BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN014D08

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004511894.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       284   3e-94   Cicer arietinum [garbanzo]
ref|XP_007156772.1|  hypothetical protein PHAVU_002G016300g             282   2e-93   Phaseolus vulgaris [French bean]
ref|XP_007155902.1|  hypothetical protein PHAVU_003G241600g             282   3e-93   Phaseolus vulgaris [French bean]
ref|XP_003517314.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    281   4e-93   Glycine max [soybeans]
ref|XP_006590254.1|  PREDICTED: uncharacterized protein LOC100305...    281   5e-93   Glycine max [soybeans]
ref|NP_001234980.1|  uncharacterized protein LOC100305922               280   8e-93   Glycine max [soybeans]
ref|XP_010093513.1|  SUMO-conjugating enzyme SCE1                       280   1e-92   Morus notabilis
dbj|BAJ53199.1|  JHL03K20.8                                             280   1e-92   Jatropha curcas
ref|NP_001235590.1|  uncharacterized protein LOC100500268               280   2e-92   Glycine max [soybeans]
ref|XP_004288010.1|  PREDICTED: SUMO-conjugating enzyme SCE1            280   2e-92   Fragaria vesca subsp. vesca
gb|KJB39148.1|  hypothetical protein B456_007G216300                    279   4e-92   Gossypium raimondii
emb|CDP02519.1|  unnamed protein product                                278   6e-92   Coffea canephora [robusta coffee]
gb|AFK39856.1|  unknown                                                 278   6e-92   Lotus japonicus
ref|XP_004509116.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       278   1e-91   Cicer arietinum [garbanzo]
ref|XP_006425960.1|  hypothetical protein CICLE_v10026671mg             276   3e-91   Citrus clementina [clementine]
ref|XP_007047350.1|  Sumo conjugation enzyme 1                          276   3e-91   
ref|XP_009389843.1|  PREDICTED: SUMO-conjugating enzyme SCE1            276   4e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783454.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       275   8e-91   Phoenix dactylifera
ref|XP_002283130.1|  PREDICTED: SUMO-conjugating enzyme SCE1            275   1e-90   Vitis vinifera
emb|CAE45567.1|  SUMO E2 conjugating enzyme SCE1                        275   1e-90   Nicotiana benthamiana
ref|XP_010070565.1|  PREDICTED: SUMO-conjugating enzyme SCE1            275   1e-90   Eucalyptus grandis [rose gum]
ref|XP_009367435.1|  PREDICTED: SUMO-conjugating enzyme SCE1            275   2e-90   Pyrus x bretschneideri [bai li]
ref|XP_009385926.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       275   2e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004151860.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       275   2e-90   Cucumis sativus [cucumbers]
ref|XP_008338336.1|  PREDICTED: SUMO-conjugating enzyme SCE1            274   3e-90   Malus domestica [apple tree]
ref|XP_011097247.1|  PREDICTED: SUMO-conjugating enzyme SCE1            274   3e-90   Sesamum indicum [beniseed]
ref|XP_004234662.1|  PREDICTED: SUMO-conjugating enzyme SCE1 isof...    274   3e-90   Solanum lycopersicum
gb|KHG02093.1|  SUMO-conjugating enzyme SCE1 -like protein              274   4e-90   Gossypium arboreum [tree cotton]
ref|XP_007206053.1|  hypothetical protein PRUPE_ppa012626mg             274   4e-90   Prunus persica
ref|XP_008809080.1|  PREDICTED: SUMO-conjugating enzyme SCE1            273   4e-90   Phoenix dactylifera
ref|XP_009783412.1|  PREDICTED: SUMO-conjugating enzyme SCE1            273   6e-90   Nicotiana sylvestris
ref|XP_008244101.1|  PREDICTED: SUMO-conjugating enzyme SCE1            273   6e-90   
gb|ACJ83979.1|  unknown                                                 273   7e-90   Medicago truncatula
ref|XP_011099107.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       273   9e-90   Sesamum indicum [beniseed]
ref|NP_001274896.1|  SUMO-conjugating enzyme SCE1-like                  273   1e-89   Solanum tuberosum [potatoes]
ref|XP_002307279.1|  ubiquitin-conjugating enzyme family protein        272   1e-89   Populus trichocarpa [western balsam poplar]
ref|XP_002468614.1|  hypothetical protein SORBIDRAFT_01g049010          272   2e-89   Sorghum bicolor [broomcorn]
ref|XP_009615424.1|  PREDICTED: SUMO-conjugating enzyme SCE1            272   2e-89   Nicotiana tomentosiformis
ref|XP_009781499.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       272   2e-89   Nicotiana sylvestris
emb|CAN61018.1|  hypothetical protein VITISV_001138                     271   2e-89   Vitis vinifera
ref|XP_003611678.1|  SUMO-conjugating enzyme UBC9                       271   3e-89   Medicago truncatula
ref|XP_010934002.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       271   5e-89   Elaeis guineensis
ref|NP_001048802.1|  Os03g0123100                                       271   5e-89   
ref|XP_010270683.1|  PREDICTED: SUMO-conjugating enzyme SCE1            271   5e-89   Nelumbo nucifera [Indian lotus]
ref|XP_003558940.1|  PREDICTED: SUMO-conjugating enzyme SCE1            271   5e-89   Brachypodium distachyon [annual false brome]
ref|XP_009139007.1|  PREDICTED: SUMO-conjugating enzyme SCE1            271   6e-89   Brassica rapa
ref|XP_006649299.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       270   8e-89   Oryza brachyantha
ref|XP_002284949.1|  PREDICTED: SUMO-conjugating enzyme SCE1            270   1e-88   Vitis vinifera
ref|XP_010927156.1|  PREDICTED: SUMO-conjugating enzyme SCE1            270   1e-88   Elaeis guineensis
ref|NP_001149113.1|  ubiquitin-conjugating enzyme E2 I                  270   2e-88   
emb|CDP01300.1|  unnamed protein product                                269   2e-88   Coffea canephora [robusta coffee]
ref|XP_004231867.1|  PREDICTED: SUMO-conjugating enzyme SCE1            269   2e-88   
gb|AFK40127.1|  unknown                                                 269   2e-88   Lotus japonicus
ref|XP_008807218.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       268   2e-88   
gb|ADP37981.1|  ubiquitin-protein ligase                                269   2e-88   Brassica napus [oilseed rape]
emb|CDY47661.1|  BnaC04g23980D                                          269   2e-88   Brassica napus [oilseed rape]
ref|XP_010548072.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       269   3e-88   Tarenaya hassleriana [spider flower]
ref|XP_008650364.1|  PREDICTED: SUMO-conjugating enzyme SCE1            269   4e-88   Zea mays [maize]
ref|XP_010263454.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       268   4e-88   Nelumbo nucifera [Indian lotus]
emb|CDY70581.1|  BnaAnng34240D                                          268   5e-88   Brassica napus [oilseed rape]
gb|ABG79538.1|  putative E2 SUMO conjugating enzyme                     268   5e-88   Triticum turgidum subsp. durum
ref|XP_010919083.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       268   5e-88   Elaeis guineensis
ref|XP_010524335.1|  PREDICTED: SUMO-conjugating enzyme SCE1            268   6e-88   Tarenaya hassleriana [spider flower]
ref|XP_009599931.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       268   6e-88   Nicotiana tomentosiformis
ref|XP_009390474.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    268   7e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009606595.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       268   8e-88   Nicotiana tomentosiformis
ref|XP_006402833.1|  hypothetical protein EUTSA_v10006282mg             268   1e-87   Eutrema salsugineum [saltwater cress]
ref|XP_009104077.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       268   1e-87   Brassica rapa
gb|KFK35081.1|  hypothetical protein AALP_AA5G232800                    267   1e-87   Arabis alpina [alpine rockcress]
gb|EMS60436.1|  SUMO-conjugating enzyme SCE1                            267   1e-87   Triticum urartu
gb|ACG45477.1|  ubiquitin-conjugating enzyme E2 I                       267   2e-87   Zea mays [maize]
ref|XP_004983815.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       266   4e-87   Setaria italica
ref|XP_006855190.1|  hypothetical protein AMTR_s00051p00153990          266   6e-87   Amborella trichopoda
ref|NP_001065167.1|  Os10g0536000                                       266   6e-87   
ref|XP_009793052.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       265   7e-87   Nicotiana sylvestris
ref|XP_006291969.1|  hypothetical protein CARUB_v10018157mg             265   8e-87   Capsella rubella
ref|XP_009116485.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       265   8e-87   Brassica rapa
ref|XP_002465018.1|  hypothetical protein SORBIDRAFT_01g030580          265   1e-86   Sorghum bicolor [broomcorn]
dbj|BAJ86881.1|  predicted protein                                      265   2e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008657947.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       264   2e-86   Zea mays [maize]
emb|CDX71988.1|  BnaC08g28860D                                          264   3e-86   
ref|XP_003574257.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       263   4e-86   Brachypodium distachyon [annual false brome]
ref|XP_009771488.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       263   4e-86   Nicotiana sylvestris
ref|XP_008660103.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       263   5e-86   Zea mays [maize]
gb|ABK23443.1|  unknown                                                 263   5e-86   Picea sitchensis
ref|XP_010504726.1|  PREDICTED: SUMO-conjugating enzyme SCE1            263   6e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010516423.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       263   6e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006662001.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       262   2e-85   Oryza brachyantha
gb|EPS61715.1|  ubiquitin carrier protein                               261   3e-85   Genlisea aurea
ref|NP_191346.1|  SUMO-conjugating enzyme SCE1                          261   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427677.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       261   4e-85   Camelina sativa [gold-of-pleasure]
ref|XP_009417521.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       261   4e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223632.1|  hypothetical protein PRUPE_ppa012638mg             261   6e-85   Prunus persica
gb|EMS55983.1|  SUMO-conjugating enzyme SCE1                            259   7e-85   Triticum urartu
ref|XP_006354854.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       259   2e-84   Solanum tuberosum [potatoes]
ref|XP_004291083.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       259   2e-84   Fragaria vesca subsp. vesca
ref|XP_008220257.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       259   3e-84   Prunus mume [ume]
ref|XP_009620476.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       257   1e-83   Nicotiana tomentosiformis
ref|XP_004252754.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       256   2e-83   Solanum lycopersicum
ref|XP_006402394.1|  hypothetical protein EUTSA_v10006281mg             256   2e-83   Eutrema salsugineum [saltwater cress]
ref|XP_008378017.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       256   3e-83   
gb|KDO84093.1|  hypothetical protein CISIN_1g031420mg                   256   5e-83   Citrus sinensis [apfelsine]
ref|XP_010679521.1|  PREDICTED: SUMO-conjugating enzyme SCE1            256   5e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006473285.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    255   6e-83   Citrus sinensis [apfelsine]
ref|XP_001768256.1|  predicted protein                                  255   8e-83   
ref|XP_004238134.1|  PREDICTED: SUMO-conjugating enzyme SCE1            255   8e-83   Solanum lycopersicum
ref|XP_006434720.1|  hypothetical protein CICLE_v10002741mg             255   9e-83   Citrus clementina [clementine]
ref|XP_010523001.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       254   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_001776874.1|  predicted protein                                  254   1e-82   
ref|XP_011069737.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       254   1e-82   Sesamum indicum [beniseed]
ref|XP_009390473.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    255   2e-82   
ref|XP_006342638.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       253   5e-82   Solanum tuberosum [potatoes]
gb|AEI83503.1|  ubiquitin-conjugating enzyme E2 I                       252   1e-81   Wolffia arrhiza
emb|CDX93982.1|  BnaC04g21410D                                          252   1e-81   
ref|XP_008393782.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       252   2e-81   
ref|XP_009138734.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       251   3e-81   Brassica rapa
ref|XP_011029476.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       251   5e-81   Populus euphratica
gb|ABK23228.1|  unknown                                                 250   6e-81   Picea sitchensis
gb|AAB63513.1|  ubiquitin-conjugating enzyme                            249   7e-81   Prunus armeniaca
ref|XP_002980875.1|  SUMO-conjugating enzyme 1a                         249   2e-80   Selaginella moellendorffii
ref|XP_006374899.1|  hypothetical protein POPTR_0014s02500g             249   3e-80   Populus trichocarpa [western balsam poplar]
ref|XP_002301168.1|  hypothetical protein POPTR_0002s12510g             248   3e-80   Populus trichocarpa [western balsam poplar]
gb|ACA04892.1|  putative ubiquitin-conjugating enzyme E2 I protein      247   8e-80   Picea abies
gb|AFK49150.1|  unknown                                                 246   1e-79   Lotus japonicus
ref|XP_011017169.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       247   2e-79   Populus euphratica
ref|XP_006374896.1|  hypothetical protein POPTR_0014s02480g             246   2e-79   Populus trichocarpa [western balsam poplar]
ref|XP_010094645.1|  Serine palmitoyltransferase 1                      259   5e-79   
ref|XP_011029489.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       245   5e-79   Populus euphratica
gb|ABG66220.1|  Ubiquitin-conjugating enzyme E2 I, putative, expr...    244   5e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008344316.1|  PREDICTED: SUMO-conjugating enzyme SCE1            243   3e-78   
gb|EYU25458.1|  hypothetical protein MIMGU_mgv11b023148mg               243   3e-78   Erythranthe guttata [common monkey flower]
gb|KCW59391.1|  hypothetical protein EUGRSUZ_H02096                     245   4e-78   Eucalyptus grandis [rose gum]
ref|XP_002534386.1|  ubiquitin-conjugating enzyme E2 I, putative        244   4e-78   
ref|XP_007017167.1|  Sumo conjugation enzyme 1 isoform 1                242   8e-78   
ref|XP_006425959.1|  hypothetical protein CICLE_v10026671mg             241   9e-78   
ref|XP_010317791.1|  PREDICTED: SUMO-conjugating enzyme SCE1 isof...    241   3e-77   Solanum lycopersicum
ref|XP_004156788.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       242   5e-76   
ref|XP_010059899.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    238   5e-76   Eucalyptus grandis [rose gum]
gb|KCW66370.1|  hypothetical protein EUGRSUZ_F00190                     238   2e-75   Eucalyptus grandis [rose gum]
ref|XP_006291970.1|  hypothetical protein CARUB_v10018157mg             235   6e-75   
ref|XP_010059898.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    231   2e-73   Eucalyptus grandis [rose gum]
gb|KDO84100.1|  hypothetical protein CISIN_1g031420mg                   229   6e-73   Citrus sinensis [apfelsine]
ref|XP_006434722.1|  hypothetical protein CICLE_v10002741mg             228   1e-72   
gb|KHG16593.1|  SUMO-conjugating enzyme SCE1 -like protein              226   3e-71   Gossypium arboreum [tree cotton]
gb|KJB21461.1|  hypothetical protein B456_004G179100                    226   3e-71   Gossypium raimondii
ref|XP_010318996.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    223   5e-70   
gb|KHG25846.1|  SUMO-conjugating enzyme SCE1 -like protein              221   2e-69   Gossypium arboreum [tree cotton]
gb|KDO84097.1|  hypothetical protein CISIN_1g031420mg                   220   4e-69   Citrus sinensis [apfelsine]
ref|XP_002506123.1|  predicted protein                                  220   4e-69   Micromonas commoda
gb|KJB53560.1|  hypothetical protein B456_009G214500                    220   5e-69   Gossypium raimondii
ref|XP_009622849.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       219   7e-69   Nicotiana tomentosiformis
ref|XP_011006861.1|  PREDICTED: SUMO-conjugating enzyme SCE1 isof...    216   4e-68   Populus euphratica
gb|KJB39142.1|  hypothetical protein B456_007G216300                    215   7e-68   Gossypium raimondii
gb|EYU44426.1|  hypothetical protein MIMGU_mgv1a0153482mg               215   7e-68   Erythranthe guttata [common monkey flower]
ref|XP_007017168.1|  Sumo conjugation enzyme 1 isoform 2                216   1e-67   
ref|XP_002448378.1|  hypothetical protein SORBIDRAFT_06g026280          215   3e-67   Sorghum bicolor [broomcorn]
gb|EYU25459.1|  hypothetical protein MIMGU_mgv1a015370mg                215   4e-67   Erythranthe guttata [common monkey flower]
ref|XP_001694849.1|  E2 ubiquitin-conjugating-like enzyme               214   9e-67   Chlamydomonas reinhardtii
ref|XP_003056766.1|  predicted protein                                  213   3e-66   Micromonas pusilla CCMP1545
ref|XP_002954400.1|  hypothetical protein VOLCADRAFT_102189             213   3e-66   Volvox carteri f. nagariensis
ref|XP_006344423.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       212   5e-66   Solanum tuberosum [potatoes]
ref|XP_005649108.1|  E2 ubiquitin-conjugating-like enzyme               212   6e-66   Coccomyxa subellipsoidea C-169
ref|XP_006368023.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       211   6e-66   Solanum tuberosum [potatoes]
gb|EWM21470.1|  ubiquitin-conjugating enzyme e2 i                       211   2e-65   Nannochloropsis gaditana
gb|EMT31701.1|  Sumo-conjugating enzyme ubc9                            211   2e-65   
ref|XP_008668997.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       210   4e-65   Zea mays [maize]
ref|XP_006473287.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    208   7e-65   
gb|KDO84096.1|  hypothetical protein CISIN_1g031420mg                   208   7e-65   Citrus sinensis [apfelsine]
ref|XP_010059901.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    209   8e-65   Eucalyptus grandis [rose gum]
ref|XP_004242945.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       209   8e-65   Solanum lycopersicum
ref|XP_006434721.1|  hypothetical protein CICLE_v10002741mg             207   1e-64   
ref|XP_004976583.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       208   2e-64   Setaria italica
ref|XP_002448377.1|  hypothetical protein SORBIDRAFT_06g026270          206   1e-63   Sorghum bicolor [broomcorn]
gb|KJB53563.1|  hypothetical protein B456_009G214500                    205   3e-63   Gossypium raimondii
ref|XP_011398219.1|  SUMO-conjugating enzyme SCE1                       205   4e-63   Auxenochlorella protothecoides
ref|XP_002448376.1|  hypothetical protein SORBIDRAFT_06g026250          204   5e-63   Sorghum bicolor [broomcorn]
emb|CAD41164.2|  OSJNBa0064M23.9                                        204   6e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003293385.1|  hypothetical protein DICPUDRAFT_58449              204   6e-63   Dictyostelium purpureum
gb|EFA82218.1|  putative E2 enzyme Ubc9                                 203   1e-62   Heterostelium album PN500
ref|XP_006652687.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       202   3e-62   Oryza brachyantha
gb|KJB53564.1|  hypothetical protein B456_009G214500                    202   5e-62   Gossypium raimondii
ref|XP_002502397.1|  predicted protein                                  201   1e-61   Micromonas commoda
ref|NP_001159056.1|  ubiquitin-conjugating enzyme E2 I                  200   2e-61   Zea mays [maize]
gb|ABR25815.1|  ubiquitin-conjugating enzyme                            198   4e-61   Oryza sativa Indica Group [Indian rice]
gb|ACG43810.1|  ubiquitin-conjugating enzyme E2 I                       199   4e-61   Zea mays [maize]
ref|XP_003580378.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    199   4e-61   Brachypodium distachyon [annual false brome]
ref|XP_009040187.1|  hypothetical protein AURANDRAFT_31459              199   5e-61   Aureococcus anophagefferens
ref|NP_001147178.1|  LOC100280784                                       199   7e-61   Zea mays [maize]
ref|XP_002500401.1|  predicted protein                                  199   9e-61   Micromonas commoda
ref|XP_637050.1|  hypothetical protein DDB_G0287693                     198   1e-60   Dictyostelium discoideum AX4
ref|XP_009858945.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          198   2e-60   
ref|XP_007908470.1|  PREDICTED: SUMO-conjugating enzyme UBC9            198   2e-60   Callorhinchus milii [Australian ghost shark]
gb|KJB21462.1|  hypothetical protein B456_004G179100                    196   2e-60   Gossypium raimondii
ref|XP_004976582.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       197   2e-60   
ref|XP_010318995.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    198   3e-60   Solanum lycopersicum
ref|XP_010059902.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    197   3e-60   Eucalyptus grandis [rose gum]
dbj|GAM24255.1|  hypothetical protein SAMD00019534_074300               197   4e-60   Acytostelium subglobosum LB1
ref|XP_005851683.1|  hypothetical protein CHLNCDRAFT_59526              197   5e-60   Chlorella variabilis
ref|XP_007576679.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    197   7e-60   Poecilia formosa
ref|NP_001232317.1|  putative ubiquitin-conjugating enzyme E2I cl...    196   7e-60   Taeniopygia guttata
gb|ACI67992.1|  SUMO-conjugating enzyme UBC9-B                          196   7e-60   Salmo salar
gb|KJB21522.1|  hypothetical protein B456_004G179000                    195   9e-60   Gossypium raimondii
ref|XP_005803294.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       196   1e-59   Xiphophorus maculatus
ref|XP_006006938.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-li...    196   1e-59   Latimeria chalumnae
ref|XP_007063734.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    196   1e-59   
ref|XP_004348529.1|  ubiquitinconjugating enzyme, putative              195   2e-59   Acanthamoeba castellanii str. Neff
ref|XP_006123351.1|  PREDICTED: SUMO-conjugating enzyme UBC9            196   2e-59   
ref|XP_005697407.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    196   2e-59   
ref|XP_005697408.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    196   2e-59   
dbj|BAD92225.1|  ubiquitin-conjugating enzyme E2I variant               196   2e-59   Homo sapiens [man]
gb|AAP36303.1|  Homo sapiens ubiquitin-conjugating enzyme E2I (UB...    195   2e-59   synthetic construct
ref|XP_005866608.1|  PREDICTED: SUMO-conjugating enzyme UBC9            196   2e-59   
ref|XP_005621791.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B is...    196   2e-59   
ref|XP_006245980.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    196   2e-59   
pdb|1KPS|A  Chain A, Structural Basis For E2-Mediated Sumo Conjug...    195   2e-59   Mus musculus [mouse]
ref|XP_003059128.1|  predicted protein                                  196   2e-59   Micromonas pusilla CCMP1545
ref|XP_010390839.1|  PREDICTED: SUMO-conjugating enzyme UBC9            196   2e-59   
ref|XP_006037209.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    196   2e-59   
gb|KFQ56066.1|  SUMO-conjugating enzyme UBC9                            195   2e-59   Nestor notabilis
gb|KFP20677.1|  SUMO-conjugating enzyme UBC9                            195   2e-59   Egretta garzetta
ref|XP_007439187.1|  PREDICTED: SUMO-conjugating enzyme UBC9            196   2e-59   
pdb|1U9A|A  Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9            195   3e-59   Mus musculus [mouse]
ref|XP_004537820.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    195   3e-59   Ceratitis capitata [medfly]
ref|XP_010873204.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     195   3e-59   Esox lucius
ref|XP_010282674.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   3e-59   Phaethon lepturus
ref|NP_003336.1|  SUMO-conjugating enzyme UBC9                          195   3e-59   Homo sapiens [man]
pdb|2O25|C  Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Compl...    195   3e-59   Homo sapiens [man]
ref|XP_005448278.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    195   3e-59   
