+++IP+ ++ +++++ L    +       +   L
Sbjct  210  QFTILNDCLMRSQTLASWTFFFDIDEYLYIPEAHSPRAILNLLAEQARNNRSLRVVFTFL  269

Query  183  CLREDAGKTHRKWGFEKLVFKDSKTGIR--RDRKYAVQPRNVAATGVHMSEN-AAGNTTH  353
             L E      RKW FEKLV+ D   G      RKYA+QP+ V ATGVH SE+   G+   
Sbjct  270  PLHEC-----RKWAFEKLVYADCNYGWEPVESRKYALQPQLVWATGVHYSEHLKQGHYIT  324

Query  354  KTEGRIMYYHYHGTIAQRREPCR  422
                 +  YHYH T+  R E C+
Sbjct  325  MDPTVLRSYHYHNTLNGRWETCK  347



>ref|XP_001777720.1| predicted protein [Physcomitrella patens]
 gb|EDQ57500.1| predicted protein [Physcomitrella patens]
Length=542

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 96/193 (50%), Gaps = 17/193 (9%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVD-------SLFPFT----QF  149
            Q  +VNDCL + +F A W FFFD+DE++F+   +++  +++       S+  +T      
Sbjct  345  QHTVVNDCLMKSQFLANWTFFFDMDEYLFVEPPHSITKLLEEKTQQDVSVIRYTGKRMST  404

Query  150  TIEQMPMSNKLCLREDAGKTHRKWGFEKLVFKDSKTGIRRDRKYAVQPRNVAATGVHMSE  329
            ++  +P +N      DA  + + WGFEK +         RD KYAVQ R++ A  +H + 
Sbjct  405  SMCSLPKANVDNATRDAINS-KLWGFEKFLLHWHWEHGPRDPKYAVQARHMWAVEIHNAV  463

Query  330  NA--AGNTTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTR---LAVDGISYVVDPTMRDV  494
             A    N   +    I ++H+HG I  R E CR  V  +    +AV    Y  D T+  +
Sbjct  464  LARRGQNRLLQYRDHIWFHHFHGFIINRAEGCRDFVEASENKAIAVGKSQYSGDYTIARL  523

Query  495  AGAVKRFELKTIG  533
            A  +K+FE   +G
Sbjct  524  AKDIKQFEQAMVG  536



>gb|AFG56179.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56180.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56181.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56182.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56183.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56184.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56185.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56187.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56188.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56189.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56190.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56191.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56192.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56193.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56194.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56195.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
Length=76

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  345  TTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKR  512
            T HKTEG+I YYHYH TI  R EPCRQ V  +       V GI YV D TM+ +A ++K+
Sbjct  2    TQHKTEGKIRYYHYHNTITTREEPCRQFVRQSMRNNVTWVGGIPYVYDATMKALAPSIKK  61

Query  513  FELKTIGPVLQRTRQ  557
            FE + +G  L   +Q
Sbjct  62   FESELMGSELASIQQ  76



>gb|AEW08052.1| hypothetical protein 0_17802_01, partial [Pinus radiata]
 gb|AFG56186.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
Length=76

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = +3

Query  345  TTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTR----LAVDGISYVVDPTMRDVAGAVKR  512
            T HKTEG+I YYHYH TI  R EPC Q V  +       V G  YV D TM+ +A ++K+
Sbjct  2    TQHKTEGKIRYYHYHNTITTREEPCSQFVRQSMRNNVTWVGGTPYVYDATMKALAPSIKK  61

Query  513  FELKTIGPVLQRTRQ  557
            FE + +G  L   +Q
Sbjct  62   FESELMGSELASIQQ  76



>ref|XP_006435485.1| hypothetical protein CICLE_v10003494mg [Citrus clementina]
 gb|ESR48725.1| hypothetical protein CICLE_v10003494mg [Citrus clementina]
Length=172

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 56/102 (55%), Gaps = 3/102 (3%)
 Frame = +3