ref|XP_010568841.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    196   3e-59   Haliaeetus leucocephalus
gb|KFM12519.1|  SUMO-conjugating enzyme UBC9                            195   3e-59   Aptenodytes forsteri
gb|EMC86701.1|  SUMO-conjugating enzyme UBC9                            195   3e-59   
ref|NP_571908.1|  SUMO-conjugating enzyme UBC9-B                        195   3e-59   Danio rerio [leopard danio]
ref|NP_001187932.1|  sumo-conjugating enzyme ubc9                       195   3e-59   Ictalurus punctatus
ref|NP_571426.1|  SUMO-conjugating enzyme UBC9-A                        195   3e-59   Danio rerio [leopard danio]
gb|ACO52076.1|  SUMO-conjugating enzyme UBC9                            195   3e-59   Rana catesbeiana [bullfrog]
ref|XP_008579450.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   3e-59   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004056983.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   3e-59   
pdb|2GRN|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9            195   3e-59   Homo sapiens [man]
ref|XP_011500210.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          194   4e-59   Ceratosolen solmsi marchali
ref|XP_004562508.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    195   4e-59   
gb|ACO08933.1|  SUMO-1-conjugating enzyme UBC9                          194   4e-59   Osmerus mordax
gb|KGL86044.1|  SUMO-conjugating enzyme UBC9                            195   4e-59   Charadrius vociferus
pdb|3A4S|A  Chain A, The Crystal Structure Of The Sld2:ubc9 Complex     195   4e-59   Homo sapiens [man]
ref|XP_006037208.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   4e-59   
ref|XP_002288880.1|  ubiquitin conjugating enzyme                       194   4e-59   Thalassiosira pseudonana CCMP1335
ref|XP_005391641.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   5e-59   
ref|XP_009665371.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   5e-59   Struthio camelus australis
ref|XP_005181569.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          194   5e-59   Musca domestica
ref|XP_007100184.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   6e-59   
gb|ACO07807.1|  SUMO-1-conjugating enzyme UBC9                          194   6e-59   Oncorhynchus mykiss
gb|KFO34746.1|  SUMO-conjugating enzyme UBC9                            196   6e-59   Fukomys damarensis [Damara mole rat]
ref|XP_007979401.1|  PREDICTED: SUMO-conjugating enzyme UBC9            196   7e-59   Chlorocebus sabaeus
ref|XP_967918.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B             194   7e-59   Tribolium castaneum [rust-red flour beetle]
gb|EDL22414.1|  mCG17660, isoform CRA_c                                 194   7e-59   Mus musculus [mouse]
ref|XP_007453652.1|  PREDICTED: SUMO-conjugating enzyme UBC9            194   7e-59   Lipotes vexillifer [baiji]
gb|AAH51289.3|  Ubiquitin-conjugating enzyme E2I (UBC9 homolog, y...    195   8e-59   Homo sapiens [man]
dbj|BAF83807.1|  unnamed protein product                                194   8e-59   Homo sapiens [man]
ref|XP_003417832.2|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   8e-59   Loxodonta africana [African bush elephant]
gb|EMS25881.1|  ubiquitin-conjugating enzyme E2 I                       194   9e-59   Rhodotorula toruloides NP11
ref|NP_001281115.1|  SUMO-conjugating enzyme UBC9-like                  194   1e-58   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ACI68998.1|  SUMO-conjugating enzyme UBC9-B                          194   1e-58   Salmo salar
gb|KJB70051.1|  hypothetical protein B456_011G056100                    192   1e-58   Gossypium raimondii
ref|XP_005821430.1|  hypothetical protein GUITHDRAFT_155732             194   1e-58   Guillardia theta CCMP2712
ref|XP_006914048.1|  PREDICTED: SUMO-conjugating enzyme UBC9            195   1e-58   
ref|XP_001356428.1|  GA15704                                            193   1e-58   Drosophila pseudoobscura pseudoobscura
ref|XP_007863301.1|  ubiquitin-conjugating enzyme9                      193   1e-58   Gloeophyllum trabeum ATCC 11539
ref|XP_009665363.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    195   1e-58   Struthio camelus australis
ref|XP_010901444.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       193   1e-58   Esox lucius
ref|XP_006009207.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    193   2e-58   Latimeria chalumnae
emb|CDQ58708.1|  unnamed protein product                                194   2e-58   Oncorhynchus mykiss
gb|EJK69498.1|  hypothetical protein THAOC_09238                        193   2e-58   Thalassiosira oceanica
gb|ACI66562.1|  SUMO-conjugating enzyme UBC9-B                          193   2e-58   Salmo salar
ref|XP_007100183.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    196   2e-58   
ref|XP_007565742.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       192   2e-58   Poecilia formosa
ref|XP_001606115.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B is...    192   2e-58   Nasonia vitripennis
ref|XP_011300412.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          192   2e-58   Fopius arisanus
ref|XP_010240304.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    193   2e-58   Brachypodium distachyon [annual false brome]
gb|EHJ63743.1|  ubiquitin-conjugating enzyme E2                         192   2e-58   
ref|XP_003961356.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       192   2e-58   Takifugu rubripes [tiger puffer]
pdb|2GRR|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s      192   2e-58   
ref|XP_003964465.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       192   2e-58   
gb|EDL35680.1|  mCG17818                                                192   2e-58   
gb|ABP57628.1|  ubiquitin-conjugating enzyme E2I                        192   3e-58   
gb|ACI33971.1|  SUMO-conjugating enzyme UBC9                            193   3e-58   
pdb|2GRO|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q       192   3e-58   
ref|XP_001968181.1|  GG24645                                            192   3e-58   
gb|ELR62878.1|  SUMO-conjugating enzyme UBC9                            192   3e-58   
ref|NP_476978.1|  lesswright, isoform A                                 192   3e-58   
dbj|BAM19143.1|  lesswright                                             192   3e-58   
ref|XP_004873904.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    193   3e-58   
ref|XP_005806114.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       192   3e-58   
ref|XP_007322005.1|  ubiquitin-conjugating enzyme, E2                   192   3e-58   
gb|KIM65356.1|  hypothetical protein SCLCIDRAFT_113026                  192   4e-58   
ref|XP_008765771.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    194   4e-58   
gb|KDQ60926.1|  hypothetical protein JAAARDRAFT_151815                  192   4e-58   
ref|XP_007239085.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       192   4e-58   
pdb|2GRQ|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a      192   4e-58   
ref|XP_005886931.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          192   4e-58   
emb|CEG64484.1|  Putative SUMO-conjugating enzyme ubc9                  192   4e-58   
gb|KIY43502.1|  ubiquitin-conjugating enzyme 9                          192   4e-58   
gb|AFH89682.1|  ubiquitin-conjugating enzyme                            192   4e-58   
pdb|2GRP|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a       192   5e-58   
pdb|2UYZ|A  Chain A, Non-Covalent Complex Between Ubc9 And Sumo1        192   5e-58   
ref|XP_008579441.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    193   5e-58   
ref|XP_001988559.1|  GH10511                                            192   5e-58   
gb|KFB45737.1|  ubiquitin-conjugating enzyme E2 i                       192   6e-58   
ref|XP_007874139.1|  hypothetical protein PNEG_02158                    191   6e-58   
ref|XP_004902352.1|  PREDICTED: SUMO-conjugating enzyme UBC9            193   6e-58   
gb|EPY50814.1|  SUMO conjugating enzyme Hus5                            191   6e-58   
ref|XP_005106871.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-li...    191   6e-58   
ref|XP_002426763.1|  SUMO-1-conjugating enzyme UBC9, putative           191   7e-58   
pdb|3UIO|A  Chain A, Complex Between Human Rangap1-sumo2, Ubc9 An...    191   7e-58   
ref|XP_011347203.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          191   8e-58   
ref|XP_008216323.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    191   8e-58   
emb|CAG04374.1|  unnamed protein product                                191   9e-58   
emb|CBQ68965.1|  probable ubiquitin--protein ligase hus5                191   1e-57   
pdb|4L83|A  Chain A, Structure Of A Putative Ubiquitin-conjugatin...    191   1e-57   
ref|XP_001899558.1|  ube2i2 protein                                     191   1e-57   
ref|XP_008558444.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          191   1e-57   
ref|XP_309574.1|  AGAP011076-PA                                         191   2e-57   
gb|ABR23407.1|  putative ubiquitin-conjugating enzyme                   191   2e-57   
gb|EDL06246.1|  mCG21975                                                191   2e-57   
emb|CAX77005.1|  lesswright                                             191   2e-57   
ref|XP_010337297.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    194   2e-57   
emb|CDO73559.1|  hypothetical protein BN946_scf185014.g29               190   2e-57   
gb|KFH73829.1|  SUMO-conjugating enzyme ubc9                            190   2e-57   
ref|XP_005643019.1|  ubiquitin-conjugating enzyme                       190   2e-57   
ref|XP_001654032.1|  AAEL009770-PA                                      190   2e-57   
ref|XP_011057878.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          190   2e-57   
emb|CCJ28847.1|  unnamed protein product                                190   2e-57   
gb|ACI68647.1|  SUMO-conjugating enzyme UBC9                            190   2e-57   
sp|Q6Y1Z4.1|UBC9_PAGMA  RecName: Full=SUMO-conjugating enzyme UBC...    190   3e-57   
gb|ACJ03792.1|  ubiquitin-conjugating enzyme E2                         190   3e-57   
gb|KDQ33413.1|  hypothetical protein PLEOSDRAFT_1087809                 190   3e-57   
gb|ACN10367.1|  SUMO-conjugating enzyme UBC9                            190   3e-57   
ref|XP_002414996.1|  ubiquitin protein ligase, putative                 190   3e-57   
ref|XP_007764593.1|  ubiquitin-conjugating enzyme 9                     189   3e-57   
gb|KFM78957.1|  SUMO-conjugating enzyme UBC9                            189   3e-57   
gb|AFU93453.1|  ubiquitin-conjugating enzyme E2 c                       189   4e-57   
ref|XP_009010112.1|  hypothetical protein HELRODRAFT_71397              189   4e-57   
gb|KJA27014.1|  hypothetical protein HYPSUDRAFT_83919                   189   4e-57   
gb|KIK57631.1|  hypothetical protein GYMLUDRAFT_75247                   189   4e-57   
gb|EPX74695.1|  SUMO conjugating enzyme Hus5                            189   4e-57   
dbj|GAK66535.1|  ubiquitin-conjugating enzyme9                          189   4e-57   
dbj|GAN08838.1|  SUMO conjugating enzyme Hus5                           189   5e-57   
emb|CEL51642.1|  ubiquitin-conjugating enzyme E2 I                      189   5e-57   
gb|EMD38460.1|  ubiquitin-conjugating enzyme9                           189   5e-57   
gb|EPB87546.1|  SUMO-conjugating enzyme ubc9                            189   6e-57   
gb|EFX81969.1|  hypothetical protein DAPPUDRAFT_230818                  189   6e-57   
gb|KDR73630.1|  hypothetical protein GALMADRAFT_251388                  189   6e-57   
ref|XP_006457886.1|  ubiquitin-conjugating enzyme9                      189   6e-57   
ref|XP_007385473.1|  ubiquitin-conjugating enzyme 9                     189   6e-57   
ref|XP_001658383.1|  AAEL007477-PA                                      188   7e-57   
ref|XP_003399340.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       189   7e-57   
ref|XP_003488254.1|  PREDICTED: hypothetical protein LOC100741621       201   7e-57   
gb|ADW82097.1|  SUMO-conjugating enzyme                                 189   7e-57   
ref|XP_001640489.1|  predicted protein                                  189   8e-57   
gb|KIY65299.1|  ubiquitin-conjugating enzyme                            189   8e-57   
gb|ACO08653.1|  SUMO-1-conjugating enzyme UBC9                          189   8e-57   
emb|CCF48644.1|  probable ubiquitin--protein ligase hus5                189   8e-57   
emb|CEI95327.1|  Putative SUMO-conjugating enzyme ubc9                  188   9e-57   
gb|KIO13437.1|  hypothetical protein M404DRAFT_122495                   188   9e-57   
emb|CAX76993.1|  lesswright                                             189   9e-57   
ref|XP_002180700.1|  predicted protein                                  188   1e-56   
gb|AAW27023.1|  SJCHGC06275 protein                                     189   1e-56   
dbj|GAC94871.1|  hypothetical protein PHSY_002444                       189   1e-56   
ref|XP_003740914.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       188   1e-56   
gb|ELU16619.1|  hypothetical protein CAPTEDRAFT_21101                   188   1e-56   
gb|EST08788.1|  ubiquitin-protein ligase                                188   1e-56   
gb|AEE61507.1|  unknown                                                 188   1e-56   
ref|XP_003382769.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          188   1e-56   
gb|KIO32572.1|  hypothetical protein M407DRAFT_105533                   188   1e-56   
ref|XP_002116889.1|  hypothetical protein TRIADDRAFT_31624              188   1e-56   
gb|EUC61687.1|  ubiquitin-conjugating enzyme, E2                        188   1e-56   
gb|EFO23090.2|  SUMO-conjugating enzyme UBC9                            188   2e-56   
emb|CCD82677.1|  putative ubiquitin-conjugating enzyme E2 I             188   2e-56   
ref|XP_006566477.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    188   2e-56   
gb|AAC50603.1|  ubiquitin-conjugating enzyme 9 (UBC9)                   188   2e-56   
ref|XP_320422.3|  AGAP012107-PA                                         187   2e-56   
gb|KGL82357.1|  SUMO-conjugating enzyme UBC9                            188   2e-56   
ref|XP_002173301.1|  SUMO conjugating enzyme Hus5                       187   2e-56   
gb|ETS60172.1|  hypothetical protein PaG_05712                          191   2e-56   
ref|NP_593204.1|  SUMO conjugating enzyme Hus5                          187   2e-56   
gb|KIL00912.1|  hypothetical protein PAXRUDRAFT_128689                  187   3e-56   
pdb|3RCZ|B  Chain B, Rad60 Sld2 Ubc9 Complex                            187   3e-56   
ref|XP_011390864.1|  putative E2 SUMO-conjugating protein UBC9          187   3e-56   
ref|XP_955236.1|  ubiquitin-conjugating enzyme (E2)                     187   3e-56   
ref|NP_001268336.1|  SUMO-conjugating enzyme UBC9                       187   3e-56   
gb|KIK46365.1|  hypothetical protein CY34DRAFT_800543                   187   3e-56   
emb|CDI55042.1|  probable ubiquitin--protein ligase hus5                187   3e-56   
emb|CBY43552.1|  unnamed protein product                                187   4e-56   
emb|CDM27915.1|  SUMO-conjugating enzyme ubc9                           187   4e-56   
gb|KIJ69060.1|  hypothetical protein HYDPIDRAFT_105630                  187   4e-56   
dbj|GAC77593.1|  ubiquitin-protein ligase                               191   4e-56   
ref|NP_001119692.1|  lesswright                                         187   4e-56   
gb|KIP12260.1|  hypothetical protein PHLGIDRAFT_62130                   187   4e-56   
ref|XP_003243970.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     187   4e-56   
ref|XP_003035299.1|  ubiquitin-conjugating enzyme 9                     187   4e-56   
ref|XP_007361367.1|  ubiquitin-conjugating enzyme 9                     187   4e-56   
ref|XP_002258423.1|  Ubiquitin-conjugating enzyme                       187   4e-56   
gb|ACM50882.1|  E2 ubiquitin conjugating enzyme                         187   5e-56   
ref|XP_002132550.1|  GA25892                                            187   5e-56   
emb|CDR98059.1|  -UMO-conjugating enzyme UBC9-B                         187   5e-56   
ref|XP_001833174.2|  ubiquitin-conjugating enzyme9                      186   5e-56   
ref|XP_003269093.2|  PREDICTED: uncharacterized protein LOC100583288    194   6e-56   
ref|XP_002565702.1|  Pc22g17930                                         186   6e-56   
gb|EYB84189.1|  hypothetical protein Y032_0322g2463                     187   6e-56   
gb|KIJ10477.1|  hypothetical protein PAXINDRAFT_172107                  186   6e-56   
emb|CDJ63826.1|  ubiquitin-conjugating enzyme e2, putative              189   6e-56   
gb|AET50682.1|  hypothetical protein                                    189   7e-56   
ref|XP_006958337.1|  ubiquitin-conjugating enzyme                       186   7e-56   
gb|KII89155.1|  hypothetical protein PLICRDRAFT_160305                  186   7e-56   
pdb|4JUE|A  Chain A, Crystal Structure Of Plasmodium Falciparum U...    186   7e-56   
ref|XP_001352023.1|  ubiquitin conjugating enzyme, putative             186   7e-56   
ref|XP_002785759.1|  SUMO-conjugating enzyme ubc9, putative             186   8e-56   
gb|KDQ11641.1|  hypothetical protein BOTBODRAFT_35092                   186   8e-56   
emb|CDQ71070.1|  unnamed protein product                                197   8e-56   
emb|CDJ95354.1|  Ubiquitin-conjugating enzyme domain containing p...    186   9e-56   
emb|CBJ27032.1|  conserved unknown protein                              186   1e-55   
ref|XP_001419699.1|  predicted protein                                  186   1e-55   
ref|XP_003699980.1|  PREDICTED: uncharacterized protein LOC100881261    199   1e-55   
dbj|BAK08306.1|  predicted protein                                      186   1e-55   
ref|XP_001614687.1|  ubiquitin conjugating enzyme                       186   1e-55   
gb|EDL22412.1|  mCG17660, isoform CRA_a                                 186   1e-55   
gb|EJW88467.1|  ubiquitin carrier protein                               186   1e-55   
ref|XP_002778187.1|  SUMO-conjugating enzyme ubc9, putative             186   2e-55   
emb|CDR98039.1|  -SUMO-conjugating enzyme UBC9                          185   2e-55   
gb|KHN74897.1|  SUMO-conjugating enzyme UBC9                            186   2e-55   
ref|XP_009045520.1|  hypothetical protein LOTGIDRAFT_110263             185   2e-55   
gb|ERG79270.1|  sumo-conjugating enzyme ubc9                            186   2e-55   
emb|CDS11348.1|  Putative SUMO-conjugating enzyme ubc9                  185   2e-55   
gb|AFV69238.1|  ubiquitin-conjugating enzyme E2 UBC9                    185   2e-55   
pdb|4M1N|A  Chain A, Crystal Structure Of Plasmodium Falciparum U...    185   2e-55   
ref|XP_763568.1|  ubiquitin-conjugating enzyme                          185   2e-55   
ref|XP_001947239.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     185   2e-55   
gb|EFX03658.1|  sumo conjugating enzyme                                 185   2e-55   
gb|ENN74894.1|  hypothetical protein YQE_08473                          190   3e-55   
ref|XP_008036607.1|  ubiquitin-conjugating enzyme 9                     184   4e-55   
gb|KIM79640.1|  hypothetical protein PILCRDRAFT_823178                  184   4e-55   
dbj|BAH72855.1|  ACYPI000084                                            184   4e-55   
gb|KGO68463.1|  Ubiquitin-conjugating enzyme, E2                        184   4e-55   
ref|XP_007264073.1|  ubiquitin-conjugating enzyme 9                     184   5e-55   
ref|XP_008694938.1|  PREDICTED: SUMO-conjugating enzyme UBC9            184   5e-55   
gb|KIK31127.1|  hypothetical protein PISMIDRAFT_132723                  184   6e-55   
gb|EPS96806.1|  hypothetical protein FOMPIDRAFT_1025232                 184   6e-55   
ref|XP_002014591.1|  GL19266                                            184   6e-55   
ref|XP_001949992.2|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     184   7e-55   
ref|XP_007846103.1|  ubiquitin-conjugating enzyme 9                     184   7e-55   
ref|XP_008893455.1|  hypothetical protein PPTG_01818                    184   8e-55   
gb|ENN74895.1|  hypothetical protein YQE_08473                          190   1e-54   
ref|XP_008625160.1|  SUMO-conjugating enzyme UBC9                       183   1e-54   
emb|CDI85656.1|  ubiquitin-conjugating enzyme e2, putative              185   1e-54   
emb|CDS29546.1|  ubiquitin conjugating enzyme e2 i                      183   1e-54   
emb|CDJ00005.1|  ubiquitin conjugating enzyme e2 i                      183   1e-54   
ref|XP_009691372.1|  ubiquitin carrier protein                          183   1e-54   
gb|ELW67784.1|  BAI1-associated protein 3                               199   1e-54   
gb|EUB62720.1|  SUMO-conjugating enzyme UBC9                            185   2e-54   
ref|XP_007301022.1|  ubiquitin-conjugating enzyme 9                     183   2e-54   
ref|XP_007395516.1|  hypothetical protein PHACADRAFT_120280             183   2e-54   
ref|XP_003717980.1|  SUMO-conjugating enzyme ubc9                       182   2e-54   
emb|CDJ29851.1|  ubiquitin-conjugating enzyme e2, putative              184   2e-54   
ref|XP_003140978.1|  ube2i2 protein                                     183   2e-54   
gb|ESA17705.1|  hypothetical protein GLOINDRAFT_344968                  182   2e-54   
gb|ENH81712.1|  sumo conjugating enzyme                                 182   2e-54   
ref|XP_003879879.1|  ubiquitin carrier protein, related                 184   3e-54   
emb|CDJ48680.1|  ubiquitin-conjugating enzyme e2, putative              184   3e-54   
emb|CDI81316.1|  ubiquitin-conjugating enzyme e2, putative              184   3e-54   
gb|EJY76190.1|  Ubiquitin conjugating enzyme, putative                  182   3e-54   
ref|XP_001418181.1|  predicted protein                                  182   3e-54   
ref|XP_007281481.1|  ubiquitin-conjugating enzyme e2-18 kda             182   3e-54   
ref|XP_001267344.1|  SUMO conjugating enzyme (UbcI), putative           182   3e-54   
ref|XP_001214722.1|  ubiquitin-conjugating enzyme E2-18 kDa             182   3e-54   
ref|XP_004832099.1|  ubiquitin-conjugating enzyme family member p...    182   3e-54   
ref|XP_009542778.1|  hypothetical protein HETIRDRAFT_414959             182   3e-54   
gb|EFN62617.1|  SUMO-conjugating enzyme UBC9                            193   4e-54   
ref|XP_572712.1|  ubiquitin-conjugating enzyme e2-18 kda                182   4e-54   
ref|XP_793891.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like          182   4e-54   
ref|XP_752143.1|  SUMO conjugating enzyme (UbcI)                        183   4e-54   
emb|CDJ60382.1|  ubiquitin-conjugating enzyme e2, putative              184   4e-54   
ref|XP_001609154.1|  ubiquitin conjugating enzyme                       182   4e-54   
ref|XP_008887051.1|  ubiquitin-conjugating enzyme subfamily protein     184   4e-54   
ref|XP_003195742.1|  ubiquitin-conjugating enzyme                       182   4e-54   
gb|ESA11669.1|  hypothetical protein GLOINDRAFT_347677                  182   4e-54   
gb|KIR98527.1|  ubiquitin-conjugating enzyme E2 I                       182   5e-54   
gb|EXV04446.1|  ubiquitin-activating enzyme E2 family protein           181   5e-54   
gb|AFR97059.1|  ubiquitin-conjugating enzyme E2 I                       181   6e-54   
ref|XP_002369648.1|  ubiquitin-conjugating enzyme E2, putative          183   6e-54   
ref|XP_001401500.2|  SUMO-conjugating enzyme                            181   6e-54   
ref|XP_678033.1|  ubiquitin conjugating enzyme                          181   6e-54   
ref|XP_007794183.1|  putative sumo-conjugating enzyme ubc9 protein      181   6e-54   
ref|XP_004255836.1|  SUMO-conjugating enzyme UBC9, putative             181   7e-54   
emb|CAK47896.1|  unnamed protein product                                182   7e-54   
ref|XP_007877095.1|  hypothetical protein PFL1_01402                    181   8e-54   
gb|ERT02952.1|  SUMO-conjugating enzyme ubc9                            181   8e-54   
ref|XP_001732266.1|  hypothetical protein MGL_0041                      181   8e-54   
ref|NP_001040407.1|  ubiquitin-conjugating enzyme E2                    181   8e-54   
gb|KIK08740.1|  hypothetical protein K443DRAFT_672259                   181   8e-54   
emb|CBJ30821.1|  expressed unknown protein                              181   8e-54   
emb|CDU17553.1|  SUMO-conjugating enzyme UBC9, putative                 181   9e-54   
gb|KHN88730.1|  SUMO-conjugating enzyme UBC9                            181   9e-54   



>ref|XP_004511894.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cicer arietinum]
Length=159

 Score =   284 bits (727),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 140/150 (93%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG YPLTMHFSEDYP
Sbjct  12   ERKSWR--KNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYYPLTMHFSEDYP  69

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  70   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  129

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD VEYKRRV+QQAKQYPPL+
Sbjct  130  QTEGYHLFIQDVVEYKRRVKQQAKQYPPLL  159



>ref|XP_007156772.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
 ref|XP_007156773.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
 gb|ESW28766.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
 gb|ESW28767.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
Length=159

 Score =   282 bits (721),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PLTMHFSEDYP
Sbjct  12   ERKSWR--KNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPLTMHFSEDYP  69

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  70   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  129

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  130  QTEGYHLFIQDATEYKRRVRQQAKQYPPLV  159



>ref|XP_007155902.1| hypothetical protein PHAVU_003G241600g [Phaseolus vulgaris]
 gb|ESW27896.1| hypothetical protein PHAVU_003G241600g [Phaseolus vulgaris]
Length=160

 Score =   282 bits (721),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 140/149 (94%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ+FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ
Sbjct  72   KPPKCKFPQSFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            TEGYHLFIQD  EYKRRVRQQAKQYPPL+
Sbjct  132  TEGYHLFIQDATEYKRRVRQQAKQYPPLL  160



>ref|XP_003517314.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Glycine 
max]
 ref|XP_006573646.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Glycine 
max]
 gb|KHN36251.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
Length=159

 Score =   281 bits (720),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPD TVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYP
Sbjct  12   ERKSWR--KNHPHGFVAKPETLPDATVNLMVWHCTIPGKAGTDWEGGYFPLTMHFSEDYP  69

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  70   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  129

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD  EYKRRVRQQ+KQYPPLV
Sbjct  130  QTEGYHLFIQDAAEYKRRVRQQSKQYPPLV  159



>ref|XP_006590254.1| PREDICTED: uncharacterized protein LOC100305922 isoform X1 [Glycine 
max]
 ref|XP_006590255.1| PREDICTED: uncharacterized protein LOC100305922 isoform X2 [Glycine 
max]
 gb|KHN42102.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
Length=159

 Score =   281 bits (719),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PLTMHFSEDYP
Sbjct  12   ERKSWR--KNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPLTMHFSEDYP  69

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  70   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  129

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD  EYKRRVRQQ+KQYPPLV
Sbjct  130  QTEGYHLFIQDAAEYKRRVRQQSKQYPPLV  159



>ref|NP_001234980.1| uncharacterized protein LOC100305922 [Glycine max]
 gb|ACU13836.1| unknown [Glycine max]
Length=159

 Score =   280 bits (717),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PLTMHFSEDYPSKPPKCKFPQ 
Sbjct  21   PHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPLTMHFSEDYPSKPPKCKFPQG  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  81   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQ+KQYPPLV
Sbjct  141  AAEYKRRVRQQSKQYPPLV  159



>ref|XP_010093513.1| SUMO-conjugating enzyme SCE1 [Morus notabilis]
 gb|EXB54179.1| SUMO-conjugating enzyme SCE1 [Morus notabilis]
Length=160

 Score =   280 bits (716),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 139/150 (93%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD VEYK+RVR QAKQYPPLV
Sbjct  131  QTEGYHLFIQDAVEYKKRVRVQAKQYPPLV  160



>dbj|BAJ53199.1| JHL03K20.8 [Jatropha curcas]
 gb|KDP31974.1| hypothetical protein JCGZ_12435 [Jatropha curcas]
Length=160

 Score =   280 bits (716),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVRQQAKQYPPLV
Sbjct  142  GAEYKKRVRQQAKQYPPLV  160



>ref|NP_001235590.1| uncharacterized protein LOC100500268 [Glycine max]
 ref|XP_003524642.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Glycine max]
 gb|ACU15291.1| unknown [Glycine max]
 gb|KHN08823.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
 gb|KHN15642.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
Length=160

 Score =   280 bits (715),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPLTLHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD  EYKRRVRQQAKQYPPL+
Sbjct  131  QTEGYHLFIQDAAEYKRRVRQQAKQYPPLL  160



>ref|XP_004288010.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   280 bits (715),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP+DPAQ
Sbjct  72   KPPKCKFPANFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPSDPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            TEGYHLFIQD+ EYKRRVRQQAKQYPPLV
Sbjct  132  TEGYHLFIQDSTEYKRRVRQQAKQYPPLV  160



>gb|KJB39148.1| hypothetical protein B456_007G216300 [Gossypium raimondii]
Length=160

 Score =   279 bits (713),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLD PNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDAPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  ANEYKRRVRQQAKQYPPLV  160



>emb|CDP02519.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   278 bits (712),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG+YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMVWHCTIPGKPGTDWEGGSYPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EYK+RVRQQAKQYPPL+
Sbjct  142  ALEYKKRVRQQAKQYPPLI  160



>gb|AFK39856.1| unknown [Lotus japonicus]
Length=160

 Score =   278 bits (712),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 136/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET PDGTVN+MVWHCTIPGK GTDWE G YPLTMHFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETQPDGTVNMMVWHCTIPGKTGTDWENGYYPLTMHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  131  QTEGYHLFIQDATEYKRRVRQQAKQYPPLV  160



>ref|XP_004509116.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cicer arietinum]
Length=159

 Score =   278 bits (710),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPETLPDG+VNLM+WHCTIPGK+GTDWEGG +PLT+HFSEDYPS
Sbjct  13   RKSWR--KNHPHGFVAKPETLPDGSVNLMIWHCTIPGKSGTDWEGGYFPLTLHFSEDYPS  70

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ
Sbjct  71   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  130

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            TEGYHLFIQDT EYKRRVR QAKQYPPL+
Sbjct  131  TEGYHLFIQDTTEYKRRVRLQAKQYPPLL  159



>ref|XP_006425960.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
 ref|XP_006494471.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Citrus sinensis]
 gb|ESR39200.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
 gb|KDO79110.1| hypothetical protein CISIN_1g031379mg [Citrus sinensis]
Length=160

 Score =   276 bits (707),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDG+VNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETLPDGSVNLMVWHCTIPGKAGTDWEGGFFPLTLHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD  EYKRRVRQQAKQYP L+
Sbjct  131  QTEGYHLFIQDAAEYKRRVRQQAKQYPALL  160



>ref|XP_007047350.1| Sumo conjugation enzyme 1 [Theobroma cacao]
 gb|EOX91507.1| Sumo conjugation enzyme 1 [Theobroma cacao]
Length=160

 Score =   276 bits (707),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLQDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDAPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  ANEYKRRVRQQAKQYPPLV  160



>ref|XP_009389843.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   276 bits (706),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDG+VNLM+WHCTIPGK GTDWEGG +PLT+HFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETLPDGSVNLMIWHCTIPGKQGTDWEGGYFPLTLHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  131  QTDGYHLFIQDPAEYKRRVRQQAKQYPPLV  160



>ref|XP_008783454.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Phoenix dactylifera]
Length=160

 Score =   275 bits (704),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLM+WHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMIWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPL+
Sbjct  142  PAEYKRRVRQQAKQYPPLI  160



>ref|XP_002283130.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Vitis vinifera]
 emb|CBI21382.3| unnamed protein product [Vitis vinifera]
Length=162

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG VNLMVW CTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGQVNLMVWQCTIPGKPGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  AAEYKRRVRQQAKQYPPLV  160



>emb|CAE45567.1| SUMO E2 conjugating enzyme SCE1 [Nicotiana benthamiana]
Length=160

 Score =   275 bits (703),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DG+VNLMVWHC+IPGKAGTDWEGG YP+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLSDGSVNLMVWHCSIPGKAGTDWEGGFYPVTIHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EYK+RVR QAKQYPPLV
Sbjct  142  AIEYKKRVRLQAKQYPPLV  160



>ref|XP_010070565.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Eucalyptus grandis]
Length=159

 Score =   275 bits (703),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLM+WHC IPGKAGTDWEGG YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  21   PHGFVAKPETLPDGTVNLMIWHCIIPGKAGTDWEGGFYPLTLHFSEDYPSKPPKCKFPQG  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  81   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVR QAKQYP L+
Sbjct  141  VTEYKKRVRMQAKQYPSLI  159



>ref|XP_009367435.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Pyrus x bretschneideri]
Length=160

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGFFPLTLHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVRQQ+KQYPPLV
Sbjct  142  ATEYKKRVRQQSKQYPPLV  160


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 43/106 (41%), Gaps = 20/106 (19%)
 Frame = +3

Query  15   MLGGIARGRLAEERKAWRKNPPWFRGKAGDTPRWYRQPDGVALHYSWK-------GRD*L  173
            M GGIARGRLAEERKAWRKN P      G   +    PDG      W        G D  
Sbjct  1    MSGGIARGRLAEERKAWRKNHP-----HGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWE  55

Query  174  GRW*LPANNALQRRLPKQTAKVQISPGVFPPK-------CLSFRNS  290
            G +  P         P +  K +  PG F P        CLS  N 
Sbjct  56   GGF-FPLTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNE  100



>ref|XP_009385926.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLM WHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMTWHCTIPGKQGTDWEGGYFPLTVHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             VEYKRRVRQQAKQYPPL+
Sbjct  142  PVEYKRRVRQQAKQYPPLL  160



>ref|XP_004151860.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cucumis sativus]
 ref|XP_008462833.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Cucumis melo]
 gb|KGN63318.1| hypothetical protein Csa_2G428410 [Cucumis sativus]
Length=160

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET+PDGTVNLM+WHC IPGK GTDWEGG +PLT++FSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETMPDGTVNLMIWHCIIPGKVGTDWEGGFFPLTLNFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKC+FPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  71   SKPPKCRFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD VEYK+RVRQQAKQYPPLV
Sbjct  131  QTEGYHLFIQDAVEYKKRVRQQAKQYPPLV  160



>ref|XP_008338336.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Malus domestica]
 ref|XP_009372432.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Pyrus x bretschneideri]
Length=160

 Score =   274 bits (700),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGFFPLTLHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVRQQ++QYPPLV
Sbjct  142  ATEYKKRVRQQSRQYPPLV  160


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 43/106 (41%), Gaps = 20/106 (19%)
 Frame = +3

Query  15   MLGGIARGRLAEERKAWRKNPPWFRGKAGDTPRWYRQPDGVALHYSWK-------GRD*L  173
            M GGIARGRLAEERKAWRKN P      G   +    PDG      W        G D  
Sbjct  1    MSGGIARGRLAEERKAWRKNHP-----HGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWE  55

Query  174  GRW*LPANNALQRRLPKQTAKVQISPGVFPPK-------CLSFRNS  290
            G +  P         P +  K +  PG F P        CLS  N 
Sbjct  56   GGF-FPLTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNE  100



>ref|XP_011097247.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Sesamum indicum]
Length=160

 Score =   274 bits (700),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPE LPDGTVNLMVW CTIPGKAGTDWEGG YPLTMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPEYLPDGTVNLMVWQCTIPGKAGTDWEGGFYPLTMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL QPNPADPAQTEGYH+FIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLGQPNPADPAQTEGYHMFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             VEY +RVRQQAKQYPPLV
Sbjct  142  EVEYGKRVRQQAKQYPPLV  160



>ref|XP_004234662.1| PREDICTED: SUMO-conjugating enzyme SCE1 isoform X2 [Solanum lycopersicum]
Length=160

 Score =   274 bits (700),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVWHC+IPGK GTDWEGG YP+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMVWHCSIPGKTGTDWEGGCYPVTIHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EYK+RV+ QAKQYPPLV
Sbjct  142  AIEYKKRVKLQAKQYPPLV  160



>gb|KHG02093.1| SUMO-conjugating enzyme SCE1 -like protein [Gossypium arboreum]
 gb|KJB39147.1| hypothetical protein B456_007G216300 [Gossypium raimondii]
Length=163

 Score =   274 bits (700),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  82   GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  261
            GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ FF
Sbjct  27   GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQGFF  86

Query  262  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  441
            HPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLD PNPADPAQTEGYHLFIQD  
Sbjct  87   HPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDAPNPADPAQTEGYHLFIQDAN  146

Query  442  EYKRRVRQQAKQYPPLV  492
            EYKRRVRQQAKQYPPLV
Sbjct  147  EYKRRVRQQAKQYPPLV  163


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 43/106 (41%), Gaps = 17/106 (16%)
 Frame = +3

Query  15   MLGGIARGRLAEERKAWRKNPPWFRGKAGDTPRWYRQPDGVALHYSWK-------GRD*L  173
            M GGIARGRLAEERKAWRKN P  RG     P     PDG      W        G D  
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHVRGGFVAKPE--TLPDGTVNLMVWHCTIPGKAGTDWE  58

Query  174  GRW*LPANNALQRRLPKQTAKVQISPGVFPPK-------CLSFRNS  290
            G +  P         P +  K +   G F P        CLS  N 
Sbjct  59   GGY-FPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNE  103



>ref|XP_007206053.1| hypothetical protein PRUPE_ppa012626mg [Prunus persica]
 gb|EMJ07252.1| hypothetical protein PRUPE_ppa012626mg [Prunus persica]
Length=160

 Score =   274 bits (700),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLSDGTVNLMVWHCTIPGKTGTDWEGGFFPLTLHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVRQQAKQYPPLV
Sbjct  142  ATEYKKRVRQQAKQYPPLV  160



>ref|XP_008809080.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809081.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809083.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809084.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809085.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
Length=160

 Score =   273 bits (699),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMVWHCTIPGKLGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDLPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  PAEYKRRVRQQAKQYPPLV  160



>ref|XP_009783412.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Nicotiana sylvestris]
Length=160

 Score =   273 bits (698),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DG+VNLMVWHC+IPGK GTDWEGG YP+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLSDGSVNLMVWHCSIPGKTGTDWEGGFYPVTIHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EYK+RVR QAKQYPPLV
Sbjct  142  AIEYKKRVRLQAKQYPPLV  160



>ref|XP_008244101.1| PREDICTED: SUMO-conjugating enzyme SCE1, partial [Prunus mume]
Length=153

 Score =   273 bits (698),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  15   PHGFVAKPETLSDGTVNLMVWHCTIPGKTGTDWEGGFFPLTLHFSEDYPSKPPKCKFPPG  74

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  75   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  134

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVRQQAKQYPPLV
Sbjct  135  ATEYKKRVRQQAKQYPPLV  153



>gb|ACJ83979.1| unknown [Medicago truncatula]
 gb|AFK49507.1| unknown [Medicago truncatula]
 gb|KEH31466.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=159

 Score =   273 bits (698),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLM+WHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  21   PHGFVAKPETAADGSVNLMIWHCTIPGKAGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  81   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYKRRVR QAKQYP +V
Sbjct  141  TTEYKRRVRLQAKQYPSIV  159



>ref|XP_011099107.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Sesamum indicum]
Length=160

 Score =   273 bits (697),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG YPLTMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIPGKPGTDWEGGYYPLTMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL QPN +DPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLVQPNASDPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
            +VEY +RVR QAKQYPPLV
Sbjct  142  SVEYNKRVRSQAKQYPPLV  160



>ref|NP_001274896.1| SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
 gb|AFX66975.1| SUMO E2 conjugating enzyme SCE1 [Solanum tuberosum]
Length=160

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVWHC+IPGK GTDWEGG YP+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMVWHCSIPGKTGTDWEGGCYPVTIHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EYK+R + QAKQYPPLV
Sbjct  142  AIEYKKRAKLQAKQYPPLV  160



>ref|XP_002307279.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 ref|XP_011006860.1| PREDICTED: SUMO-conjugating enzyme SCE1 isoform X1 [Populus euphratica]
 emb|CAD29823.2| putative ubiquitin-conjugating enzyme [Populus x canadensis]
 gb|ABK93309.1| unknown [Populus trichocarpa]
 gb|EEE94275.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=160

 Score =   272 bits (696),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGK GTDWEGG +PLT++FSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETQPDGTVNLMVWHCTIPGKLGTDWEGGYFPLTLNFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ
Sbjct  72   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            TEGYHLFIQD  EYK+RVRQQAKQYP LV
Sbjct  132  TEGYHLFIQDAAEYKKRVRQQAKQYPSLV  160



>ref|XP_002468614.1| hypothetical protein SORBIDRAFT_01g049010 [Sorghum bicolor]
 ref|XP_004985918.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
 gb|EER95612.1| hypothetical protein SORBIDRAFT_01g049010 [Sorghum bicolor]
Length=160

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLM+WHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGTVNLMIWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  142  PTEYKRRVRLQAKQYPALV  160



>ref|XP_009615424.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Nicotiana tomentosiformis]
Length=160

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DG+VNLM WHC+IPGK GTDWEGG YP+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLSDGSVNLMAWHCSIPGKTGTDWEGGFYPVTIHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EYK+RVR QAKQYPPLV
Sbjct  142  AIEYKKRVRLQAKQYPPLV  160



>ref|XP_009781499.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana sylvestris]
Length=160

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG YPLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLPDGSVNLMVWHCTIPGKTGTDWEGGYYPLTVHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EY++RVR Q+KQYPPLV
Sbjct  142  ALEYRKRVRLQSKQYPPLV  160



>emb|CAN61018.1| hypothetical protein VITISV_001138 [Vitis vinifera]
Length=160

 Score =   271 bits (694),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  PAEYKRRVRQQAKQYPPLV  160



>ref|XP_003611678.1| SUMO-conjugating enzyme UBC9 [Medicago truncatula]
 gb|AES94636.1| ubiquitin-conjugating enzyme [Medicago truncatula]
 gb|AFK34870.1| unknown [Medicago truncatula]
Length=159

 Score =   271 bits (693),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDGT+NLM WHC+IPGKAGTDWEGG YPLTM FSEDYPS
Sbjct  13   RKSWR--KNHPHGFVAKPETNPDGTINLMAWHCSIPGKAGTDWEGGYYPLTMVFSEDYPS  70

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLDQPNPADPAQ
Sbjct  71   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQ  130

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            TEGYHLFIQD VEYKRRV+QQAKQYP ++
Sbjct  131  TEGYHLFIQDAVEYKRRVKQQAKQYPSII  159



>ref|XP_010934002.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Elaeis guineensis]
Length=160

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DG+VNLMVW+CTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLADGSVNLMVWNCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP+DPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPSDPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY+RRVRQQAKQYPPLV
Sbjct  142  LTEYRRRVRQQAKQYPPLV  160



>ref|NP_001048802.1| Os03g0123100 [Oryza sativa Japonica Group]
 gb|AAN74837.1| Putative ubiquitin-conjugating enzyme [Oryza sativa Japonica 
Group]
 gb|ABF93717.1| Ubiquitin-conjugating enzyme E2 I, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10716.1| Os03g0123100 [Oryza sativa Japonica Group]
 gb|EAY88329.1| hypothetical protein OsI_09788 [Oryza sativa Indica Group]
 gb|EAZ25409.1| hypothetical protein OsJ_09225 [Oryza sativa Japonica Group]
 dbj|BAG88233.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=160

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLM+WHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLADGTVNLMIWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYPP+V
Sbjct  142  PTEYKRRVRLQAKQYPPIV  160



>ref|XP_010270683.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Nelumbo nucifera]
Length=160

 Score =   271 bits (692),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +P+++ FSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIPGKPGTDWEGGYFPISLQFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  PAEYKRRVRQQAKQYPPLV  160



>ref|XP_003558940.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Brachypodium distachyon]
Length=160

 Score =   271 bits (692),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQA
Sbjct  22   PHGFVAKPETLGDGTVNLMVWHCTIPGKQGTDWEGGYFPLTLNFSEDYPSKPPKCKFPQA  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRR+R QAKQYPPLV
Sbjct  142  PTEYKRRIRLQAKQYPPLV  160



>ref|XP_009139007.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Brassica rapa]
 emb|CDX88967.1| BnaA04g02190D [Brassica napus]
Length=160

 Score =   271 bits (692),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  132  TDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>ref|XP_006649299.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Oryza brachyantha]
Length=160

 Score =   270 bits (691),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET+ DGTVNLM+WHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETMADGTVNLMIWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYPP+V
Sbjct  142  PTEYKRRVRLQAKQYPPIV  160



>ref|XP_002284949.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Vitis vinifera]
 emb|CBI19485.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPN ADPAQT+GY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNAADPAQTDGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  PAEYKRRVRQQAKQYPPLV  160



>ref|XP_010927156.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Elaeis guineensis]
Length=160

 Score =   270 bits (689),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DG+VNLMVWHCTIPGK GTDW+GG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLSDGSVNLMVWHCTIPGKQGTDWDGGYFPLTLHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  PAEYKRRVRQQAKQYPPLV  160



>ref|NP_001149113.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|ACG34242.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|AFW89763.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=160

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPE+LPDGTVNLM+WHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPESLPDGTVNLMIWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRV+ QAKQYP LV
Sbjct  142  PTEYKRRVKLQAKQYPALV  160



>emb|CDP01300.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPE+  DG+VNLMVWHCTIPGKAGTDWEGG YPLTMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPESGADGSVNLMVWHCTIPGKAGTDWEGGYYPLTMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGY +++Q+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYQMYMQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP+V
Sbjct  142  PAEYKRRVRQQAKQYPPIV  160



>ref|XP_004231867.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Solanum lycopersicum]
Length=160

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLM+WHCTIPGKA TDWEGG YPLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLPDGSVNLMIWHCTIPGKAETDWEGGCYPLTIHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYH+FIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHMFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EY++RVR Q+KQYPPLV
Sbjct  142  VLEYRKRVRLQSKQYPPLV  160



>gb|AFK40127.1| unknown [Lotus japonicus]
Length=159

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETL DGT+NLMVWHCTIPGK GTDW+GG +PLT+HFSEDYP
Sbjct  12   ERKSWR--KNHPHGFVAKPETLSDGTINLMVWHCTIPGKTGTDWDGGYFPLTLHFSEDYP  69

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  70   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  129

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QTEGYHLFIQD  EYKRRV+QQ K +PPLV
Sbjct  130  QTEGYHLFIQDVAEYKRRVQQQTKLFPPLV  159



>ref|XP_008807218.1| PREDICTED: SUMO-conjugating enzyme SCE1-like, partial [Phoenix 
dactylifera]
Length=137

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  82   GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  261
            GFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ FF
Sbjct  1    GFVAKPETLPDGSVNLMVWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQGFF  60

Query  262  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  441
            HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD  
Sbjct  61   HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQDPA  120

Query  442  EYKRRVRQQAKQYPPLV  492
            EY+RRVR QAKQYPPLV
Sbjct  121  EYRRRVRHQAKQYPPLV  137



>gb|ADP37981.1| ubiquitin-protein ligase [Brassica napus]
Length=160

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITV+QILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVEQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  132  TDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>emb|CDY47661.1| BnaC04g23980D [Brassica napus]
Length=160

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLFIQD VEYK+RV+ Q KQYPP+V
Sbjct  132  TDGYHLFIQDAVEYKKRVKLQYKQYPPIV  160



>ref|XP_010548072.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Tarenaya hassleriana]
Length=160

 Score =   269 bits (687),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGT NLMVW C IPGK+GTDWEGG +PL MHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGTCNLMVWQCIIPGKSGTDWEGGYFPLAMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAI+VKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAISVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKR+VRQQAKQYPP+V
Sbjct  142  PAEYKRKVRQQAKQYPPIV  160



>ref|XP_008650364.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Zea mays]
 gb|ACG24785.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|ACG37840.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 tpg|DAA43022.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=160

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPE+LPDGTVNLM+W CTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPESLPDGTVNLMIWQCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  142  PTEYKRRVRLQAKQYPALV  160



>ref|XP_010263454.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nelumbo nucifera]
Length=160

 Score =   268 bits (686),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVW+CTIPGK GTDWEGG +P+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMVWNCTIPGKPGTDWEGGYFPITLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  PAEYKRRVRQQAKQYPPLV  160



>emb|CDY70581.1| BnaAnng34240D [Brassica napus]
Length=160

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPETL DG+VNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETLTDGSVNLMVWHCTIPGKAGTDWEGGYFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  132  TDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>gb|ABG79538.1| putative E2 SUMO conjugating enzyme [Triticum turgidum subsp. 
durum]
Length=161

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  23   PHGFVAKPETLGDGTVNLMVWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPTN  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  83   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  142

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  143  PAEYKRRVRAQAKQYPALV  161



>ref|XP_010919083.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Elaeis guineensis]
Length=160

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DG+VNLMVW+C IPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLHDGSVNLMVWNCIIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPL+
Sbjct  142  PAEYKRRVRQQAKQYPPLI  160



>ref|XP_010524335.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Tarenaya hassleriana]
Length=160

 Score =   268 bits (685),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDGT NLMVW CTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETSPDGTCNLMVWQCTIPGKPGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  142  PAEYKRRVRQQAKQYPPIL  160



>ref|XP_009599931.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   268 bits (685),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DG+VNLMVWHCTIPGK GTDWEGG YPLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLTDGSVNLMVWHCTIPGKTGTDWEGGYYPLTIHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLDQPNPADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDQPNPADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             +EY++RVR Q+KQYPP+V
Sbjct  142  ALEYRKRVRLQSKQYPPIV  160