Query  234  LVFKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAGNTTHKTEGRIMYYHYHGTIAQRRE  413
            L   D  T ++   + A+Q     ATGVH+SEN    T H  E +I YYHYH TI    E
Sbjct  58   LCLNDRTTHLKIIPENAIQATIAYATGVHVSENVISKTLH--EIKIHYYHYHNTITVHEE  115

Query  414  PCRQLVNDTRLAVDGISYVVDPTMRDVAGAVKRFELKTIGPV  539
             C +LV  +  A +   YV++  M+ +A  +K+FE KTIG +
Sbjct  116  VCGELVPPSPSA-NQYPYVLEHIMKKLANTIKQFEHKTIGSI  156



>ref|XP_002965483.1| hypothetical protein SELMODRAFT_406883 [Selaginella moellendorffii]
 gb|EFJ32903.1| hypothetical protein SELMODRAFT_406883 [Selaginella moellendorffii]
Length=534

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 71/169 (42%), Gaps = 23/169 (14%)
 Frame = +3

Query  9    LIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCL  188
            L++NDCL R +F A W FF+D+DE++ +    ++ +++ S       ++  +  S   C 
Sbjct  350  LVINDCLQRSRFLATWAFFWDLDEYLQLVNSTSMAALLRSYESSPWISLANLVWSRTYCK  409

Query  189  REDAGKTHRKWGFEKLVFK------------DSKTGIRRDRKYAVQPRNVAATGVH--MS  326
               A     +W  E++ F+            ++  G+   RK+   PR V    +H  + 
Sbjct  410  ETSA---EDEWAVERMRFRLRYPTCGDEQRAETCHGVEGHRKWIANPRKVLVASIHRTVE  466

Query  327  ENAAGNTTHKTEGRIMYYHYHGTIAQRREPCRQL-----VNDTRLAVDG  458
                G     +  R+ ++H           C  +     VN++ L VDG
Sbjct  467  PEWNGEILRASIARLNHFHGLAVEGSANSSCWIVKKLDQVNESSL-VDG  514



>ref|XP_002982958.1| hypothetical protein SELMODRAFT_422280 [Selaginella moellendorffii]
 gb|EFJ15767.1| hypothetical protein SELMODRAFT_422280 [Selaginella moellendorffii]
Length=536

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 60/144 (42%), Gaps = 15/144 (10%)
 Frame = +3

Query  9    LIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKLCL  188
            L++NDCL R +F A W FF+D+DE++ +    ++ +++ S       ++  +  S   C 
Sbjct  350  LVINDCLQRSRFLATWAFFWDLDEYLQLVNSTSMAALLRSYESSPWISLANLVWSRTYCK  409

Query  189  REDAGKTHRKWGFEKLVFK------------DSKTGIRRDRKYAVQPRNVAATGVHMSEN  332
               A     +W  E++ F+            ++  G+   RK+   PR V    +H +  
Sbjct  410  ETSA---EDEWAVERMRFRLRYPTCGDEQRAETCHGVEGHRKWIANPRKVLVASIHRTVE  466

Query  333  AAGNTTHKTEGRIMYYHYHGTIAQ  404
               N             +HG  A+
Sbjct  467  PEWNGEILRASIARLNQFHGLAAE  490



>ref|XP_001784337.1| predicted protein [Physcomitrella patens]
 gb|EDQ50855.1| predicted protein [Physcomitrella patens]
Length=683

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 63/143 (44%), Gaps = 28/143 (20%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            Q L++NDCLHR +F A+ +FFFD DEF+ +P  ++LK  +         +   +  + K 
Sbjct  476  QVLLINDCLHRSRFMAERVFFFDYDEFLQVPAPDSLKMFMRRHAKEPWISFGSIYANTKD  535

Query  183  CLREDAGKTHRKWGFEKLVFKDSKT--------------------GIRRDRKYAVQPRNV  302
            C     G++     FE++V++  +                     G    RKY   PR  
Sbjct  536  CRLPKPGESETL--FERMVWRRPRPECRIQQAKYEGPPVDALHCIGPLGRRKYVANPRKT  593