>ref|XP_009390474.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=160

 Score =   268 bits (685),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLM+WHCTIPGK GTDWEGG +PLT++FSEDYPSKPPKC+FPQ 
Sbjct  22   PHGFVAKPETLADGTVNLMIWHCTIPGKPGTDWEGGYFPLTLYFSEDYPSKPPKCRFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY+RRVRQQAKQYP LV
Sbjct  142  LEEYRRRVRQQAKQYPALV  160



>ref|XP_009606595.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   268 bits (684),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVWHC+IPGK GTDWEGG YP+TMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGPDGSVNLMVWHCSIPGKTGTDWEGGFYPITMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP DPAQT+GY L++QD
Sbjct  82   FFHPNIYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPNDPAQTDGYQLYMQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYKRRVRQQAKQYP L+
Sbjct  142  TAEYKRRVRQQAKQYPALI  160



>ref|XP_006402833.1| hypothetical protein EUTSA_v10006282mg [Eutrema salsugineum]
 gb|ESQ44286.1| hypothetical protein EUTSA_v10006282mg [Eutrema salsugineum]
Length=160

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GYHLFIQD  EYK+RV+ Q+KQYPP+V
Sbjct  131  QTDGYHLFIQDAAEYKKRVKLQSKQYPPIV  160



>ref|XP_009104077.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brassica rapa]
 emb|CDX98253.1| BnaC06g16140D [Brassica napus]
 emb|CDX67711.1| BnaA07g17510D [Brassica napus]
Length=160

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  132  TDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>gb|KFK35081.1| hypothetical protein AALP_AA5G232800 [Arabis alpina]
Length=160

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  131  QTDGYHLFIQDPVEYKKRVKLQSKQYPPVV  160



>gb|EMS60436.1| SUMO-conjugating enzyme SCE1 [Triticum urartu]
Length=161

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  23   PHGFVAKPETLGDGTVNLMVWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPTN  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  83   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  142

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  143  PAEYKRRVRVQAKQYPALV  161



>gb|ACG45477.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
Length=160

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPE+LPDGTVNLM+W CTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPESLPDGTVNLMIWQCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP DPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPVDPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  142  PTEYKRRVRLQAKQYPALV  160



>ref|XP_004983815.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
Length=160

 Score =   266 bits (680),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PETL DG+ NLM+W+CTIPGK GTDWEGG YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPETLADGSANLMIWNCTIPGKQGTDWEGGYYPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  142  PAEYKRRVRLQAKQYPALV  160



>ref|XP_006855190.1| hypothetical protein AMTR_s00051p00153990 [Amborella trichopoda]
 gb|ERN16657.1| hypothetical protein AMTR_s00051p00153990 [Amborella trichopoda]
Length=160

 Score =   266 bits (679),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVW CTIPGK  TDWEGG +P+T+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLPDGSVNLMVWQCTIPGKQATDWEGGYFPITLHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPL+
Sbjct  142  PAEYKRRVRQQAKQYPPLL  160



>ref|NP_001065167.1| Os10g0536000 [Oryza sativa Japonica Group]
 gb|AAL58113.1|AC092697_1 putative ubiquitin-conjugating enzyme [Oryza sativa Japonica 
Group]
 gb|AAP54809.1| Ubiquitin-conjugating enzyme E2 I, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27081.1| Os10g0536000 [Oryza sativa Japonica Group]
 dbj|BAG97144.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00378.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67364.1| hypothetical protein OsI_34467 [Oryza sativa Indica Group]
 gb|EEE51317.1| hypothetical protein OsJ_32281 [Oryza sativa Japonica Group]
Length=160

 Score =   266 bits (679),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET+ DG+ NLM+WHCTIPGK GTDWEGG YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETMADGSANLMIWHCTIPGKQGTDWEGGYYPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYH+FIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHIFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP L+
Sbjct  142  KPEYKRRVRVQAKQYPALL  160



>ref|XP_009793052.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana sylvestris]
Length=160

 Score =   265 bits (678),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVWHC+IPGK GTDWEGG YP+TMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGPDGSVNLMVWHCSIPGKTGTDWEGGFYPITMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP DPAQT+GY L++QD
Sbjct  82   FFHPNIYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPNDPAQTDGYQLYMQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYKRRVR QAKQYP L+
Sbjct  142  TAEYKRRVRHQAKQYPALI  160



>ref|XP_006291969.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
 gb|EOA24867.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
Length=160

 Score =   265 bits (678),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GYHLF QD VEYK+RV+ Q+KQYPP+V
Sbjct  131  QTDGYHLFCQDPVEYKKRVKLQSKQYPPIV  160



>ref|XP_009116485.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brassica rapa]
Length=160

 Score =   265 bits (678),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET  DG+VNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGTDGSVNLMVWHCTIPGKAGTDWEGGYFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  132  TDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>ref|XP_002465018.1| hypothetical protein SORBIDRAFT_01g030580 [Sorghum bicolor]
 gb|EER92016.1| hypothetical protein SORBIDRAFT_01g030580 [Sorghum bicolor]
Length=160

 Score =   265 bits (676),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PETL DG+ NLMVW+CTIPGK GTDWE G YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPETLADGSANLMVWNCTIPGKQGTDWESGYYPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  142  PAEYKRRVRLQAKQYPALV  160



>dbj|BAJ86881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET+ DG+VNLM+W+CTIPGK GTDWE G YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  23   PHGFVAKPETMADGSVNLMIWNCTIPGKQGTDWESGYYPLTLHFSEDYPSKPPKCKFPQG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  83   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  142

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY+RR+R QAKQYP LV
Sbjct  143  PAEYRRRIRLQAKQYPALV  161



>ref|XP_008657947.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Zea mays]
 tpg|DAA46073.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=160

 Score =   264 bits (675),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PETL DG+ NLMVW CTIPGK GTDWE G YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPETLADGSANLMVWSCTIPGKQGTDWESGYYPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  142  PTEYKRRVRLQAKQYPALV  160



>emb|CDX71988.1| BnaC08g28860D [Brassica napus]
Length=160

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET  DG+VNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGSDGSVNLMVWHCTIPGKAGTDWEGGYFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAI VKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAIAVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  132  TDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>ref|XP_003574257.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brachypodium distachyon]
Length=161

 Score =   263 bits (673),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET+ DG+VNLMVWHCTIPGK GTDWEGG +PLT+ FSEDYPSKPPKCKFPQ 
Sbjct  23   PHGFVAKPETVADGSVNLMVWHCTIPGKQGTDWEGGYFPLTLQFSEDYPSKPPKCKFPQN  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  83   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  142

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVR QAKQYP L+
Sbjct  143  PAEYKKRVRLQAKQYPALI  161



>ref|XP_009771488.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana sylvestris]
Length=160

 Score =   263 bits (673),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLMVWHC+IPGK  TDWEGG+YPLTMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGADGSVNLMVWHCSIPGKPATDWEGGHYPLTMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP DPAQT+GY L++QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPNDPAQTDGYQLYMQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYKRRV+QQAKQYP L+
Sbjct  142  TAEYKRRVKQQAKQYPALL  160



>ref|XP_008660103.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Zea mays]
 gb|AFW88190.1| putative ubiquitin-conjugating enzyme family isoform 1 [Zea mays]
 gb|AFW88191.1| putative ubiquitin-conjugating enzyme family isoform 2 [Zea mays]
Length=160

 Score =   263 bits (672),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PE+L DG+VNLMVW+CTIPGK GTDWEGG YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPESLTDGSVNLMVWNCTIPGKHGTDWEGGYYPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDS WRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSDWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP LV
Sbjct  142  PAEYKRRVRLQAKQYPALV  160



>gb|ABK23443.1| unknown [Picea sitchensis]
Length=160

 Score =   263 bits (672),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+P+T PDG++NLMVW C IPGK+GTDWEGG +PLT++FSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPDTQPDGSLNLMVWQCIIPGKSGTDWEGGYFPLTINFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLDQPNP DPAQT+GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDQPNPGDPAQTDGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPPLV
Sbjct  142  LTEYKRRVRQQAKQYPPLV  160



>ref|XP_010504726.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Camelina sativa]
Length=160

 Score =   263 bits (672),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GYHLF QD VEYK+RV+ Q+KQYP +V
Sbjct  131  QTDGYHLFCQDPVEYKKRVKLQSKQYPAIV  160



>ref|XP_010516423.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Camelina sativa]
Length=160

 Score =   263 bits (672),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLF QD VEYK+RV+ Q+KQYP +V
Sbjct  132  TDGYHLFCQDPVEYKKRVKLQSKQYPAIV  160



>ref|XP_006662001.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Oryza brachyantha]
Length=160

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+ NLMVWHC IPGK GTDWEGG YP+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETTADGSANLMVWHCAIPGKQGTDWEGGYYPVTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GYH+FIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHIFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR QAKQYP L+
Sbjct  142  KPEYKRRVRMQAKQYPALL  160



>gb|EPS61715.1| ubiquitin carrier protein [Genlisea aurea]
Length=160

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP+TLPDG++NLMVW C IPGK GTDW+GG +PLTMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPDTLPDGSLNLMVWQCIIPGKPGTDWDGGYFPLTMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNP DPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDSPNPNDPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
             VEYK+RVR QAKQYP +V
Sbjct  142  PVEYKKRVRSQAKQYPSIV  160



>ref|NP_191346.1| SUMO-conjugating enzyme SCE1 [Arabidopsis thaliana]
 ref|XP_002878176.1| hypothetical protein ARALYDRAFT_486239 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q42551.1|SCE1_ARATH RecName: Full=SUMO-conjugating enzyme SCE1; AltName: Full=Protein 
EMBRYO DEFECTIVE 1637; AltName: Full=Protein hus5 homolog; 
AltName: Full=SUMO-conjugating enzyme 1; Short=AtSCE1 [Arabidopsis 
thaliana]
 gb|AAA86642.1| ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AAC64116.1| E2 ubiquitin-conjugating-like enzyme [Arabidopsis thaliana]
 emb|CAB67615.1| E2 ubiquitin-conjugating-like enzyme Ahus5 [Arabidopsis thaliana]
 gb|AAK68778.1| E2 ubiquitin-conjugating-like enzyme Ahus5 [Arabidopsis thaliana]
 gb|AAO30040.1| E2 ubiquitin-conjugating-like enzyme Ahus5 [Arabidopsis thaliana]
 gb|EFH54435.1| hypothetical protein ARALYDRAFT_486239 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE79711.1| SUMO-conjugating enzyme SCE1 [Arabidopsis thaliana]
Length=160

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 133/150 (89%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET  DGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETGQDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GYHLF QD VEYK+RV+ Q+KQYP LV
Sbjct  131  QTDGYHLFCQDPVEYKKRVKLQSKQYPALV  160



>ref|XP_010427677.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Camelina sativa]
Length=160

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYPS
Sbjct  14   RKSWR--KNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPAQ
Sbjct  72   KPPKCKFPTGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPAQ  131

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GYHLF QD VEYK+RV+ Q+KQYP +V
Sbjct  132  TDGYHLFCQDPVEYKKRVKLQSKQYPAIV  160



>ref|XP_009417521.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DGTVNLMVWHC IPGK GTDWEGG+YPLT+HFSEDYPSKPPKC+FPQ 
Sbjct  22   PHGFVAKPETSADGTVNLMVWHCIIPGKQGTDWEGGHYPLTLHFSEDYPSKPPKCRFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAIT KQILVGIQDLLD+PNPADPAQ +G+ LFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITAKQILVGIQDLLDRPNPADPAQVDGHQLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY+RRVRQQAKQYP L+
Sbjct  142  LSEYRRRVRQQAKQYPALI  160



>ref|XP_007223632.1| hypothetical protein PRUPE_ppa012638mg [Prunus persica]
 gb|EMJ24831.1| hypothetical protein PRUPE_ppa012638mg [Prunus persica]
Length=160

 Score =   261 bits (666),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG +NLM+W C IPGK+ TDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGPDGAINLMIWQCIIPGKSSTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  142  PAEYKRRVRQQAKQYPPVL  160



>gb|EMS55983.1| SUMO-conjugating enzyme SCE1 [Triticum urartu]
Length=140

 Score =   259 bits (663),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  82   GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  261
            GFVAKPET+ DG+VNLM+W+CTIPGK GTDWE G YPLT+HFSEDYPSKPPKCKFPQ FF
Sbjct  4    GFVAKPETVADGSVNLMIWNCTIPGKQGTDWESGYYPLTLHFSEDYPSKPPKCKFPQGFF  63

Query  262  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  441
            HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD  
Sbjct  64   HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQDPA  123

Query  442  EYKRRVRQQAKQYPPLV  492
            EYKRR+R QAKQYP LV
Sbjct  124  EYKRRIRLQAKQYPALV  140



>ref|XP_006354854.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
Length=160

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDGTVNLMVW C+IPGK  TDWEGG+YP+TMHFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETGPDGTVNLMVWQCSIPGKPSTDWEGGHYPITMHFSEDYPSKPPKCKFPAG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP DPAQTEGY L++QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPDDPAQTEGYQLYMQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYK+RV+QQAKQYP L+
Sbjct  142  TDEYKKRVKQQAKQYPALL  160



>ref|XP_004291083.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Fragaria vesca 
subsp. vesca]
Length=160

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET PDG+VNLMVW C IPGKA TDWEGGNYPLT+ FSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPETGPDGSVNLMVWQCLIPGKASTDWEGGNYPLTLQFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLDQPN ADPAQTEGY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQDLLDQPNAADPAQTEGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRV+QQAKQYP ++
Sbjct  142  PAEYKRRVKQQAKQYPSVI  160



>ref|XP_008220257.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Prunus mume]
Length=160

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG ++LM+W C IPGK+ TDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGPDGAIDLMIWQCIIPGKSSTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  142  PAEYKRRVRQQAKQYPPVL  160



>ref|XP_009620476.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLM+WHC+IPGK  TDWE G+YPLTMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETGADGSVNLMIWHCSIPGKPATDWEDGHYPLTMHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP DPAQT+GY L++QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPNDPAQTDGYQLYMQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYKRRV+QQAK YP L+
Sbjct  142  TAEYKRRVKQQAKLYPALL  160



>ref|XP_004252754.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum lycopersicum]
Length=160

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET  DG+VNLMVWHC+IPGKA TDWEGG YP+TM+FSED+PSKPPKCKFPQ 
Sbjct  22   PHGFVARPETGADGSVNLMVWHCSIPGKAKTDWEGGFYPITMYFSEDFPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP+DPAQTEGY L++QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPSDPAQTEGYQLYMQD  141

Query  436  TVEYKRRVRQQAKQYP  483
              EYK+RVRQQAKQYP
Sbjct  142  GAEYKKRVRQQAKQYP  157



>ref|XP_006402394.1| hypothetical protein EUTSA_v10006281mg [Eutrema salsugineum]
 gb|ESQ43847.1| hypothetical protein EUTSA_v10006281mg [Eutrema salsugineum]
Length=160

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PH FVAKPET  DGT NLMVW C IPGK+GTDWEGG YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHAFVAKPETSSDGTNNLMVWQCIIPGKSGTDWEGGFYPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD+PNP DPAQTEGY LF+QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDEPNPNDPAQTEGYQLFVQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKR+VRQQAKQYPP++
Sbjct  142  KTEYKRKVRQQAKQYPPIL  160



>ref|XP_008378017.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Malus domestica]
Length=160

 Score =   256 bits (654),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVW C IPGK  TDWEGG +PLT++F+EDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETAPDGSVNLMVWQCIIPGKPSTDWEGGYFPLTLNFTEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLL QPNPADPAQTEGY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQDLLGQPNPADPAQTEGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  142  PAEYKRRVRQQAKQYPPVI  160



>gb|KDO84093.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
 gb|KDO84094.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
 gb|KDO84095.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=160

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ 
Sbjct  23   PHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  142  PAEYKRRVRQQAKQYPPVI  160



>ref|XP_010679521.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Beta vulgaris subsp. 
vulgaris]
Length=160

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP+T  DG++NL+VW C IPGKAGTDWEGG YPLTM+FSE+YPSKPPKCKFP  
Sbjct  22   PHGFVAKPDTQADGSMNLLVWQCIIPGKAGTDWEGGYYPLTMYFSEEYPSKPPKCKFPAG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED  WRPAITVKQILVGIQDLLDQPN ADPAQTEGYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDCDWRPAITVKQILVGIQDLLDQPNAADPAQTEGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYKRRVRQQAKQYP  +
Sbjct  142  TTEYKRRVRQQAKQYPATI  160



>ref|XP_006473285.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006473286.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Citrus 
sinensis]
Length=159

 Score =   255 bits (652),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQG  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQD
Sbjct  81   FFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQD  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  141  PAEYKRRVRQQAKQYPPVI  159



>ref|XP_001768256.1| predicted protein [Physcomitrella patens]
 gb|EDQ66870.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   255 bits (651),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET  DG +NLMVW CT+PGK GTDWEGG YP+ +HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPETGADGALNLMVWQCTLPGKVGTDWEGGFYPVAIHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ+LLD PNPADPAQTE Y LFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQELLDAPNPADPAQTEAYQLFIQD  141

Query  436  TVEYKRRVRQQAKQYPP  486
             VEYKRRVRQQAKQYPP
Sbjct  142  PVEYKRRVRQQAKQYPP  158



>ref|XP_004238134.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Solanum lycopersicum]
Length=160

 Score =   255 bits (651),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVW C+IPGK  TDWEGG+YP+TMHFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETGPDGSVNLMVWQCSIPGKPSTDWEGGHYPVTMHFSEDYPSKPPKCKFPAG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP DPAQT+GY L++QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPDDPAQTDGYQLYMQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RV+QQAKQYP L+
Sbjct  142  EFEYKKRVKQQAKQYPALL  160



>ref|XP_006434720.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
 gb|ESR47960.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
Length=160

 Score =   255 bits (651),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ 
Sbjct  23   PHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  142  PAEYKRRVRQQAKQYPPVL  160



>ref|XP_010523001.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Tarenaya hassleriana]
Length=160

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPETLPDGT NLMVW C IPGK+GTDWEGG YPLT+HFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETLPDGTNNLMVWQCIIPGKSGTDWEGGFYPLTLHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD+PNP DPA
Sbjct  71   SKPPKCKFPPGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDEPNPNDPA  130

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GY L++QD  EY++RV+QQAKQYPP++
Sbjct  131  QTDGYQLYVQDREEYRKRVKQQAKQYPPII  160



>ref|XP_001776874.1| predicted protein [Physcomitrella patens]
 gb|EDQ58277.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET  DG +NLMVW CT+PGK GTDWEGG YP+ +HF+EDYPSKPPKCKFPQ 
Sbjct  22   PHGFVARPETCADGALNLMVWQCTLPGKVGTDWEGGFYPVAIHFTEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ+LLD PNPADPAQTE Y LFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQELLDAPNPADPAQTEAYQLFIQD  141

Query  436  TVEYKRRVRQQAKQYPP  486
             VEYKRRVRQQAKQYPP
Sbjct  142  PVEYKRRVRQQAKQYPP  158



>ref|XP_011069737.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Sesamum indicum]
Length=160

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVWHC IPGKA T+WEGG YPLTMHFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETSPDGSVNLMVWHCIIPGKANTEWEGGFYPLTMHFSEDYPSKPPKCKFPQN  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLDQPNP DPAQT+GY L++Q+
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDQPNPNDPAQTDGYQLYMQE  141

Query  436  TVEYKRRVRQQAKQYP  483
              EY RRVRQQAKQYP
Sbjct  142  RDEYWRRVRQQAKQYP  157



>ref|XP_009390473.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=186

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 132/165 (80%), Gaps = 26/165 (16%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETL DGTVNLM+WHCTIPGK GTDWEGG +PLT++FSEDYPSKPPKC+FPQ 
Sbjct  22   PHGFVAKPETLADGTVNLMIWHCTIPGKPGTDWEGGYFPLTLYFSEDYPSKPPKCRFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDS--------------------------GWRPAITVKQILV  357
            FFHPNVYPSGTVCLSILNEDS                          GWRPAITVKQILV
Sbjct  82   FFHPNVYPSGTVCLSILNEDSVSYCCKPSSLAYVAVKCVMTCLCHMQGWRPAITVKQILV  141

Query  358  GIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            GIQDLLDQPNPADPAQT+GYHLFIQD  EY+RRVRQQAKQYP LV
Sbjct  142  GIQDLLDQPNPADPAQTDGYHLFIQDLEEYRRRVRQQAKQYPALV  186



>ref|XP_006342638.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
Length=160

 Score =   253 bits (646),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET  DG+VNLMVW+C+IPGKA TDWEGG YP+TM+FSED+PSKPPKCKFPQ 
Sbjct  22   PHGFVARPETGADGSVNLMVWNCSIPGKAKTDWEGGFYPITMNFSEDFPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGT+CLSILNEDSGWRPAITVKQILVGIQDLL QPNP+DPAQTEG+ L++QD
Sbjct  82   FFHPNVYPSGTICLSILNEDSGWRPAITVKQILVGIQDLLVQPNPSDPAQTEGFQLYMQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVRQQAKQYP LV
Sbjct  142  GAEYKKRVRQQAKQYPALV  160



>gb|AEI83503.1| ubiquitin-conjugating enzyme E2 I [Wolffia arrhiza]
Length=160

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PETLPDG+VNLM+W C IPGK GTDW+GG +P+T+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVARPETLPDGSVNLMIWQCLIPGKQGTDWDGGFFPITLHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNED GWRPAITVKQIL GIQDLLDQPNPADPAQTEGY LFIQD
Sbjct  82   FFHPNIYPSGTVCLSILNEDKGWRPAITVKQILTGIQDLLDQPNPADPAQTEGYQLFIQD  141

Query  436  TVEYKRRVRQQAKQYP  483
              EYKRRVR QAKQYP
Sbjct  142  PTEYKRRVRLQAKQYP  157



>emb|CDX93982.1| BnaC04g21410D [Brassica napus]
Length=160

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PH FVAKPET  DGT NLMVW C IPGK+GTDWEGG YPLT++FSEDYPSKPPKCKFPQ 
Sbjct  22   PHAFVAKPETSSDGTNNLMVWQCIIPGKSGTDWEGGFYPLTLNFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD+PNP DPAQTEGY LF+QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDEPNPNDPAQTEGYQLFVQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRV+QQAKQYP +V
Sbjct  142  KNEYKRRVKQQAKQYPTVV  160



>ref|XP_008393782.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Malus domestica]
Length=160

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLMVW C IPGK  TDWEGG +PLT++FSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETASDGSVNLMVWLCIIPGKPSTDWEGGYFPLTLNFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLL QPNPADPAQ EGY LFIQ+
Sbjct  82   FFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQDLLGQPNPADPAQAEGYQLFIQE  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP++
Sbjct  142  PAEYKRRVRQQAKQYPPVL  160



>ref|XP_009138734.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brassica rapa]
 emb|CDY66302.1| BnaA04g27280D [Brassica napus]
Length=160

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PH FVAKPET  DGT NLMVW C IPGK+GTDWEGG YPLT++FSEDYPSKPPKCKFPQ 
Sbjct  22   PHAFVAKPETSSDGTNNLMVWQCIIPGKSGTDWEGGFYPLTLNFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD+PNP DPAQTEGY LF+QD
Sbjct  82   FFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDEPNPNDPAQTEGYQLFVQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRV+QQAKQYP ++
Sbjct  142  KNEYKRRVKQQAKQYPTVL  160



>ref|XP_011029476.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Populus euphratica]
Length=161

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +1

Query  37   VVSRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSED  216
            +   R +R G   PHGFVAKP+   DGT++LMVW C IPGK GTDWEGG +PLT+HFSED
Sbjct  11   LAEERKSR-GKNHPHGFVAKPDNAQDGTLDLMVWKCIIPGKPGTDWEGGFFPLTLHFSED  69

Query  217  YPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPAD  396
            YPSKPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLDQPNPAD
Sbjct  70   YPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDQPNPAD  129

Query  397  PAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            PAQT+GY LF+QD  EY+R+VRQQAKQYPP +
Sbjct  130  PAQTDGYQLFVQDPTEYRRKVRQQAKQYPPAL  161



>gb|ABK23228.1| unknown [Picea sitchensis]
 gb|ABK26454.1| unknown [Picea sitchensis]
Length=160

 Score =   250 bits (639),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET  DG++NLMVW C +PGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVARPETQQDGSLNLMVWQCILPGKPGTDWEGGYFPLTIHFSEDYPSKPPKCKFPTG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLDQPNP+DPAQT+ Y LFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDQPNPSDPAQTDAYQLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP V
Sbjct  142  PPEYKRRVRQQAKQYPPPV  160



>gb|AAB63513.1| ubiquitin-conjugating enzyme [Prunus armeniaca]
Length=126

 Score =   249 bits (635),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  115  GTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVC  294
            GTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVC
Sbjct  1    GTVNLMVWHCTIPGKTGTDWEGGFFPLTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVC  60

Query  295  LSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAK  474
            LSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  EYK+RVRQQAK
Sbjct  61   LSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDATEYKKRVRQQAK  120

Query  475  QYPPLV  492
            QYPPLV
Sbjct  121  QYPPLV  126



>ref|XP_002980875.1| SUMO-conjugating enzyme 1a [Selaginella moellendorffii]
 gb|EFJ18060.1| SUMO-conjugating enzyme 1a [Selaginella moellendorffii]
Length=160

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET PDG+VNLM WHCT+PGKAGTDWEGG +PL +HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVARPETQPDGSVNLMTWHCTLPGKAGTDWEGGYFPLAIHFSEDYPSKPPKCKFPPN  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQ+LLD PN ADPAQ++ Y +FIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQELLDAPNAADPAQSDAYQMFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAK YPP V
Sbjct  142  RDEYKRRVRQQAKLYPPPV  160


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 44/106 (42%), Gaps = 20/106 (19%)
 Frame = +3

Query  15   MLGGIARGRLAEERKAWRKNPPWFRGKAGDTPRWYRQPDGVALHYSWK-------GRD*L  173
            M GGIARGRLAEERKAWRKN P      G   R   QPDG     +W        G D  
Sbjct  1    MSGGIARGRLAEERKAWRKNHP-----HGFVARPETQPDGSVNLMTWHCTLPGKAGTDWE  55

Query  174  GRW*LPANNALQRRLPKQTAKVQISPGVFPPK-------CLSFRNS  290
            G +  P         P +  K +  P  F P        CLS  N 
Sbjct  56   GGY-FPLAIHFSEDYPSKPPKCKFPPNFFHPNVYPSGTVCLSILNE  100



>ref|XP_006374899.1| hypothetical protein POPTR_0014s02500g [Populus trichocarpa]
 gb|ABK95631.1| unknown [Populus trichocarpa]
 gb|ERP52696.1| hypothetical protein POPTR_0014s02500g [Populus trichocarpa]
Length=161

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKP+   DG+++LMVW C IPGK GTDWEGG +PL++HFSEDYPS
Sbjct  15   RKSWR--KNHPHGFVAKPDNAQDGSLDLMVWKCIIPGKPGTDWEGGFFPLSLHFSEDYPS  72

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLDQPNP+DPAQ
Sbjct  73   KPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDQPNPSDPAQ  132

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            T+GY LF+QD  EY+RRVRQQAKQYPP +
Sbjct  133  TDGYQLFVQDPTEYRRRVRQQAKQYPPAL  161



>ref|XP_002301168.1| hypothetical protein POPTR_0002s12510g [Populus trichocarpa]
 gb|ABK94802.1| unknown [Populus trichocarpa]
 gb|ABK96193.1| unknown [Populus trichocarpa]
 gb|EEE80441.1| hypothetical protein POPTR_0002s12510g [Populus trichocarpa]
Length=161

 Score =   248 bits (634),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP+  PDG+++LM+W C IPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  23   PHGFVAKPDNAPDGSLDLMMWKCIIPGKPGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQIL+GIQDLLDQPNP+DPAQT+GY LF+QD
Sbjct  83   FFHPNVYPSGTVCLSILNEDYGWRPAITVKQILIGIQDLLDQPNPSDPAQTDGYQLFVQD  142

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY+RRVRQQAK YPP +
Sbjct  143  PAEYRRRVRQQAKLYPPTL  161



>gb|ACA04892.1| putative ubiquitin-conjugating enzyme E2 I protein [Picea abies]
Length=143

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET  DG++NLMVW C +PGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  
Sbjct  5    PHGFVARPETQQDGSLNLMVWQCILPGKPGTDWEGGYFPLTIHFSEDYPSKPPKCKFPTG  64

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLDQPNP+D AQT+ Y LFIQD
Sbjct  65   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDQPNPSDXAQTDAYQLFIQD  124

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVRQQAKQYPP V
Sbjct  125  PPEYKRRVRQQAKQYPPPV  143



>gb|AFK49150.1| unknown [Lotus japonicus]
Length=122

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  127  LMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSIL  306
            +MVWHCTIPGK GTDWE G YPLTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSIL
Sbjct  1    MMVWHCTIPGKTGTDWENGYYPLTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSIL  60

Query  307  NEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  486
            NEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPP
Sbjct  61   NEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDATEYKRRVRQQAKQYPP  120

Query  487  LV  492
            LV
Sbjct  121  LV  122



>ref|XP_011017169.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Populus euphratica]
Length=161

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP+  PDG+++LM+W C IPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  23   PHGFVAKPDNAPDGSLDLMMWKCIIPGKPGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED GWRPAITVKQIL+GIQDLLDQPNP+DP QT+GY LF+QD
Sbjct  83   FFHPNVYPSGTVCLSILNEDYGWRPAITVKQILIGIQDLLDQPNPSDPGQTDGYQLFVQD  142

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY+RRVRQQAK YPP +
Sbjct  143  PAEYRRRVRQQAKLYPPTL  161



>ref|XP_006374896.1| hypothetical protein POPTR_0014s02480g [Populus trichocarpa]
 gb|ERP52693.1| hypothetical protein POPTR_0014s02480g [Populus trichocarpa]
Length=161

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKP+   DG+++LMVW C IPGK GTDWEGG +PLT+HFSEDYP
Sbjct  14   ERKSWR--KNHPHGFVAKPDNAQDGSLDLMVWKCIIPGKPGTDWEGGFFPLTLHFSEDYP  71

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLDQPNPADPA
Sbjct  72   SKPPKCKFPPGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDQPNPADPA  131

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GY LF+QD  EY+R+VRQQAKQYPP +
Sbjct  132  QTDGYQLFVQDPTEYRRKVRQQAKQYPPAL  161



>ref|XP_010094645.1| Serine palmitoyltransferase 1 [Morus notabilis]
 gb|EXB56496.1| Serine palmitoyltransferase 1 [Morus notabilis]
Length=603

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 137/174 (79%), Gaps = 17/174 (10%)
 Frame = +1

Query  22   EELLAVVSRRSARPGAKTP-----------------HGFVAKPETLPDGTVNLMVWHCTI  150
            + +  V S+RSA    + P                  GFVAKPET PDG+VNLMVW C I
Sbjct  430  DSVFVVTSKRSALDKCRLPVGIRLFVSAGHSESDLVKGFVAKPETAPDGSVNLMVWQCII  489

Query  151  PGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRP  330
            PGK GTDWEGG +PLT+HFSEDYPSKPPKC+FP  FFHPNVYPSGTVCLSIL+EDSGWRP
Sbjct  490  PGKPGTDWEGGYFPLTLHFSEDYPSKPPKCRFPPGFFHPNVYPSGTVCLSILSEDSGWRP  549

Query  331  AITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            AITVKQILVGIQDLLDQPNPADPAQT+GY LFIQ+ VEYKRRVRQQAKQYP ++
Sbjct  550  AITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQEPVEYKRRVRQQAKQYPQII  603



>ref|XP_011029489.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Populus euphratica]
Length=161

 Score =   245 bits (626),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKP+   DG+++LMVW C IPGK GTDWEGG +PLT+HFSEDYP
Sbjct  14   ERKSWR--KNHPHGFVAKPDNAQDGSLDLMVWKCIIPGKPGTDWEGGFFPLTLHFSEDYP  71

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLDQPNP+DPA
Sbjct  72   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDQPNPSDPA  131

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QT+GY LF+QD  EY+R  RQQAKQYPP +
Sbjct  132  QTDGYQLFVQDPTEYRRTERQQAKQYPPTI  161



>gb|ABG66220.1| Ubiquitin-conjugating enzyme E2 I, putative, expressed [Oryza 
sativa Japonica Group]
Length=129

 Score =   244 bits (623),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  106  LPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSG  285
            + DG+ NLM+WHCTIPGK GTDWEGG YPLT+HFSEDYPSKPPKCKFPQ FFHPNVYPSG
Sbjct  1    MADGSANLMIWHCTIPGKQGTDWEGGYYPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSG  60

Query  286  TVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQ  465
            TVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYH+FIQD  EYKRRVR 
Sbjct  61   TVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHIFIQDKPEYKRRVRV  120

Query  466  QAKQYPPLV  492
            QAKQYP L+
Sbjct  121  QAKQYPALL  129



>ref|XP_008344316.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Malus domestica]
Length=160

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTI  K  TDW+GG +P T+HFSEDYPSKPPKCKFP  
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIXXKTXTDWDGGFFPXTLHFSEDYPSKPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNED G RP ITVKQILVGIQDL+DQPN  DPAQ  GYHLFIQD
Sbjct  82   FFHPNVYPSGTVCLSILNEDXGLRPXITVKQILVGIQDLMDQPNXXDPAQXXGYHLFIQD  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK+RVR Q+KQYPPLV
Sbjct  142  ATEYKKRVRXQSKQYPPLV  160



>gb|EYU25458.1| hypothetical protein MIMGU_mgv11b023148mg [Erythranthe guttata]
Length=160

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPE+  DG+V+LMVWHC IPGK  TDWEGG YPLTMHFSEDYP KPPKCKFP  
Sbjct  22   PHGFVAKPESGADGSVDLMVWHCLIPGKPNTDWEGGYYPLTMHFSEDYPIKPPKCKFPPN  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD PNP+DPAQT+GY +FIQ+
Sbjct  82   FFHPNIYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDLPNPSDPAQTDGYQIFIQE  141

Query  436  TVEYKRRVRQQAKQYP  483
              EYK+RVRQQAKQYP
Sbjct  142  PDEYKKRVRQQAKQYP  157



>gb|KCW59391.1| hypothetical protein EUGRSUZ_H02096, partial [Eucalyptus grandis]
Length=220

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 120/133 (90%), Gaps = 5/133 (4%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLM+WHC IPGKAGTDWEGG YPLT+HFSEDYPSKPPKCKFPQ 
Sbjct  71   PHGFVAKPETLPDGTVNLMIWHCIIPGKAGTDWEGGFYPLTLHFSEDYPSKPPKCKFPQG  130

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ-  432
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ 
Sbjct  131  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQV  190

Query  433  ----DTVEYKRRV  459
                D   + R V
Sbjct  191  FSFSDAFNFHRSV  203



>ref|XP_002534386.1| ubiquitin-conjugating enzyme E2 I, putative [Ricinus communis]
 gb|EEF27994.1| ubiquitin-conjugating enzyme E2 I, putative [Ricinus communis]
Length=196

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDGTVNLMVWHCTIPGK+GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGTVNLMVWHCTIPGKSGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ 
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQH  141

Query  436  T  438
            T
Sbjct  142  T  142



>ref|XP_007017167.1| Sumo conjugation enzyme 1 isoform 1 [Theobroma cacao]
 gb|EOY14392.1| Sumo conjugation enzyme 1 isoform 1 [Theobroma cacao]
Length=160

 Score =   242 bits (618),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VN+M+WHC IPGK GTDW+GG +PLT+HFSEDYPSKPP CKFPQ 
Sbjct  22   PHGFVAKPETALDGSVNMMLWHCIIPGKKGTDWDGGYFPLTLHFSEDYPSKPPNCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            F HPNVYPSGTVCLSILNED+GW+PAIT+KQILVGIQDLLDQPN +DPAQTEGY L++ +
Sbjct  82   FLHPNVYPSGTVCLSILNEDNGWKPAITIKQILVGIQDLLDQPNASDPAQTEGYQLYVSN  141

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY++RV+QQAKQYPP +
Sbjct  142  LDEYRKRVQQQAKQYPPCL  160



>ref|XP_006425959.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
 gb|ESR39199.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
Length=121

 Score =   241 bits (614),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +1

Query  130  MVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILN  309
            MVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILN
Sbjct  1    MVWHCTIPGKAGTDWEGGFFPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILN  60

Query  310  EDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  489
            ED+GWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYP L
Sbjct  61   EDNGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQYPAL  120

Query  490  V  492
            +
Sbjct  121  L  121



>ref|XP_010317791.1| PREDICTED: SUMO-conjugating enzyme SCE1 isoform X1 [Solanum lycopersicum]
Length=161

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVWHC+IPGK GTDWEGG YP+T+HFSEDYPSKPPKCKFPQ 
Sbjct  22   PHGFVAKPETLPDGSVNLMVWHCSIPGKTGTDWEGGCYPVTIHFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ 
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQS  141

Query  436  TVEY  447
             + +
Sbjct  142  LLVF  145



>ref|XP_004156788.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cucumis sativus]
Length=272

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET+PDGTVNLM+WHC IPGK GTDWEGG +PLT++FSEDYPSKPPKC+FPQ 
Sbjct  22   PHGFVAKPETMPDGTVNLMIWHCIIPGKVGTDWEGGFFPLTLNFSEDYPSKPPKCRFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ  432
            FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ
Sbjct  82   FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ  140



>ref|XP_010059899.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Eucalyptus 
grandis]
Length=159

 Score =   238 bits (606),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 127/149 (85%), Gaps = 3/149 (2%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            RR+ R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGGNYPLT++F+EDYPS
Sbjct  14   RRAWR--KNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTDWEGGNYPLTLYFTEDYPS  71

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            K PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QILVG+QDLL QPNPA PA 
Sbjct  72   KAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQILVGVQDLLHQPNPASPAN  130

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
             + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  131  YDEYELFVKDPAEYQRRVRQQAKQYPPLV  159



>gb|KCW66370.1| hypothetical protein EUGRSUZ_F00190 [Eucalyptus grandis]
Length=204

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 127/149 (85%), Gaps = 3/149 (2%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            RR+ R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGGNYPLT++F+EDYPS
Sbjct  59   RRAWR--KNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTDWEGGNYPLTLYFTEDYPS  116

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            K PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QILVG+QDLL QPNPA PA 
Sbjct  117  KAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQILVGVQDLLHQPNPASPAN  175

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
             + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  176  YDEYELFVKDPAEYQRRVRQQAKQYPPLV  204



>ref|XP_006291970.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
 gb|EOA24868.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
Length=157

 Score =   235 bits (599),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
             R+S R     PHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +PLTMHFSEDYP
Sbjct  13   ERKSWR--KNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYP  70

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            SKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD PNPADPA
Sbjct  71   SKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPA  130

Query  403  QTEGYHLFIQ  432
            QT+GYHLF Q
Sbjct  131  QTDGYHLFCQ  140



>ref|XP_010059898.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Eucalyptus 
grandis]
Length=165

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 9/155 (6%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGT------DWEGGNYPLTMHF  207
            RR+ R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGT      DWEGGNYPLT++F
Sbjct  14   RRAWR--KNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTFFLMQTDWEGGNYPLTLYF  71

Query  208  SEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPN  387
            +EDYPSK PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QILVG+QDLL QPN
Sbjct  72   TEDYPSKAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQILVGVQDLLHQPN  130

Query  388  PADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            PA PA  + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  131  PASPANYDEYELFVKDPAEYQRRVRQQAKQYPPLV  165



>gb|KDO84100.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=121

 Score =   229 bits (583),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +1

Query  130  MVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILN  309
            M+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILN
Sbjct  1    MIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILN  60

Query  310  EDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  489
            ED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP+
Sbjct  61   EDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPV  120

Query  490  V  492
            +
Sbjct  121  I  121



>ref|XP_006434722.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
 gb|ESR47962.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
Length=121

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +1

Query  130  MVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILN  309
            M+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILN
Sbjct  1    MIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILN  60

Query  310  EDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  489
            ED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP+
Sbjct  61   EDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPV  120

Query  490  V  492
            +
Sbjct  121  L  121



>gb|KHG16593.1| SUMO-conjugating enzyme SCE1 -like protein [Gossypium arboreum]
Length=160

 Score =   226 bits (575),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+V+LMVWHC IPGK GTDWEGG +PLT++FSE+YPSKPPKCKFP  
Sbjct  22   PHGFVAKPETRADGSVDLMVWHCVIPGKKGTDWEGGYFPLTLNFSEEYPSKPPKCKFPNG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSG VCLSIL+E  GWRP+ITVKQILVGIQDLLDQPN  D AQTEG+ L++ +
Sbjct  82   FFHPNVYPSGIVCLSILSERRGWRPSITVKQILVGIQDLLDQPNATDAAQTEGHQLYVSN  141

Query  436  TVEYKRRVRQQAKQYP  483
              EY++RV+QQ  QYP
Sbjct  142  PNEYRKRVQQQVLQYP  157



>gb|KJB21461.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21463.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21464.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21466.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21468.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
Length=160

 Score =   226 bits (575),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+V+LMVWHC IPGK GTDWEGG +PLT++FSE+YPSKPPKCKFP  
Sbjct  22   PHGFVAKPETRVDGSVDLMVWHCVIPGKKGTDWEGGYFPLTLNFSEEYPSKPPKCKFPNG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSG VCLSIL+E  GWRP+ITVKQILVGIQDLLDQPN  D AQTEG+ L+I +
Sbjct  82   FFHPNVYPSGIVCLSILSERRGWRPSITVKQILVGIQDLLDQPNATDAAQTEGHQLYISN  141

Query  436  TVEYKRRVRQQAKQYP  483
              EY++RV+QQ  QYP
Sbjct  142  PNEYRKRVQQQVLQYP  157



>ref|XP_010318996.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Solanum 
lycopersicum]
Length=161

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET PDG+ NLM+W C IPGK GTDWEGG+YPLTMHFSEDYPS+PPKCKFP+ 
Sbjct  22   PHGFVARPETGPDGSANLMLWRCIIPGKPGTDWEGGHYPLTMHFSEDYPSQPPKCKFPRG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFI-Q  432
            FFH NVYPSG VCLSILN   GW PAITVKQILVGIQ+LLD+PNP+  AQ+E Y L++ +
Sbjct  82   FFHINVYPSGDVCLSILNTGLGWSPAITVKQILVGIQELLDEPNPSSSAQSECYKLYVKK  141

Query  433  DTVEYKRRVRQQAKQYPPLV  492
            D  EYK+RVR QA QYP L+
Sbjct  142  DKTEYKKRVRAQANQYPALL  161



>gb|KHG25846.1| SUMO-conjugating enzyme SCE1 -like protein [Gossypium arboreum]
Length=160

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP + PDG+VNL+VWHC IPGK GTDWEGG +PLT++FSEDYPSKPP CKFP  
Sbjct  22   PHGFVAKPMSAPDGSVNLLVWHCVIPGKVGTDWEGGYFPLTINFSEDYPSKPPICKFPNG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSG VCLSIL+E  GWRP+ITV QILVGIQDLLDQPN +D AQTEGY L++ +
Sbjct  82   FFHPNVYPSGNVCLSILSERRGWRPSITVTQILVGIQDLLDQPNASDYAQTEGYRLYVSN  141

Query  436  TVEYKRRVRQQAKQYPP  486
               Y+ RV+QQ  QYPP
Sbjct  142  PDLYRERVQQQVLQYPP  158



>gb|KDO84097.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=146

 Score =   220 bits (560),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 111/119 (93%), Gaps = 1/119 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ 
Sbjct  23   PHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ  432
            FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQ
Sbjct  82   FFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQ  140



>ref|XP_002506123.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67381.1| predicted protein [Micromonas sp. RCC299]
Length=157

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET+ DG VNL+ W C+IPG+  T W GG YPLTM FSEDYPSKPPKCKFPQ 
Sbjct  21   PHGFVARPETV-DGAVNLLRWECSIPGRKDTLWAGGFYPLTMEFSEDYPSKPPKCKFPQG  79

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNED GWRP+ITVKQIL+GIQDLLD PNPA PAQ+E Y LF  D
Sbjct  80   FFHPNIYPSGTVCLSILNEDEGWRPSITVKQILMGIQDLLDSPNPASPAQSEAYMLFTND  139

Query  436  TVEYKRRVRQQAKQYPPL  489
              +Y R+V++Q+ +YP L
Sbjct  140  RADYDRKVKEQSLRYPAL  157



>gb|KJB53560.1| hypothetical protein B456_009G214500 [Gossypium raimondii]
Length=160

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP + PDG+VNL+VWHC IPGK GTDWEGG +PLT++FSEDYPSKPP CKFP  
Sbjct  22   PHGFVAKPMSAPDGSVNLLVWHCVIPGKIGTDWEGGYFPLTINFSEDYPSKPPICKFPNG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSG VCLSIL+E  GWRP+ITV QILVGIQDLLDQPN +D AQTEGY +++ +
Sbjct  82   FFHPNVYPSGNVCLSILSERHGWRPSITVTQILVGIQDLLDQPNASDYAQTEGYRVYVSN  141

Query  436  TVEYKRRVRQQAKQYPP  486
               Y++RV+QQ  QYPP
Sbjct  142  PDLYRKRVQQQVLQYPP  158



>ref|XP_009622849.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   219 bits (559),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P+GF+AKPET PDG+VNLMVWHCTIPGK GTDWE G+YPLTMHFSEDYPS+PPKCKFPQ 
Sbjct  22   PYGFMAKPETGPDGSVNLMVWHCTIPGKRGTDWERGHYPLTMHFSEDYPSQPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY SG VCLSILN + GW PAITVKQILVGIQ+LLD+PNP+  AQ+  + L+ QD
Sbjct  82   FFHINVYGSGDVCLSILNPNYGWSPAITVKQILVGIQELLDEPNPSSAAQSYCHKLYTQD  141

Query  436  TVEYKRRVRQQAKQYP  483
              EYKR V++QAK+YP
Sbjct  142  KAEYKRLVKKQAKKYP  157



>ref|XP_011006861.1| PREDICTED: SUMO-conjugating enzyme SCE1 isoform X2 [Populus euphratica]
Length=131

 Score =   216 bits (551),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  142  CTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSG  321
              +P    TDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSG
Sbjct  15   AAVPVNLSTDWEGGYFPLTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSG  74

Query  322  WRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            WRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  EYK+RVRQQAKQYP LV
Sbjct  75   WRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDAAEYKKRVRQQAKQYPSLV  131



>gb|KJB39142.1| hypothetical protein B456_007G216300 [Gossypium raimondii]
 gb|KJB39145.1| hypothetical protein B456_007G216300 [Gossypium raimondii]
Length=112

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  166  TDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVK  345
            TDWEGG +PLT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVK
Sbjct  4    TDWEGGYFPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVK  63

Query  346  QILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QIL+GIQDLLD PNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  64   QILIGIQDLLDAPNPADPAQTEGYHLFIQDANEYKRRVRQQAKQYPPLV  112



>gb|EYU44426.1| hypothetical protein MIMGU_mgv1a0153482mg, partial [Erythranthe 
guttata]
Length=109

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  166  TDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVK  345
            TDWEGG YPL+M FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVK
Sbjct  1    TDWEGGCYPLSMQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVK  60

Query  346  QILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QILVGIQDLLDQPNP+DPAQTEGYHLFIQD+VEYK+RVR QAKQYPPLV
Sbjct  61   QILVGIQDLLDQPNPSDPAQTEGYHLFIQDSVEYKKRVRSQAKQYPPLV  109



>ref|XP_007017168.1| Sumo conjugation enzyme 1 isoform 2 [Theobroma cacao]
 gb|EOY14393.1| Sumo conjugation enzyme 1 isoform 2 [Theobroma cacao]
Length=166

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET  DG+VN+M+WHC IPGK GTDW+GG +PLT+HFSEDYPSKPP CKFPQ 
Sbjct  22   PHGFVAKPETALDGSVNMMLWHCIIPGKKGTDWDGGYFPLTLHFSEDYPSKPPNCKFPQG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            F HPNVYPSGTVCLSILNED+GW+PAIT+KQILVGIQDLLDQPN +DPAQTEGY L++  
Sbjct  82   FLHPNVYPSGTVCLSILNEDNGWKPAITIKQILVGIQDLLDQPNASDPAQTEGYQLYVSM  141