Query  303  AATGVH---MSENA---AGNTTH  353
             A GVH   + +N    +GN  H
Sbjct  594  FAAGVHWVTIPKNGLDLSGNGAH  616



>ref|XP_001629191.1| predicted protein [Nematostella vectensis]
 gb|EDO37128.1| predicted protein [Nematostella vectensis]
Length=476

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 20/163 (12%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSLFPFTQFTIEQMPMSNKL  182
            Q L + DCL+RYK +AK++ F DVDEFI +P +N+  S+V+ L  F +      P     
Sbjct  303  QVLAILDCLYRYKNRAKFVAFNDVDEFI-VPLRNS--SIVEILNAFHR------PYHCGH  353

Query  183  CLREDAGKTHRKWGFEK--LV----FKDSKTGIRRDRKYAVQPRNVAATGVHMSENAAG-  341
            C +     ++ ++  +K  LV    F  ++  I    K  V P  V   G+H    A G 
Sbjct  354  CFQSVVFSSNARFPRQKSELVSQRFFHRTQETIPLLSKCIVDPLRVFEMGIHHISKATGL  413

Query  342  ----NTTHKTEGRIMYYHYHGTIAQRREPCRQLVNDTRLAVDG  458
                N+ H+++  I +Y    T    R  C  LV+D  +A  G
Sbjct  414  RYSVNSVHESDAVIFHYRTCTTSFGIRHQCMNLVHDGTMAKYG  456



>gb|AAI63096.1| Hypothetical protein LOC100005569 [Danio rerio]
 gb|AAI63100.1| Hypothetical protein LOC100005569 [Danio rerio]
Length=428

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (43%), Gaps = 38/141 (27%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSL----------------F  134
            Q + +N+C++R+ +Q++++   D+DE I   K + L+S+++ L                F
Sbjct  247  QLVTLNECIYRHMYQSRYVLLNDIDEIIMPYKYSNLQSLMEDLQSADPSKGVFLIENHIF  306

Query  135  PFTQFTIEQMPMSNKLCLREDAGKTHRK-WG-------FEKLVFKDSKTGIRRDRKYAVQ  290
            P TQF              ED+GK  RK W         E +  +  +  +    K  V 
Sbjct  307  PKTQF--------------EDSGKFKRKEWKNISGINIMEHIYREPERKNVYNPTKMIVN  352

Query  291  PRNVAATGVHMSENAAGNTTH  353
            PR V  T VH S    G + H
Sbjct  353  PRKVEQTSVHSSLKNFGGSYH  373



>ref|NP_001116796.1| uncharacterized protein LOC100005569 [Danio rerio]
 ref|XP_005167202.1| PREDICTED: uncharacterized protein LOC100005569 isoform X1 [Danio 
rerio]
Length=443

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (43%), Gaps = 38/141 (27%)
 Frame = +3

Query  3    QFLIVNDCLHRYKFQAKWMFFFDVDEFIFIPKKNTLKSVVDSL----------------F  134
            Q + +N+C++R+ +Q++++   D+DE I   K + L+S+++ L                F
Sbjct  262  QLVTLNECIYRHMYQSRYVLLNDIDEIIMPYKYSNLQSLMEDLQSADPSKGVFLIENHIF  321

Query  135  PFTQFTIEQMPMSNKLCLREDAGKTHRK-WG-------FEKLVFKDSKTGIRRDRKYAVQ  290
            P TQF              ED+GK  RK W         E +  +  +  +    K  V 
Sbjct  322  PKTQF--------------EDSGKFKRKEWKNISGINIMEHIYREPERKNVYNPTKMIVN  367

Query  291  PRNVAATGVHMSENAAGNTTH  353
            PR V  T VH S    G + H
Sbjct  368  PRKVEQTSVHSSLKNFGGSYH  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520