Query  436  TV  441
            ++
Sbjct  142  SI  143



>ref|XP_002448378.1| hypothetical protein SORBIDRAFT_06g026280 [Sorghum bicolor]
 gb|EES12706.1| hypothetical protein SORBIDRAFT_06g026280 [Sorghum bicolor]
Length=159

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP TLPDG+VNLM+W+C +PGK  TDWEGG++PLT+HF+EDYPS+PP CKFP  
Sbjct  23   PHGFVAKPATLPDGSVNLMLWNCIVPGKKDTDWEGGHFPLTLHFTEDYPSRPPDCKFPAG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY +G+VCLSIL +   W+P+ITV+QIL+GIQDLLD PNPA PAQ   Y LF Q+
Sbjct  83   FFHVNVYNTGSVCLSILAD--AWKPSITVRQILIGIQDLLDNPNPASPAQNLCYVLFTQN  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
            T EYK RVRQQAK+YPPLV
Sbjct  141  TPEYKNRVRQQAKRYPPLV  159



>gb|EYU25459.1| hypothetical protein MIMGU_mgv1a015370mg [Erythranthe guttata]
Length=160

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDGTVNLMVW C IPGK+GTDWEGG YPLTMHFSEDYP KPP+CKFP  
Sbjct  22   PHGFVAKPETSPDGTVNLMVWRCVIPGKSGTDWEGGYYPLTMHFSEDYPGKPPECKFPPN  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVY SG+VCLSILNE  GWRP+ITVKQILVGIQDLLD+PNP   A      LF++ 
Sbjct  82   FFHPNVYSSGSVCLSILNEALGWRPSITVKQILVGIQDLLDKPNPDSAAHPYSNQLFLKQ  141

Query  436  TVEYKRRVRQQAKQYP  483
              EYK++V Q AK+YP
Sbjct  142  RDEYKKQVCQLAKRYP  157



>ref|XP_001694849.1| E2 ubiquitin-conjugating-like enzyme [Chlamydomonas reinhardtii]
 gb|EDP02001.1| E2 ubiquitin-conjugating-like enzyme [Chlamydomonas reinhardtii]
Length=159

 Score =   214 bits (545),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GF A+PET  DG+VNLM W C IPGK GTDWEGG YPLTM FSEDYP+KPPKCKFP  
Sbjct  21   PFGFHARPETADDGSVNLMKWKCHIPGKQGTDWEGGFYPLTMEFSEDYPTKPPKCKFPAG  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNED GWRP+IT+KQ+L+GIQ+LLD PNP  PAQ++ + LF Q 
Sbjct  81   FFHPNIYPSGTVCLSILNEDEGWRPSITIKQLLLGIQELLDTPNPGSPAQSDAFVLFTQQ  140

Query  436  TVEYKRRVRQQAKQYPP  486
              EY ++V++QA  YPP
Sbjct  141  KAEYVKKVKRQALNYPP  157



>ref|XP_003056766.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58411.1| predicted protein [Micromonas pusilla CCMP1545]
Length=158

 Score =   213 bits (542),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGF A+P T+ DG+V+++ W C IPGK  TDW GG YPLTM FSEDYPSKPPKCKFP+ 
Sbjct  21   PHGFYARPVTVGDGSVDILKWECQIPGKKDTDWHGGYYPLTMEFSEDYPSKPPKCKFPEK  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNED GWRP+IT+KQIL+GIQ+LL  PN A PAQ+E Y +F  D
Sbjct  81   FFHPNIYPSGTVCLSILNEDDGWRPSITLKQILLGIQELLSTPNSASPAQSEAYMMFTTD  140

Query  436  TVEYKRRVRQQAKQYP  483
              +YK RVRQQA +YP
Sbjct  141  EKQYKIRVRQQAAKYP  156



>ref|XP_002954400.1| hypothetical protein VOLCADRAFT_102189 [Volvox carteri f. nagariensis]
 gb|EFJ44550.1| hypothetical protein VOLCADRAFT_102189 [Volvox carteri f. nagariensis]
Length=159

 Score =   213 bits (542),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GF A+PET  DG++NLM W C IPGK GTDWEGG +PLTM FSEDYP+KPPKCKFP  
Sbjct  21   PFGFHARPETAEDGSINLMKWKCHIPGKQGTDWEGGFFPLTMEFSEDYPTKPPKCKFPAG  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNED GWRP+ITVKQ+L+GIQ+LLD PNP  PAQ++ + L+ Q 
Sbjct  81   FFHPNIYPSGTVCLSILNEDEGWRPSITVKQLLLGIQELLDTPNPNSPAQSDAFLLYTQQ  140

Query  436  TVEYKRRVRQQAKQYPP  486
              EY ++V++QA QYPP
Sbjct  141  KAEYCKKVKRQALQYPP  157



>ref|XP_006344423.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
Length=161

 Score =   212 bits (540),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET PDG+ NLMVW C IPGK GTDWEGG+YPL M FSEDYPS+PPKCKFP  
Sbjct  22   PHGFVARPETGPDGSANLMVWRCIIPGKPGTDWEGGHYPLIMLFSEDYPSQPPKCKFPPG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ-  432
            FFH NVYPSG VCLSILN   GW PAITV QILVGIQ+LLD+PNP+  AQ E + L++Q 
Sbjct  82   FFHINVYPSGDVCLSILNTGLGWSPAITVTQILVGIQELLDEPNPSSSAQFECHKLYVQK  141

Query  433  DTVEYKRRVRQQAKQYPPLV  492
            D  EYK+RV+ QAKQYP L+
Sbjct  142  DKTEYKKRVKAQAKQYPALL  161



>ref|XP_005649108.1| E2 ubiquitin-conjugating-like enzyme [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24564.1| E2 ubiquitin-conjugating-like enzyme [Coccomyxa subellipsoidea 
C-169]
Length=159

 Score =   212 bits (540),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GF A+PET  DG+VNLM W+C IPGK GTDWEGG +PLTM FS++YP+KPPKCKF  +
Sbjct  21   PFGFFARPETAADGSVNLMKWNCHIPGKPGTDWEGGYFPLTMEFSDEYPAKPPKCKFKPS  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNED GWRP+ITVK IL GIQDLLD PNP  PAQ E + +F Q 
Sbjct  81   FFHPNIYPSGTVCLSILNEDEGWRPSITVKNILTGIQDLLDDPNPKSPAQAEAFMMFTQQ  140

Query  436  TVEYKRRVRQQAKQYP  483
             VEY++RV+QQA + P
Sbjct  141  KVEYRKRVKQQALRNP  156



>ref|XP_006368023.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
Length=138

 Score =   211 bits (537),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  166  TDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVK  345
            TDWEGG YPLT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVK
Sbjct  30   TDWEGGCYPLTIHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVK  89

Query  346  QILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QILVGIQDLLDQPNPADPAQTEGYH+FIQD +EY++RVR Q+KQYPPLV
Sbjct  90   QILVGIQDLLDQPNPADPAQTEGYHMFIQDVLEYRKRVRLQSKQYPPLV  138



>gb|EWM21470.1| ubiquitin-conjugating enzyme e2 i [Nannochloropsis gaditana]
Length=160

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+P    DG++NLM W C+IPGK GTDWEGG + +TM FSEDYPSKPPKCKF  A
Sbjct  22   PHGFVARPVLDADGSMNLMSWDCSIPGKEGTDWEGGVFKVTMEFSEDYPSKPPKCKFVPA  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSILNED  WRPAITVKQ+L+GIQDLLD PNP  PAQ + Y LF+ +
Sbjct  82   LFHPNVYPSGTVCLSILNEDEDWRPAITVKQMLLGIQDLLDSPNPESPAQAQAYQLFVTN  141

Query  436  TVEYKRRVRQQAKQYPP  486
              EY+RRVR +AK+  P
Sbjct  142  REEYRRRVRIEAKRNTP  158



>gb|EMT31701.1| Sumo-conjugating enzyme ubc9 [Aegilops tauschii]
Length=173

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  166  TDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVK  345
            TDWEGG +PLT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVK
Sbjct  65   TDWEGGYFPLTLHFSEDYPSKPPKCKFPTNFFHPNVYPSGTVCLSILNEDSGWRPAITVK  124

Query  346  QILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QILVGIQDLLDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  125  QILVGIQDLLDQPNPADPAQTDGYHLFIQDPAEYKRRVRAQAKQYPALV  173



>ref|XP_008668997.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Zea mays]
 tpg|DAA36340.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=159

 Score =   210 bits (534),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGF+AKP TLPDG+VNLM+W+C +PGK GTDWEGG++PLT+HF EDYPS+PP CKFP  
Sbjct  23   PHGFMAKPATLPDGSVNLMLWNCVVPGKQGTDWEGGHFPLTLHFDEDYPSRPPHCKFPAG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY +G+VCLSIL +   W+P+ITV+Q L+GIQDLLD PNPA PAQ   Y LF Q+
Sbjct  83   FFHVNVYNTGSVCLSILGD--AWKPSITVRQTLIGIQDLLDNPNPASPAQNLSYVLFTQN  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EY  RVRQQAK+YP LV
Sbjct  141  MPEYASRVRQQAKRYPSLV  159



>ref|XP_006473287.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X3 [Citrus 
sinensis]
Length=132

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  166  TDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVK  345
            TDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVK
Sbjct  24   TDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVK  83

Query  346  QILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QILVGIQDLLDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  84   QILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI  132



>gb|KDO84096.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=133

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  166  TDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVK  345
            TDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVK
Sbjct  25   TDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVK  84

Query  346  QILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QILVGIQDLLDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  85   QILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI  133



>ref|XP_010059901.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X3 [Eucalyptus 
grandis]
Length=156

 Score =   209 bits (532),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 118/156 (76%), Gaps = 18/156 (12%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGT------DWEGGNYPLTMH  204
             RR+ R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGT      DWEGGNYPLT++
Sbjct  13   ERRAWR--KNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTFFLMQTDWEGGNYPLTLY  70

Query  205  FSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQP  384
            F+EDYPSK PKC FP+ FFH NVY SG           GWRP+ITV+QILVG+QDLL QP
Sbjct  71   FTEDYPSKAPKCMFPKDFFHLNVYGSGM----------GWRPSITVRQILVGVQDLLHQP  120

Query  385  NPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            NPA PA  + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  121  NPASPANYDEYELFVKDPAEYQRRVRQQAKQYPPLV  156



>ref|XP_004242945.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum lycopersicum]
Length=161

 Score =   209 bits (532),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 1/137 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPET PDG+VNLMVWHC IPGK  +DWEGG YP+T+HFSE+YP  PPKCKFPQ 
Sbjct  22   PHGFVAKPETAPDGSVNLMVWHCFIPGKPASDWEGGYYPMTIHFSENYPFMPPKCKFPQG  81

Query  256  FFHPNVYPSGTVCL-SILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ  432
            FFHPNVYPSG VCL S+ N+  GW P ITVK+IL+ I  LLD P+P   AQT+ Y+++IQ
Sbjct  82   FFHPNVYPSGKVCLQSLFNQGHGWSPTITVKEILIAIPYLLDWPSPNYKAQTDSYNMYIQ  141

Query  433  DTVEYKRRVRQQAKQYP  483
            D  EY+RRVRQQA+QYP
Sbjct  142  DNAEYRRRVRQQAEQYP  158



>ref|XP_006434721.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
 gb|ESR47961.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
Length=133

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  166  TDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVK  345
            TDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVK
Sbjct  25   TDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVK  84

Query  346  QILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            QILVGIQDLLDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  85   QILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVL  133



>ref|XP_004976583.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
Length=159

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVW C +PGK GTDWEGG +PLT+ F EDYPS  P CKFP  
Sbjct  23   PHGFVAKPETLPDGSVNLMVWKCVVPGKEGTDWEGGYFPLTLQFPEDYPSNAPVCKFPAG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVYP+G VCLSIL+  + W+P+ITV QIL+GIQDLLD PNPA PAQ   Y L+ +D
Sbjct  83   FFHVNVYPTGAVCLSILS--NAWKPSITVCQILIGIQDLLDHPNPASPAQDACYRLYKKD  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
               YK RVRQQAKQYP LV
Sbjct  141  MRSYKDRVRQQAKQYPSLV  159



>ref|XP_002448377.1| hypothetical protein SORBIDRAFT_06g026270 [Sorghum bicolor]
 gb|EES12705.1| hypothetical protein SORBIDRAFT_06g026270 [Sorghum bicolor]
Length=159

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 2/141 (1%)
 Frame = +1

Query  70   KTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFP  249
            + PHGFVAKP TLPDG+VNLM+W+C +PGK GTDWEGG +PLT+HF+E+YPS PP CKFP
Sbjct  21   RHPHGFVAKPATLPDGSVNLMLWNCVVPGKEGTDWEGGYFPLTLHFTENYPSNPPTCKFP  80

Query  250  QAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFI  429
            + FFH NVY SG VCLSIL +   W P+ITV QIL+GIQ+LLD PNPA PAQ   Y +F 
Sbjct  81   RRFFHVNVYDSGDVCLSILGD--AWAPSITVPQILIGIQELLDNPNPASPAQDFAYDVFA  138

Query  430  QDTVEYKRRVRQQAKQYPPLV  492
            ++  EYKRRVR+QAK+YP LV
Sbjct  139  KNMPEYKRRVREQAKRYPSLV  159



>gb|KJB53563.1| hypothetical protein B456_009G214500 [Gossypium raimondii]
Length=155

 Score =   205 bits (521),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  97   PETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVY  276
            P + PDG+VNL+VWHC IPGK GTDWEGG +PLT++FSEDYPSKPP CKFP  FFHPNVY
Sbjct  24   PMSAPDGSVNLLVWHCVIPGKIGTDWEGGYFPLTINFSEDYPSKPPICKFPNGFFHPNVY  83

Query  277  PSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRR  456
            PSG VCLSIL+E  GWRP+ITV QILVGIQDLLDQPN +D AQTEGY +++ +   Y++R
Sbjct  84   PSGNVCLSILSERHGWRPSITVTQILVGIQDLLDQPNASDYAQTEGYRVYVSNPDLYRKR  143

Query  457  VRQQAKQYPP  486
            V+QQ  QYPP
Sbjct  144  VQQQVLQYPP  153



>ref|XP_011398219.1| SUMO-conjugating enzyme SCE1 [Auxenochlorella protothecoides]
 gb|KFM25326.1| SUMO-conjugating enzyme SCE1 [Auxenochlorella protothecoides]
Length=160

 Score =   205 bits (521),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GF A+PET   G  NL+ W+C IPGK  T WEGG YPLTM FSE+YP++PPKCKFP  
Sbjct  22   PFGFHARPETTSTGETNLLKWNCHIPGKENTLWEGGFYPLTMEFSEEYPARPPKCKFPAG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPN+YPSGTVCLSILNED GWRP+ITVKQILVGIQ+LLD PNP  PAQ++ Y +F Q 
Sbjct  82   FFHPNIYPSGTVCLSILNEDEGWRPSITVKQILVGIQELLDTPNPHSPAQSDAYLMFTQR  141

Query  436  TVEYKRRVRQQAKQYPP  486
              EYKR+++  A +YPP
Sbjct  142  LTEYKRKIKDVASKYPP  158



>ref|XP_002448376.1| hypothetical protein SORBIDRAFT_06g026250 [Sorghum bicolor]
 gb|EES12704.1| hypothetical protein SORBIDRAFT_06g026250 [Sorghum bicolor]
Length=159

 Score =   204 bits (520),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVW C IPGK GTDW+GG +PLT+HF EDYPS PP CKFP  
Sbjct  23   PHGFVAKPETLPDGSVNLMVWKCVIPGKEGTDWDGGYFPLTLHFPEDYPSSPPICKFPAG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVYP+G VCLSIL+  S W+ +ITV+QIL+GIQDLLD PNPA  AQ   Y L+ +D
Sbjct  83   FFHVNVYPTGAVCLSILS--SAWKASITVRQILIGIQDLLDNPNPASAAQDICYRLYKKD  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              +YK  VRQQAK+YP +V
Sbjct  141  MPKYKDHVRQQAKRYPSVV  159



>emb|CAD41164.2| OSJNBa0064M23.9 [Oryza sativa Japonica Group]
 gb|EAY95270.1| hypothetical protein OsI_17093 [Oryza sativa Indica Group]
 gb|EAZ31738.1| hypothetical protein OsJ_15891 [Oryza sativa Japonica Group]
Length=160

 Score =   204 bits (520),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLMVW C IPGK GTDWEGG +PLTM F+EDYP+  P CKFP  
Sbjct  24   PHGFVAKPETLPDGSVNLMVWRCIIPGKEGTDWEGGYFPLTMQFTEDYPTNAPSCKFPSG  83

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY SG VCLSIL+  + W+P+ITV+QIL+GIQ+L D PNP   AQ   Y L+ +D
Sbjct  84   FFHINVYDSGAVCLSILS--TAWKPSITVRQILIGIQELFDDPNPNSAAQNISYELYRKD  141

Query  436  TVEYKRRVRQQAKQYP  483
              EY++RVRQQAK+YP
Sbjct  142  MEEYRKRVRQQAKKYP  157



>ref|XP_003293385.1| hypothetical protein DICPUDRAFT_58449 [Dictyostelium purpureum]
 gb|EGC30098.1| hypothetical protein DICPUDRAFT_58449 [Dictyostelium purpureum]
Length=159

 Score =   204 bits (520),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P+GF A+P T  DG++NL VW C IPGK  T WE G YPLTM F+EDYPSKPPKC+FP+ 
Sbjct  21   PYGFYARPTTNTDGSLNLFVWSCGIPGKKDTIWENGVYPLTMEFTEDYPSKPPKCRFPKD  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNE+S W+P+IT+K +L+GIQDLLD PNP  PAQ    HLF+QD
Sbjct  81   FFHPNVYPSGTVCLSILNEESDWKPSITIKTVLLGIQDLLDNPNPKSPAQQLPIHLFLQD  140

Query  436  TVEYKRRVRQQAKQYP  483
              EY ++VRQQAK YP
Sbjct  141  KDEYVKKVRQQAKSYP  156



>gb|EFA82218.1| putative E2 enzyme Ubc9 [Polysphondylium pallidum PN500]
Length=159

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +1

Query  31   LAVVSRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFS  210
            LA ++          P GF A+P+   DG+ NL +W C IPG  GT WEGG YPLTM FS
Sbjct  6    LARLTEERKNWRKDHPFGFYARPKNNADGSANLFMWECGIPGVTGTLWEGGVYPLTMEFS  65

Query  211  EDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP  390
            EDYPSKPPKC+FP+ FFHPN+YPSGTVCLSI+NED  W+P+I+VKQIL+GIQ+LL++PNP
Sbjct  66   EDYPSKPPKCRFPKDFFHPNIYPSGTVCLSIVNEDGNWKPSISVKQILLGIQELLNEPNP  125

Query  391  ADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  486
              PAQ     LFI D  EYK++VR+Q KQYPP
Sbjct  126  KSPAQQLAITLFIHDMEEYKKKVREQTKQYPP  157



>ref|XP_006652687.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Oryza brachyantha]
Length=161

 Score =   202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 109/136 (80%), Gaps = 2/136 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKPETLPDG+VNLM+W C IPGK GTDWEGG +PLTM F+EDYP+ PP CKFP  
Sbjct  25   PHGFVAKPETLPDGSVNLMLWRCIIPGKEGTDWEGGYFPLTMQFTEDYPNSPPSCKFPSG  84

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY SG VCLSIL+  SGW+P+ITVKQIL+GIQ+L D PNP   AQ   Y L+ ++
Sbjct  85   FFHINVYDSGAVCLSILS--SGWKPSITVKQILMGIQELFDDPNPMSAAQNLSYELYKKN  142

Query  436  TVEYKRRVRQQAKQYP  483
              EY++ VRQQAK+YP
Sbjct  143  MPEYRKCVRQQAKKYP  158



>gb|KJB53564.1| hypothetical protein B456_009G214500 [Gossypium raimondii]
Length=157

 Score =   202 bits (513),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP + PDG+VNL+VWHC IPGK GTDWEGG +PLT++FSEDYPSKPP CKFP  
Sbjct  22   PHGFVAKPMSAPDGSVNLLVWHCVIPGKIGTDWEGGYFPLTINFSEDYPSKPPICKFPNG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ  432
            FFHPNVYPSG VCLSIL+E  GWRP+ITV QILVGIQDLLDQPN +D AQTEGY +++ 
Sbjct  82   FFHPNVYPSGNVCLSILSERHGWRPSITVTQILVGIQDLLDQPNASDYAQTEGYRVYVS  140



>ref|XP_002502397.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO63655.1| predicted protein, partial [Micromonas sp. RCC299]
Length=157

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = +1

Query  79   HGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAF  258
            HGFVA+PET+ DG VNL+ W C+IPGK  T W  G+YPLTM FSEDYP KPPKCKFPQ F
Sbjct  21   HGFVARPETV-DGAVNLLRWECSIPGKKDTLWFSGHYPLTMEFSEDYPFKPPKCKFPQGF  79

Query  259  FHPN-VYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FHP+ VYPSGTVCLSIL+ED GWRP+ITVKQIL+GIQD+LD PNPA P+Q+E Y LF  +
Sbjct  80   FHPSGVYPSGTVCLSILHEDEGWRPSITVKQILLGIQDMLDSPNPASPSQSEAYLLFKNN  139

Query  436  TVEYKRRVRQQAKQYPPL  489
              +Y ++V++QA +YP L
Sbjct  140  RADYDKKVKEQATRYPAL  157



>ref|NP_001159056.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|ACG43792.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 tpg|DAA36341.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=159

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVAKP  LPDG+VNLM+W+C +PGK GTDWEGG +P+T+HF+E+YPS PP CKFP+ 
Sbjct  23   PLGFVAKPAMLPDGSVNLMLWNCVVPGKEGTDWEGGYFPVTLHFTENYPSNPPTCKFPRR  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY SG VCLSIL +   W P+ITV+QIL+GIQ+LL+ PNPA PAQ   Y +F ++
Sbjct  83   FFHVNVYDSGDVCLSILGD--AWAPSITVRQILIGIQELLENPNPASPAQDFAYDVFAEN  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR+QAK+YP LV
Sbjct  141  MPEYKRRVREQAKRYPSLV  159



>gb|ABR25815.1| ubiquitin-conjugating enzyme [Oryza sativa Indica Group]
Length=104

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  181  GNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVG  360
            G YPLT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVG
Sbjct  1    GYYPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVG  60

Query  361  IQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
            IQDLLDQPNPADPAQT+GYH+FIQD  EYKRRVR QAKQYP L+
Sbjct  61   IQDLLDQPNPADPAQTDGYHIFIQDKPEYKRRVRVQAKQYPALL  104



>gb|ACG43810.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
Length=159

 Score =   199 bits (507),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVAKP  LPDG+VNLM+W C +PGK GTDWEGG +P+T+HF+E+YPS PP CKFP+ 
Sbjct  23   PLGFVAKPAMLPDGSVNLMLWDCVVPGKEGTDWEGGYFPVTLHFTENYPSNPPTCKFPRR  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY SG VCLSIL +   W P+ITV+QIL+GIQ+LL+ PNPA PAQ   Y +F ++
Sbjct  83   FFHVNVYDSGDVCLSILGD--AWAPSITVRQILIGIQELLENPNPASPAQDFAYDVFAEN  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYKRRVR+QAK+YP LV
Sbjct  141  MPEYKRRVREQAKRYPSLV  159



>ref|XP_003580378.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Brachypodium 
distachyon]
Length=159

 Score =   199 bits (507),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVAKP+TLPDG+VNLMVW C IPGK GTDWEGG +PLT+ F++DYP+ PP CKFP  
Sbjct  23   PHGFVAKPDTLPDGSVNLMVWRCVIPGKQGTDWEGGYFPLTLEFNDDYPTVPPVCKFPSG  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVY SG VCLSIL+  SGW+P+ITVKQ+LVGIQ+LLD  NP   AQ   Y L+ ++
Sbjct  83   FFHVNVYDSGLVCLSILS--SGWKPSITVKQVLVGIQELLDDANPNSAAQQRCYELYKKN  140

Query  436  TVEYKRRVRQQAKQYPPLV  492
              EYK RVR+QAK+YP  V
Sbjct  141  MPEYKNRVREQAKRYPSRV  159



>ref|XP_009040187.1| hypothetical protein AURANDRAFT_31459, partial [Aureococcus anophagefferens]
 gb|EGB05058.1| hypothetical protein AURANDRAFT_31459 [Aureococcus anophagefferens]
Length=154

 Score =   199 bits (506),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R +    A  P GF A+P + PD + NLM W   IPGKAGTDWE G Y +TM F++DYPS
Sbjct  6    RLAEERKADHPFGFYARPGSNPDNSTNLMRWETGIPGKAGTDWEAGLYKVTMEFTDDYPS  65

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
            KPPKCKF    FHPNVYPSGT+CLSILNE+  WRPAIT+KQ+L+GIQDLLD PNP  PAQ
Sbjct  66   KPPKCKFVPPLFHPNVYPSGTICLSILNEEEDWRPAITIKQMLLGIQDLLDTPNPNSPAQ  125

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPP  486
            ++ Y LF+ D  EYK+RVRQ+A +  P
Sbjct  126  SDAYQLFVSDKAEYKKRVRQEAAKNAP  152



>ref|NP_001147178.1| LOC100280784 [Zea mays]
 gb|ACG25870.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
Length=172

 Score =   199 bits (507),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +1

Query  82   GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  261
            GFVAKP  LPDG+VNLM+W+C +PGK GTDWEGG +P+T+HF+E+YPS PP CKFP+ FF
Sbjct  38   GFVAKPAMLPDGSVNLMLWNCVVPGKEGTDWEGGYFPVTLHFTENYPSIPPTCKFPRRFF  97

Query  262  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  441
            H NVY SG VCLSIL +   W P+ITV+QIL+GIQ+LL+ PNPA PAQ   Y +F ++  
Sbjct  98   HVNVYDSGDVCLSILGD--AWAPSITVRQILIGIQELLENPNPASPAQDFAYDVFAENMP  155

Query  442  EYKRRVRQQAKQYPPLV  492
            EYKRRVR+QAK+YP LV
Sbjct  156  EYKRRVREQAKRYPSLV  172



>ref|XP_002500401.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61659.1| predicted protein [Micromonas sp. RCC299]
Length=178

 Score =   199 bits (507),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = +1

Query  31   LAVVSRRSARPGAKT--PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMH  204
            LA    ++ R G +   PHGFVAKP T  DG+V+L+ W C IPGKAGT WE G YP+ + 
Sbjct  4    LAKTRLQTERKGWRKDHPHGFVAKPRTARDGSVDLLNWDCKIPGKAGTLWEKGLYPIRLE  63

Query  205  FSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQP  384
            F+EDYPSKPPK  FP  FFHPNVYPSG VCLSILNED GW+P+ITVKQILVG+Q+LLD P
Sbjct  64   FTEDYPSKPPKVSFPAGFFHPNVYPSGKVCLSILNEDKGWKPSITVKQILVGVQELLDNP  123

Query  385  NPADPAQTEGYHLFIQDTVEYKRRVRQQAKQY  480
            N AD AQ   Y LF +   EY +RVR +A +Y
Sbjct  124  NNADAAQEAAYKLFKKSGAEYAKRVRIEAAKY  155



>ref|XP_637050.1| hypothetical protein DDB_G0287693 [Dictyostelium discoideum AX4]
 sp|Q9NGP4.1|UBC9_DICDI RecName: Full=Sumo-conjugating enzyme ubc9; AltName: Full=Sumo-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9 
[Dictyostelium discoideum]
 gb|AAF65153.1|AF246690_1 putative E2 enzyme Ubc9 [Dictyostelium discoideum]
 gb|EAL63493.1| hypothetical protein DDB_G0287693 [Dictyostelium discoideum AX4]
Length=159

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P+GF A+P T  DG++NL VW+C IPGK  T+WEGG YPL M F+EDYPSKPPKC+FP+ 
Sbjct  21   PYGFFARPSTNTDGSLNLYVWNCGIPGKTKTNWEGGVYPLIMEFTEDYPSKPPKCRFPKD  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSGTVCLSILNE++ W+P++T+K +L+GIQDLLD PNP  PAQ    HLF+ +
Sbjct  81   FFHPNVYPSGTVCLSILNEEADWKPSVTIKTVLLGIQDLLDNPNPKSPAQQLPIHLFLTN  140

Query  436  TVEYKRRVRQQAKQYPP  486
              EY ++V+ Q+K YPP
Sbjct  141  KEEYDKKVKAQSKVYPP  157



>ref|XP_009858945.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Ciona intestinalis]
Length=160

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVAKP   PD T+NLM W C IPGK GT WEGG Y + M F +DYPS PPKC+F  A
Sbjct  21   PFGFVAKPTKNPDHTLNLMNWECAIPGKKGTSWEGGLYKIRMIFKDDYPSSPPKCRFEPA  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL+ED  WRPAIT+KQIL+GIQDLL +PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILDEDKDWRPAITIKQILLGIQDLLTEPNINDPAQAEAYAIYSQN  140

Query  436  TVEYKRRVRQQAKQYPPL  489
             VEY +RV++QAKQ+  L
Sbjct  141  KVEYDKRVKEQAKQFSGL  158



>ref|XP_007908470.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callorhinchus milii]
 ref|XP_007908471.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callorhinchus milii]
Length=158

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG Y L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTLNLMNWECAIPGKKGTAWEGGQYKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   IFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFAP  157



>gb|KJB21462.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21465.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21467.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
Length=121

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  MVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILN  309
            MVWHC IPGK GTDWEGG +PLT++FSE+YPSKPPKCKFP  FFHPNVYPSG VCLSIL+
Sbjct  1    MVWHCVIPGKKGTDWEGGYFPLTLNFSEEYPSKPPKCKFPNGFFHPNVYPSGIVCLSILS  60

Query  310  EDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  483
            E  GWRP+ITVKQILVGIQDLLDQPN  D AQTEG+ L+I +  EY++RV+QQ  QYP
Sbjct  61   ERRGWRPSITVKQILVGIQDLLDQPNATDAAQTEGHQLYISNPNEYRKRVQQQVLQYP  118



>ref|XP_004976582.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
Length=159

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPS  225
            R+S R     PHGFVAKPETLPDG+VNL++W C IPGK GTDWEGG +PLT+HFSE+YP 
Sbjct  15   RKSWR--KSHPHGFVAKPETLPDGSVNLLLWKCVIPGKKGTDWEGGYFPLTVHFSENYPD  72

Query  226  KPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQ  405
             PP CKFP  FFH NVY  G VCLSIL +   W P+ITV QILV IQDLLD PNP   AQ
Sbjct  73   HPPICKFPAGFFHVNVYDPGAVCLSILGD--AWNPSITVPQILVCIQDLLDNPNPISRAQ  130

Query  406  TEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
               YHL+ ++  EYK+RVRQQAK+YP LV
Sbjct  131  RFIYHLYAKNMPEYKKRVRQQAKRYPSLV  159



>ref|XP_010318995.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Solanum 
lycopersicum]
Length=164

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+PET PDG+ NLM+W C IPGK GTDWEGG+YPLTMHFSEDYPS+PPKCKFP+ 
Sbjct  22   PHGFVARPETGPDGSANLMLWRCIIPGKPGTDWEGGHYPLTMHFSEDYPSQPPKCKFPRG  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFH NVYPSG VCLSILN   GW PAITVKQILVGIQ+LLD+PNP+  AQ+E Y L+++ 
Sbjct  82   FFHINVYPSGDVCLSILNTGLGWSPAITVKQILVGIQELLDEPNPSSSAQSECYKLYVKK  141

Query  436  TV  441
             +
Sbjct  142  LL  143



>ref|XP_010059902.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X4 [Eucalyptus 
grandis]
Length=151

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 9/135 (7%)
 Frame = +1

Query  46   RRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGT------DWEGGNYPLTMHF  207
            RR+ R     PHGFVAKPET PDG+VNLMVWHCTIPGKAGT      DWEGGNYPLT++F
Sbjct  14   RRAWR--KNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTFFLMQTDWEGGNYPLTLYF  71

Query  208  SEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPN  387
            +EDYPSK PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QILVG+QDLL QPN
Sbjct  72   TEDYPSKAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQILVGVQDLLHQPN  130

Query  388  PADPAQTEGYHLFIQ  432
            PA PA  + Y LF++
Sbjct  131  PASPANYDEYELFVK  145



>dbj|GAM24255.1| hypothetical protein SAMD00019534_074300 [Acytostelium subglobosum 
LB1]
Length=159

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = +1

Query  31   LAVVSRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFS  210
            LA ++    +     P GF A+P+   DG+ NL VW C IPG  GT WEGG YPLTM FS
Sbjct  6    LARLTEERKQWRKDHPFGFFARPQNNKDGSTNLFVWDCGIPGITGTLWEGGTYPLTMEFS  65

Query  211  EDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNP  390
            E+YPSKPPKC+FP+ FFHPNVYPSGTVCLSI+N+D  W+P+I+VKQIL+GIQDLL+ PNP
Sbjct  66   EEYPSKPPKCRFPKDFFHPNVYPSGTVCLSIVNDDGDWKPSISVKQILLGIQDLLNAPNP  125

Query  391  ADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  492
              PAQ     LF+ +  EYKR+V++Q K YPP V
Sbjct  126  KSPAQQLPITLFVNNIEEYKRKVKEQVKLYPPPV  159



>ref|XP_005851683.1| hypothetical protein CHLNCDRAFT_59526 [Chlorella variabilis]
 gb|EFN59581.1| hypothetical protein CHLNCDRAFT_59526 [Chlorella variabilis]
Length=160

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  76   PHGFVAKPETLPD-GTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQ  252
            P GF A+PE   + G  N+M W C IPGK  T W+GG YPLTM F+EDYP+KPPKCK P 
Sbjct  21   PFGFHARPELNEETGETNMMRWKCYIPGKEDTIWQGGFYPLTMEFTEDYPAKPPKCKLPA  80

Query  253  AFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQ  432
             FFHPN+YPSGTVCLSILNED GWRP+ITVKQIL+GIQ+LLD PNP  PAQ++ + +F Q
Sbjct  81   GFFHPNIYPSGTVCLSILNEDEGWRPSITVKQILLGIQELLDNPNPLSPAQSDAFVMFQQ  140

Query  433  DTVEYKRRVRQQAKQYPPLV  492
               EYK+RV+Q+A +YPP V
Sbjct  141  RLEEYKKRVKQEAAKYPPPV  160



>ref|XP_007576679.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Poecilia 
formosa]
 ref|XP_008434542.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Poecilia 
reticulata]
Length=162

 Score =   197 bits (500),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  25   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  84

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  85   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  144

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK+Y P
Sbjct  145  RVEYEKRVRAQAKKYSP  161



>ref|NP_001232317.1| putative ubiquitin-conjugating enzyme E2I cluster 2 [Taeniopygia 
guttata]
 gb|ACH44578.1| putative ubiquitin-conjugating enzyme E2I cluster 2 [Taeniopygia 
guttata]
Length=158

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + LTM F +DYPS PPKCKF   
Sbjct  21   PWGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLTMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED+ WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDNDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFAP  157



>gb|ACI67992.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
Length=157

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ QD
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQD  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFSP  157



>gb|KJB21522.1| hypothetical protein B456_004G179000, partial [Gossypium raimondii]
Length=134

 Score =   195 bits (496),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 109/134 (81%), Gaps = 3/134 (2%)
 Frame = +1

Query  82   GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  261
            GFVAKPET  DG+V+LMVWHC I GK   DW GG +PLT++FSE+YPSKPPKCKF   FF
Sbjct  1    GFVAKPETRADGSVDLMVWHCVILGKK-RDWGGGYFPLTLNFSEEYPSKPPKCKFSNGFF  59

Query  262  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  441
            HP+VYPSG VCLSIL+E  GWRP+ITVKQILVGIQDLLDQPN  D AQTEG+ L+  +  
Sbjct  60   HPSVYPSGIVCLSILSERRGWRPSITVKQILVGIQDLLDQPNATDAAQTEGHQLY--NPN  117

Query  442  EYKRRVRQQAKQYP  483
            EY++RV+QQ  QYP
Sbjct  118  EYRKRVQQQVLQYP  131



>ref|XP_005803294.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Xiphophorus maculatus]
 ref|XP_007576680.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Poecilia 
formosa]
 ref|XP_007576681.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Poecilia 
formosa]
 ref|XP_008434543.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Poecilia 
reticulata]
Length=158

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK+Y P
Sbjct  141  RVEYEKRVRAQAKKYSP  157



>ref|XP_006006938.1| PREDICTED: SUMO-conjugating enzyme UBC9-B-like isoform X1 [Latimeria 
chalumnae]
Length=158

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG Y L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTLNLMNWECAIPGKKGTPWEGGLYKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   IFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFAP  157



>ref|XP_007063734.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Chelonia 
mydas]
Length=167

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  30   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  89

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  90   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  149

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  150  RVEYEKRVRAQAKKFAP  166



>ref|XP_004348529.1| ubiquitinconjugating enzyme, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22071.1| ubiquitinconjugating enzyme, putative [Acanthamoeba castellanii 
str. Neff]
Length=141

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  79   HGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAF  258
             G +++    PDG+ NLM W C IPG+ GTDWE G +PLTM F++DYPSKPPKC+FP  F
Sbjct  6    RGRLSEERKNPDGSANLMKWTCGIPGRKGTDWENGIFPLTMAFTDDYPSKPPKCQFPSGF  65

Query  259  FHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDT  438
            FHPN+YPSGTVCLSILNED  W+P+ITVKQIL+G+Q+LLD PNP  PAQ + Y LF+ + 
Sbjct  66   FHPNIYPSGTVCLSILNEDEDWKPSITVKQILLGVQELLDSPNPNSPAQQDAYALFVTNR  125

Query  439  VEYKRRVRQQAKQY  480
             EYKRRV+ Q+ +Y
Sbjct  126  TEYKRRVKLQSAKY  139



>ref|XP_006123351.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pelodiscus sinensis]
Length=167

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  30   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  89

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  90   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  149

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  150  RVEYEKRVRAQAKKFAP  166



>ref|XP_005697407.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Capra hircus]
Length=171

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  34   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  93

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  94   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  153

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  154  RVEYEKRVRAQAKKFAP  170



>ref|XP_005697408.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Capra hircus]
Length=165

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  28   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  87

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  88   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  147

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  148  RVEYEKRVRAQAKKFAP  164



>dbj|BAD92225.1| ubiquitin-conjugating enzyme E2I variant [Homo sapiens]
Length=171

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  34   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  93

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  94   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  153

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  154  RVEYEKRVRAQAKKFAP  170



>gb|AAP36303.1| Homo sapiens ubiquitin-conjugating enzyme E2I (UBC9 homolog, 
yeast) [synthetic construct]
 gb|AAX29193.1| ubiquitin-conjugating enzyme E2I, partial [synthetic construct]
Length=159

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFAP  157



>ref|XP_005866608.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Myotis brandtii]
Length=164

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  27   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  86

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  87   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  146

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  147  RVEYEKRVRAQAKKFAP  163



>ref|XP_005621791.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X4 [Canis lupus 
familiaris]
Length=168

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  31   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  90

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  91   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  150

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  151  RVEYEKRVRAQAKKFAP  167



>ref|XP_006245980.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Rattus norvegicus]
Length=182

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  45   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  104

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  105  LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  164

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  165  RVEYEKRVRAQAKKFAP  181



>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed 
By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 
And Rangap1
 pdb|1KPS|C Chain C, Structural Basis For E2-Mediated Sumo Conjugation Revealed 
By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 
And Rangap1
Length=159

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  22   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  81

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  82   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  141

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  142  RVEYEKRVRAQAKKFAP  158



>ref|XP_003059128.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56260.1| predicted protein [Micromonas pusilla CCMP1545]
Length=179

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            PHGFVA+P    DG+VN+++W C IPGKAGT WE G +P+TM+F+EDYPSKPPK   P  
Sbjct  21   PHGFVARPVNARDGSVNMLIWECKIPGKAGTLWESGLFPVTMYFTEDYPSKPPKVSLPAG  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
            FFHPNVYPSG VCLSILNE+ GW+P+ITVKQIL G+Q+LLD PN AD AQ   Y L+ + 
Sbjct  81   FFHPNVYPSGKVCLSILNEEKGWKPSITVKQILTGVQELLDNPNNADAAQDVAYKLYKKS  140

Query  436  TVEYKRRVRQQAKQY  480
              EY +RVR +A +Y
Sbjct  141  KAEYSKRVRIEAARY  155



>ref|XP_010390839.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Corvus cornix cornix]
Length=190

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  53   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  112

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  113  LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  172

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  173  RVEYEKRVRAQAKKFAP  189



>ref|XP_006037209.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Alligator 
sinensis]
 ref|XP_006268488.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Alligator 
mississippiensis]
Length=169

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  32   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  91

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  92   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  151

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  152  RVEYEKRVRAQAKKFAP  168



>gb|KFQ56066.1| SUMO-conjugating enzyme UBC9, partial [Nestor notabilis]
Length=160

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  23   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  83   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  142

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  143  RVEYEKRVRAQAKKFAP  159



>gb|KFP20677.1| SUMO-conjugating enzyme UBC9, partial [Egretta garzetta]
Length=162

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  25   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  84

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  85   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  144

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  145  RVEYEKRVRAQAKKFAP  161



>ref|XP_007439187.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Python bivittatus]
Length=179

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  43   SRRSARPGAKTPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYP  222
            S  +AR    +  GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYP
Sbjct  31   SGEAARLTFGSLQGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYP  90

Query  223  SKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPA  402
            S PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPA
Sbjct  91   SSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPA  150

Query  403  QTEGYHLFIQDTVEYKRRVRQQAKQYPP  486
            Q E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  151  QAEAYTIYCQNRVEYEKRVRAQAKKFAP  178



>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9
 pdb|1U9B|A Chain A, MurineHUMAN UBIQUITIN-Conjugating Enzyme Ubc9
 gb|KFO95587.1| SUMO-conjugating enzyme UBC9, partial [Calypte anna]
 gb|KFU93317.1| SUMO-conjugating enzyme UBC9, partial [Chaetura pelagica]
Length=160

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  23   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  83   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  142

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  143  RVEYEKRVRAQAKKFAP  159



>ref|XP_004537820.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004537821.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Ceratitis 
capitata]
 ref|XP_011186646.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Bactrocera cucurbitae]
 ref|XP_011197477.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Bactrocera dorsalis]
Length=159

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA+P   PDGT+NLM+W C IPGK GT WEGG Y L M F +DYP+ PPKCKF   
Sbjct  21   PFGFVARPAKNPDGTLNLMIWECAIPGKKGTAWEGGLYKLRMIFKDDYPTSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAK  474
             +EY++RVR QA+
Sbjct  141  RLEYEKRVRAQAR  153



>ref|XP_010873204.1| PREDICTED: SUMO-conjugating enzyme UBC9-B-like [Esox lucius]
Length=157

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNVQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFSP  157



>ref|XP_010282674.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Phaethon 
lepturus]
Length=165

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  28   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  87

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  88   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  147

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  148  RVEYEKRVRAQAKKFAP  164



>ref|NP_003336.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_037182.1| SUMO-conjugating enzyme UBC9 [Rattus norvegicus]
 ref|NP_035795.1| SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|NP_919235.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_919236.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_919237.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_989596.1| SUMO-conjugating enzyme UBC9 [Gallus gallus]
 ref|NP_001016408.1| SUMO-conjugating enzyme UBC9 [Xenopus (Silurana) tropicalis]
 ref|NP_001080758.1| SUMO-conjugating enzyme UBC9 [Xenopus laevis]
 ref|NP_001092842.1| SUMO-conjugating enzyme UBC9 [Bos taurus]
 ref|NP_001171080.1| SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|NP_001171081.1| SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|NP_001181765.1| SUMO-conjugating enzyme UBC9 [Macaca mulatta]
 ref|NP_001191298.1| SUMO-conjugating enzyme UBC9 [Sus scrofa]
 ref|NP_001269197.1| SUMO-conjugating enzyme UBC9 [Ictidomys tridecemlineatus]
 ref|XP_001362136.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X1 [Monodelphis 
domestica]
 ref|XP_001497036.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Equus caballus]
 ref|XP_002708678.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Oryctolagus cuniculus]
 ref|XP_002802397.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 3 [Macaca 
mulatta]
 ref|XP_001118584.2| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 1 [Macaca 
mulatta]
 ref|XP_002825992.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pongo abelii]
 ref|XP_002920223.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Ailuropoda melanoleuca]
 ref|XP_003228308.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Anolis carolinensis]
 ref|XP_003314952.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003314953.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003314954.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003314955.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003478486.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Cavia porcellus]
 ref|XP_003501621.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Cricetulus griseus]
 ref|XP_003762040.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Sarcophilus harrisii]
 ref|XP_003790814.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Otolemur garnettii]
 ref|XP_003790815.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 2 [Otolemur garnettii]
 ref|XP_003807672.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan paniscus]
 ref|XP_003807675.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan paniscus]
 ref|XP_003928414.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Saimiri boliviensis 
boliviensis]
 ref|XP_004020754.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 1 [Ovis 
aries]
 ref|XP_004020755.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 2 [Ovis 
aries]
 ref|XP_004056984.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004056985.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 3 [Gorilla gorilla 
gorilla]
 ref|XP_004056986.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 4 [Gorilla gorilla 
gorilla]
 ref|XP_004056987.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 5 [Gorilla gorilla 
gorilla]
 ref|XP_004056988.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 6 [Gorilla gorilla 
gorilla]
 ref|XP_004056989.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 7 [Gorilla gorilla 
gorilla]
 ref|XP_004270391.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Orcinus orca]
 ref|XP_004373204.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Trichechus manatus latirostris]
 ref|XP_004403169.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004438268.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004466439.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform 2 [Dasypus 
novemcinctus]
 ref|XP_004466441.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform 4 [Dasypus 
novemcinctus]
 ref|XP_004596658.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Ochotona princeps]
 ref|XP_004604259.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Sorex araneus]
 ref|XP_004652200.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Jaculus jaculus]
 ref|XP_004627971.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Octodon degus]
 ref|XP_004705847.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Echinops telfairi]
 ref|XP_004750875.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mustela putorius 
furo]
 ref|XP_004750876.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Mustela putorius 
furo]
 ref|XP_004821061.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mustela putorius 
furo]
 ref|XP_004821062.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Mustela putorius 
furo]
 ref|XP_004873905.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004873906.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Heterocephalus 
glaber]
 ref|XP_005007427.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cavia porcellus]
 ref|XP_005018677.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Anas platyrhynchos]
 ref|XP_005054678.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Ficedula 
albicollis]
 ref|XP_005054679.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Ficedula 
albicollis]
 ref|XP_005054680.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Ficedula 
albicollis]
 ref|XP_005054681.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Ficedula 
albicollis]
 ref|XP_005142194.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Melopsittacus undulatus]
 ref|XP_005240263.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Falco peregrinus]
 ref|XP_005288940.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chrysemys picta bellii]
 ref|XP_005349160.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X2 [Microtus 
ochrogaster]
 ref|XP_005349161.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X3 [Microtus 
ochrogaster]
 ref|XP_005391642.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Chinchilla 
lanigera]
 ref|XP_005391643.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Chinchilla 
lanigera]
 ref|XP_005391644.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Chinchilla 
lanigera]
 ref|XP_005443636.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Falco cherrug]
 ref|XP_005494552.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Zonotrichia albicollis]
 ref|XP_005426030.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Geospiza 
fortis]
 ref|XP_005523174.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005523175.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pseudopodoces 
humilis]
 ref|XP_005505754.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Columba livia]
 ref|XP_005590899.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X2 [Macaca 
fascicularis]
 ref|XP_005655187.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Sus scrofa]
 ref|XP_005655188.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Sus scrofa]
 ref|XP_005655189.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Sus scrofa]
 ref|XP_005655190.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Sus scrofa]
 ref|XP_005957665.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pantholops hodgsonii]
 ref|XP_006107145.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Myotis lucifugus]
 ref|XP_006174069.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Camelus ferus]
 ref|XP_006204311.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Vicugna pacos]
 ref|XP_006146425.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tupaia chinensis]
 ref|XP_006245981.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Rattus norvegicus]
 ref|XP_006245982.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Rattus norvegicus]
 ref|XP_006543476.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|XP_006524111.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mus musculus]
 ref|XP_006524112.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mus musculus]
 ref|XP_006721002.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Homo sapiens]
 ref|XP_006764003.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Myotis davidii]
 ref|XP_006901973.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Elephantulus edwardii]
 ref|XP_006873913.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chrysochloris asiatica]
 ref|XP_006971735.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Peromyscus maniculatus 
bairdii]
 ref|XP_006978856.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006978857.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Peromyscus 
maniculatus bairdii]
 ref|XP_007098722.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Panthera tigris altaica]
 ref|XP_007063735.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Chelonia 
mydas]
 ref|XP_007063736.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Chelonia 
mydas]
 ref|XP_007100185.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Physeter 
catodon]
 ref|XP_007100186.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Physeter 
catodon]
 ref|XP_007100187.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X5 [Physeter 
catodon]
 ref|XP_007100188.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X6 [Physeter 
catodon]
 ref|XP_007100189.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X7 [Physeter 
catodon]
 ref|XP_007100190.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X8 [Physeter 
catodon]
 ref|XP_006043825.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Bubalus bubalis]
 ref|XP_006043826.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Bubalus bubalis]
 ref|XP_007181803.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007181804.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007528059.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Erinaceus europaeus]
 ref|XP_007640349.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cricetulus 
griseus]
 ref|XP_007606686.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cricetulus 
griseus]
 ref|XP_007606687.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cricetulus 
griseus]
 ref|XP_007937697.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Orycteropus afer afer]
 ref|XP_008120065.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Anolis carolinensis]
 ref|XP_008068489.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tarsius syrichta]
 ref|XP_008144582.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Eptesicus fuscus]
 ref|XP_008488620.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Calypte anna]
 ref|XP_008488627.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Calypte anna]
 ref|XP_008507395.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Equus przewalskii]
 ref|XP_008579457.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Galeopterus 
variegatus]
 ref|XP_008579465.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Galeopterus 
variegatus]
 ref|XP_008579471.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Galeopterus 
variegatus]
 ref|XP_008631762.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Corvus brachyrhynchos]
 ref|XP_008631764.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Corvus brachyrhynchos]
 ref|XP_008854385.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nannospalax galili]
 ref|XP_008854386.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nannospalax galili]
 ref|XP_008926353.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Manacus vitellinus]
 ref|XP_008945297.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Merops nubicus]
 ref|XP_009007131.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callithrix jacchus]
 ref|XP_009007133.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callithrix jacchus]
 ref|XP_009007134.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callithrix jacchus]
 ref|XP_009078931.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Acanthisitta chloris]
 ref|XP_009089966.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Serinus canaria]
 ref|XP_009089967.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Serinus canaria]
 ref|XP_009193899.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Papio anubis]
 ref|XP_009193900.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Papio anubis]
 ref|XP_003916379.2| PREDICTED: SUMO-conjugating enzyme UBC9 [Papio anubis]
 ref|XP_009284790.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Aptenodytes 
forsteri]
 ref|XP_009248552.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pongo abelii]
 ref|XP_009318786.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pygoscelis adeliae]
 ref|XP_009489665.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pelecanus crispus]
 ref|XP_009466139.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nipponia nippon]
 ref|XP_009466140.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nipponia nippon]
 ref|XP_009506456.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Phalacrocorax carbo]
 ref|XP_009565758.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Cuculus canorus]
 ref|XP_009582677.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Fulmarus glacialis]
 ref|XP_009642754.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Egretta garzetta]
 ref|XP_009809901.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Gavia stellata]
 ref|XP_009694527.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Cariama cristata]
 ref|XP_009865051.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Apaloderma vittatum]
 ref|XP_009893125.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Charadrius vociferus]
 ref|XP_009897212.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Picoides pubescens]
 ref|XP_009918273.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_009940264.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Opisthocomus hoazin]
 ref|XP_009951723.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Leptosomus discolor]
 ref|XP_009986405.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tauraco erythrolophus]
 ref|XP_010019930.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nestor notabilis]
 ref|XP_009961917.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tyto alba]
 ref|XP_010000861.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chaetura pelagica]
 ref|XP_010141728.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Buceros rhinoceros silvestris]
 ref|XP_010158047.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Eurypyga helias]
 ref|XP_010169641.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Caprimulgus carolinensis]
 ref|XP_010071158.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pterocles gutturalis]
 ref|XP_010191869.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Mesitornis unicolor]
 ref|XP_010118496.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chlamydotis macqueenii]
 ref|XP_010196900.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Colius striatus]
 ref|XP_010220356.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tinamus guttatus]
 ref|XP_010282673.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Phaethon 
lepturus]
 ref|XP_010386100.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Rhinopithecus roxellana]
 ref|XP_010568842.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010568843.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010568844.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010618830.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Fukomys damarensis]
 ref|XP_010595744.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Loxodonta 
africana]
 ref|XP_010717788.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Meleagris gallopavo]
 ref|XP_010834846.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Bison bison bison]
 ref|XP_010834854.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Bison bison bison]
 ref|XP_010948232.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Camelus bactrianus]
 ref|XP_010990946.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Camelus dromedarius]
 ref|XP_011224461.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Ailuropoda melanoleuca]
 ref|XP_011289040.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Felis catus]
 ref|XP_011375128.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pteropus 
vampyrus]
 sp|P63281.1|UBC9_RAT RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-conjugating 
enzyme UbcE2A; AltName: Full=Ubiquitin-protein ligase 
I [Rattus norvegicus]
 sp|P63279.1|UBC9_HUMAN RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I; AltName: Full=p18 [Homo sapiens]
 sp|P63280.1|UBC9_MOUSE RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
Short=mUBC9; AltName: Full=Ubiquitin carrier protein I; AltName: 
Full=Ubiquitin-conjugating enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Mus musculus]
 sp|P63282.1|UBC9_XENLA RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Xenopus laevis]
 sp|P63283.1|UBC9_CHICK RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Gallus gallus]
 sp|Q2EF73.1|UBC9_SPETR RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Ictidomys tridecemlineatus]
 sp|Q28CQ4.1|UBC9_XENTR RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Xenopus (Silurana) tropicalis]
 pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, 
Rangap1 And Nup358RANBP2
 pdb|2PX9|B Chain B, The Intrinsic Affinity Between E2 And The Cys Domain 
Of E1 In Ubiquitin-Like Modifications
 pdb|2VRR|A Chain A, Structure Of Sumo Modified Ubc9
 pdb|2XWU|A Chain A, Crystal Structure Of Importin 13 - Ubc9 Complex
 pdb|3UIN|A Chain A, Complex Between Human Rangap1-sumo2, Ubc9 And The Ir1 
Domain From Ranbp2
 gb|AAK61274.1|AE006466_9 ubiquitin conjugating enzyme E2 [Homo sapiens]
 gb|AAL85282.1|AF461016_1 ubiquitin-conjugating enzyme [Gallus gallus]
 gb|AAC51361.1| ubiquitin conjugating enzyme [Homo sapiens]
 gb|AAA86662.1| ubiquitin-conjugating enzyme [Homo sapiens]
 dbj|BAA08091.1| ubiquitin conjugating enzyme [Homo sapiens]
 gb|AAB02181.1| ubiquitin conjugating enzyme homolog [Homo sapiens]
 gb|AAB02182.1| ubiquitin conjugating enzyme homolog [Mus musculus]
 emb|CAA65287.1| ubiquitin conjugating enzyme [Homo sapiens]
 emb|CAA68072.1| ubiquitin conjugating enzyme [Mus musculus]
 gb|AAC50715.1| ubiquitin conjugating enzyme 9 [Homo sapiens]
 gb|AAC50716.1| ubiquitin conjugating enzyme 9 [Homo sapiens]
 gb|AAB09410.1| RAD6 homolog; May be involved in ubiquitin conjugation; Interacts 
with RAD52 and RAD51 proteins; Method: conceptual translation 
supplied by author [Homo sapiens]
 gb|AAB18790.1| ubiquitin conjugating enzyme mUBC9 [Mus musculus]
 gb|AAB48446.1| ubiquitin-conjugating enzyme mE2 [Mus musculus]
 gb|AAB52424.1| ubiquitin conjugating enzyme UBC9 [Mus musculus]
 gb|AAB57736.1| E2 ubiquitin conjugating enzyme [Xenopus laevis]
 emb|CAA66188.1| ubiquitin-conjugating enzyme [Mus musculus]
 emb|CAA05359.1| ubiquitin-conjugating enzyme, UBC9 [Homo sapiens]
 gb|AAC98704.1| ubiquitin-conjugating enzyme UbcE2A [Rattus norvegicus]
 gb|AAH00427.1| Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Homo 
sapiens]
 dbj|BAB22599.1| unnamed protein product [Mus musculus]
 dbj|BAB23783.1| unnamed protein product [Mus musculus]
 dbj|BAB27487.1| unnamed protein product [Mus musculus]
 dbj|BAB28140.1| unnamed protein product [Mus musculus]
 gb|AAH04429.1| Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Homo 
sapiens]
 dbj|BAB68210.1| ubiquitin-conjugating enzyme 9 [Gallus gallus]
 dbj|BAC40395.1| unnamed protein product [Mus musculus]
 gb|AAH46273.1| Ube2i protein [Xenopus laevis]
 gb|AAP35578.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Homo 
sapiens]
 gb|AAS21651.1| ubiquitin-conjugating enzyme E2I [Mus musculus]
 gb|AAH86324.1| Ubiquitin-conjugating enzyme E2I [Rattus norvegicus]
 gb|AAH86592.1| Ubiquitin-conjugating enzyme E2I [Rattus norvegicus]
 gb|AAX32600.1| ubiquitin-conjugating enzyme E2I [synthetic construct]
 dbj|BAE38521.1| unnamed protein product [Mus musculus]
 dbj|BAE36134.1| unnamed protein product [Mus musculus]
 dbj|BAE29670.1| unnamed protein product [Mus musculus]
 dbj|BAE38922.1| unnamed protein product [Mus musculus]
 dbj|BAE39124.1| unnamed protein product [Mus musculus]
 dbj|BAE39303.1| unnamed protein product [Mus musculus]
 dbj|BAE40170.1| unnamed protein product [Mus musculus]
 dbj|BAE35560.1| unnamed protein product [Mus musculus]
 dbj|BAE40548.1| unnamed protein product [Mus musculus]
 dbj|BAE40602.1| unnamed protein product [Mus musculus]
 dbj|BAE38295.1| unnamed protein product [Mus musculus]
 dbj|BAE38290.1| unnamed protein product [Mus musculus]
 gb|ABD39323.1| Ubc9 [Ictidomys tridecemlineatus]
 emb|CAJ81434.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81669.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Xenopus 
(Silurana) tropicalis]
 gb|EAW85673.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85676.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85677.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85678.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85679.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|ABM82299.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [synthetic 
construct]
 gb|ABM85478.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [synthetic 
construct]
 gb|EDK97005.1| mCG121199 [Mus musculus]
 gb|EDL22415.1| mCG17660, isoform CRA_d [Mus musculus]
 gb|AAI46108.1| UBE2I protein [Bos taurus]
 gb|EDM03919.1| rCG35051, isoform CRA_a [Rattus norvegicus]
 gb|EDM03920.1| rCG35051, isoform CRA_a [Rattus norvegicus]
 tpg|DAA15584.1| TPA: SUMO-conjugating enzyme UBC9 [Bos taurus]
 gb|ELK10831.1| SUMO-conjugating enzyme UBC9 [Pteropus alecto]
 gb|AIC49932.1| UBE2I, partial [synthetic construct]
Length=158

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFAP  157



>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With 
Sumo-1- Conjugating Enzyme Ubc9
 pdb|2O25|D Chain D, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With 
Sumo-1- Conjugating Enzyme Ubc9
 pdb|1A3S|A Chain A, Human Ubc9
Length=160

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  23   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  83   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  142

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  143  RVEYEKRVRAQAKKFAP  159



>ref|XP_005448278.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Oreochromis 
niloticus]
Length=166

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  29   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  88

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  89   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  148

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  149  RVEYEKRVRAQAKKFSP  165



>ref|XP_010568841.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Haliaeetus 
leucocephalus]
Length=177

 Score =   196 bits (497),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  40   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  99

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  100  LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  159

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  160  RVEYEKRVRAQAKKFAP  176



>gb|KFM12519.1| SUMO-conjugating enzyme UBC9, partial [Aptenodytes forsteri]
 gb|KFQ04881.1| SUMO-conjugating enzyme UBC9, partial [Haliaeetus albicilla]
Length=162

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  25   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  84

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  85   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  144

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  145  RVEYEKRVRAQAKKFAP  161



>gb|EMC86701.1| SUMO-conjugating enzyme UBC9, partial [Columba livia]
 gb|KFO59142.1| SUMO-conjugating enzyme UBC9, partial [Corvus brachyrhynchos]
 gb|KFO81001.1| SUMO-conjugating enzyme UBC9, partial [Cuculus canorus]
 gb|KFO94285.1| SUMO-conjugating enzyme UBC9, partial [Buceros rhinoceros silvestris]
 gb|KFP24952.1| SUMO-conjugating enzyme UBC9, partial [Colius striatus]
 gb|KFP41832.1| SUMO-conjugating enzyme UBC9, partial [Chlamydotis macqueenii]
 gb|KFP63080.1| SUMO-conjugating enzyme UBC9, partial [Cariama cristata]
 gb|KFP71123.1| SUMO-conjugating enzyme UBC9, partial [Acanthisitta chloris]
 gb|KFP74994.1| SUMO-conjugating enzyme UBC9, partial [Apaloderma vittatum]
 gb|KFP99428.1| SUMO-conjugating enzyme UBC9, partial [Leptosomus discolor]
 gb|KFQ20145.1| SUMO-conjugating enzyme UBC9, partial [Mesitornis unicolor]
 gb|KFQ20945.1| SUMO-conjugating enzyme UBC9, partial [Merops nubicus]
 gb|KFQ66495.1| SUMO-conjugating enzyme UBC9, partial [Pelecanus crispus]
 gb|KFQ66785.1| SUMO-conjugating enzyme UBC9, partial [Phaethon lepturus]
 gb|KFQ87332.1| SUMO-conjugating enzyme UBC9, partial [Phoenicopterus ruber ruber]
 gb|KFQ99985.1| SUMO-conjugating enzyme UBC9, partial [Nipponia nippon]
 gb|KFR16481.1| SUMO-conjugating enzyme UBC9, partial [Opisthocomus hoazin]
 gb|KFV05403.1| SUMO-conjugating enzyme UBC9, partial [Tauraco erythrolophus]
 gb|KFV06404.1| SUMO-conjugating enzyme UBC9, partial [Pterocles gutturalis]
 gb|KFV42659.1| SUMO-conjugating enzyme UBC9, partial [Gavia stellata]
 gb|KFV61532.1| SUMO-conjugating enzyme UBC9, partial [Picoides pubescens]
 gb|KFV90352.1| SUMO-conjugating enzyme UBC9, partial [Eurypyga helias]
 gb|KFV95287.1| SUMO-conjugating enzyme UBC9, partial [Fulmarus glacialis]
 gb|KFW64662.1| SUMO-conjugating enzyme UBC9, partial [Pygoscelis adeliae]
 gb|KFW84556.1| SUMO-conjugating enzyme UBC9, partial [Manacus vitellinus]
 gb|KFW92898.1| SUMO-conjugating enzyme UBC9, partial [Phalacrocorax carbo]
 gb|KFZ63056.1| SUMO-conjugating enzyme UBC9, partial [Podiceps cristatus]
Length=162

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  25   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  84

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  85   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  144

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  145  RVEYEKRVRAQAKKFAP  161



>ref|NP_571908.1| SUMO-conjugating enzyme UBC9-B [Danio rerio]
 sp|Q9DDJ0.1|UBC9B_DANRE RecName: Full=SUMO-conjugating enzyme UBC9-B; AltName: Full=SUMO-protein 
ligase B; AltName: Full=Ubiquitin carrier protein 
9-B; AltName: Full=Ubiquitin carrier protein I-B; AltName: 
Full=Ubiquitin-conjugating enzyme E2 I-B; AltName: Full=Ubiquitin-protein 
ligase I-B [Danio rerio]
 gb|AAG48365.1|AF332623_1 ubiquitin-conjugating enzyme 9-2 [Danio rerio]
 gb|AAH58302.1| Ubiquitin-conjugating enzyme E2I2 [Danio rerio]
 gb|AAH66609.1| Ube2i2 protein [Danio rerio]
 gb|ACI69186.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACM08750.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACM09698.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACO08035.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 gb|ACO08745.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 emb|CDQ77658.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ71883.1| unnamed protein product [Oncorhynchus mykiss]
Length=157

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFSP  157



>ref|NP_001187932.1| sumo-conjugating enzyme ubc9 [Ictalurus punctatus]
 ref|XP_003438817.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_004080405.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Oryzias latipes]
 ref|XP_004562509.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Maylandia 
zebra]
 ref|XP_004562510.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X3 [Maylandia 
zebra]
 ref|XP_004562511.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X4 [Maylandia 
zebra]
 ref|XP_005448279.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X3 [Oreochromis 
niloticus]
 ref|XP_005448280.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X4 [Oreochromis 
niloticus]
 ref|XP_005721637.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005721638.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005721639.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X3 [Pundamilia 
nyererei]
 ref|XP_005939577.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005939578.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_006637129.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Lepisosteus oculatus]
 ref|XP_006801101.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Neolamprologus 
brichardi]
 ref|XP_006801102.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Neolamprologus 
brichardi]
 ref|XP_008301925.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Stegastes partitus]
 ref|XP_008312442.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Cynoglossus semilaevis]
 ref|XP_010734550.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Larimichthys crocea]
 ref|XP_010770433.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Notothenia coriiceps]
 ref|XP_010887168.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Esox lucius]
 ref|XP_011486461.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Oryzias latipes]
 gb|ACM08908.1| SUMO-conjugating enzyme UBC9 [Salmo salar]
 gb|ACM09251.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACM09362.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACO08197.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 gb|ACO08675.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 gb|ACO08888.1| SUMO-1-conjugating enzyme UBC9 [Osmerus mordax]
 gb|ACQ58614.1| SUMO-conjugating enzyme UBC9 [Anoplopoma fimbria]
 gb|ADO29316.1| sumo-conjugating enzyme ubc9 [Ictalurus punctatus]
 emb|CBN81292.1| SUMO-conjugating enzyme UBC9 [Dicentrarchus labrax]
 gb|AGH92631.1| SUMO-conjugating enzyme UBC9 [Salmo salar]
Length=158

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFSP  157



>ref|NP_571426.1| SUMO-conjugating enzyme UBC9-A [Danio rerio]
 ref|XP_005174251.1| PREDICTED: SUMO-conjugating enzyme UBC9-A isoform X1 [Danio rerio]
 sp|Q9W6H5.1|UBC9A_DANRE RecName: Full=SUMO-conjugating enzyme UBC9-A; AltName: Full=SUMO-protein 
ligase A; AltName: Full=Ubiquitin carrier protein 
9-A; AltName: Full=Ubiquitin carrier protein I-A; AltName: 
Full=Ubiquitin-conjugating enzyme E2 I-A; AltName: Full=Ubiquitin-protein 
ligase I-A [Danio rerio]
 gb|AAD28601.1|AF128240_1 ubiquitin-conjugating enzyme 9 [Danio rerio]
 gb|AAH59506.1| Ubiquitin-conjugating enzyme E2I [Danio rerio]
Length=158

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPMKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFSP  157



>gb|ACO52076.1| SUMO-conjugating enzyme UBC9 [Rana catesbeiana]
Length=158

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFAP  157



>ref|XP_008579450.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Galeopterus 
variegatus]
Length=168

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  31   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  90

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  91   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  150

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  151  RVEYEKRVRAQAKKFAP  167



>ref|XP_004056983.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Gorilla gorilla 
gorilla]
Length=164

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  27   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  86

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  87   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  146

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  147  RVEYEKRVRAQAKKFAP  163



>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9
 pdb|2PE6|A Chain A, Non-Covalent Complex Between Human Sumo-1 And Human 
Ubc9
Length=161

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  24   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  83

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  84   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  143

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  144  RVEYEKRVRAQAKKFAP  160



>ref|XP_011500210.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Ceratosolen solmsi 
marchali]
 ref|XP_011500211.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Ceratosolen solmsi 
marchali]
Length=159

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA+P   PDGT+NLM W C IPGK GT WEGG Y L M F +DYPS PPKCKF   
Sbjct  21   PFGFVARPTKNPDGTLNLMSWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             +EY++RVR QA+   P
Sbjct  141  RLEYEKRVRAQARAMAP  157



>ref|XP_004562508.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Maylandia 
zebra]
Length=176

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  39   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  98

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  99   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  158

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  159  RVEYEKRVRAQAKKFSP  175



>gb|ACO08933.1| SUMO-1-conjugating enzyme UBC9 [Osmerus mordax]
Length=158

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG Y L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTLWEGGQYKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   IFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             ++Y++RVR QAK++ P
Sbjct  141  RMDYEKRVRAQAKKFAP  157



>gb|KGL86044.1| SUMO-conjugating enzyme UBC9, partial [Charadrius vociferus]
Length=162

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  25   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  84

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  85   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  144

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  145  RVEYEKRVRAQAKKFAP  161



>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex
 pdb|3A4S|B Chain B, The Crystal Structure Of The Sld2:ubc9 Complex
Length=163

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  26   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  85

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  86   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  145

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  146  RVEYEKRVRAQAKKFAP  162



>ref|XP_006037208.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Alligator 
sinensis]
 ref|XP_006268487.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Alligator 
mississippiensis]
Length=177

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  40   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  99

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  100  LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  159

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  160  RVEYEKRVRAQAKKFAP  176



>ref|XP_002288880.1| ubiquitin conjugating enzyme [Thalassiosira pseudonana CCMP1335]
 gb|EED94316.1| ubiquitin conjugating enzyme [Thalassiosira pseudonana CCMP1335]
Length=161

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P+GF A+P +  DG+ +LM W   IPGK GTDWE G Y + + FS++YPSKPPKCKF   
Sbjct  23   PYGFYARPVSRGDGSSDLMKWETGIPGKEGTDWESGVYKVMLEFSDEYPSKPPKCKFVPP  82

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGT+CLSILNE+ GWRPAITVKQ+L+GIQDLLD PNP  PAQ+E Y+LFI +
Sbjct  83   LFHPNVYPSGTICLSILNEEEGWRPAITVKQMLLGIQDLLDTPNPNSPAQSEAYNLFINN  142

Query  436  TVEYKRRVRQQAKQYPP  486
              EYKRRV+ +A++  P
Sbjct  143  KAEYKRRVKAEARKNTP  159



>ref|XP_005391641.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Chinchilla 
lanigera]
Length=170

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  33   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  92

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  93   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  152

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  153  RVEYEKRVRAQAKKFAP  169



>ref|XP_009665371.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Struthio 
camelus australis]
Length=171

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  34   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  93

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  94   LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  153

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  154  RVEYEKRVRAQAKKFAP  170



>ref|XP_005181569.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Musca domestica]
Length=159

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA+P   PDGT+NLM+W C IPGK GT WEGG Y L M F +DYP+ PPKCKF   
Sbjct  21   PFGFVARPAKNPDGTLNLMIWECAIPGKKGTPWEGGLYKLRMIFKDDYPTSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAK  474
             +EY++RVR QA+
Sbjct  141  RLEYEKRVRAQAR  153



>ref|XP_007100184.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Physeter 
catodon]
Length=179

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  42   PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  101

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  102  LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN  161

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  162  RVEYEKRVRAQAKKFAP  178



>gb|ACO07807.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
Length=157

 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  76   PHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQA  255
            P GFVA P   PDGT+NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF   
Sbjct  21   PFGFVAAPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP  80

Query  256  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  435
             FHPNVYPSGTVCLSIL ED  WRPAIT++QIL+GIQ+LL++PN  DPAQ E Y ++ Q+
Sbjct  81   LFHPNVYPSGTVCLSILEEDKDWRPAITIEQILLGIQELLNEPNIQDPAQAEAYTIYCQN  140

Query  436  TVEYKRRVRQQAKQYPP  486
             VEY++RVR QAK++ P
Sbjct  141  RVEYEKRVRAQAKKFSP  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125