BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN013I15

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIY53988.1|  malate dehydrogenase                                    359   4e-121   Stylosanthes guianensis [stylo]
ref|XP_006592546.1|  PREDICTED: malate dehydrogenase, mitochondrial     359   5e-121   
emb|CAD33240.1|  putative mitochondrial NAD-dependent malate dehy...    358   2e-120   Solanum tuberosum [potatoes]
emb|CAD33241.1|  putative mitochondrial NAD-dependent malate dehy...    358   2e-120   Solanum tuberosum [potatoes]
ref|XP_009611177.1|  PREDICTED: malate dehydrogenase 2, mitochond...    357   2e-120   Nicotiana tomentosiformis
gb|AFK45866.1|  unknown                                                 357   3e-120   Lotus japonicus
gb|AAB99755.1|  malate dehydrogenase precursor                          356   5e-120   Medicago sativa [alfalfa]
gb|KEH19547.1|  malate dehydrogenase                                    356   6e-120   Medicago truncatula
ref|NP_001234001.1|  mitochondrial malate dehydrogenase                 356   8e-120   
ref|NP_001276183.1|  malate dehydrogenase, mitochondrial-like           355   2e-119   Glycine max [soybeans]
ref|XP_004510039.1|  PREDICTED: malate dehydrogenase, mitochondri...    355   2e-119   Cicer arietinum [garbanzo]
ref|XP_009335198.1|  PREDICTED: malate dehydrogenase, mitochondrial     355   2e-119   Pyrus x bretschneideri [bai li]
gb|AIE54296.1|  mitochondrial malate dehydrogenase                      355   2e-119   Nicotiana tabacum [American tobacco]
gb|KFK35713.1|  hypothetical protein AALP_AA4G027400                    354   3e-119   Arabis alpina [alpine rockcress]
ref|XP_009760199.1|  PREDICTED: malate dehydrogenase 2, mitochond...    354   3e-119   Nicotiana sylvestris
ref|NP_001275034.1|  malate dehydrogenase, mitochondrial-like           354   3e-119   Solanum tuberosum [potatoes]
ref|XP_010108267.1|  Malate dehydrogenase 1                             354   4e-119   Morus notabilis
ref|XP_008367914.1|  PREDICTED: malate dehydrogenase, mitochondrial     353   6e-119   Malus domestica [apple tree]
ref|XP_008226502.1|  PREDICTED: malate dehydrogenase, mitochondrial     353   8e-119   Prunus mume [ume]
ref|XP_006358950.1|  PREDICTED: malate dehydrogenase, mitochondri...    353   9e-119   Solanum tuberosum [potatoes]
ref|XP_007133189.1|  hypothetical protein PHAVU_011G159000g             353   1e-118   Phaseolus vulgaris [French bean]
ref|NP_001274946.1|  malate dehydrogenase, mitochondrial-like           353   1e-118   Solanum tuberosum [potatoes]
ref|XP_010313914.1|  PREDICTED: malate dehydrogenase, mitochondrial     352   2e-118   
ref|XP_009593526.1|  PREDICTED: malate dehydrogenase, mitochondrial     352   2e-118   Nicotiana tomentosiformis
ref|XP_009340262.1|  PREDICTED: malate dehydrogenase, mitochondri...    352   2e-118   Pyrus x bretschneideri [bai li]
emb|CDY55845.1|  BnaCnng29330D                                          352   2e-118   Brassica napus [oilseed rape]
emb|CDY25868.1|  BnaA05g14590D                                          352   3e-118   Brassica napus [oilseed rape]
ref|XP_002894430.1|  mitochondrial malate dehydrogenase                 352   3e-118   
emb|CDP05985.1|  unnamed protein product                                352   4e-118   Coffea canephora [robusta coffee]
ref|XP_010277741.1|  PREDICTED: malate dehydrogenase, mitochondrial     352   4e-118   Nelumbo nucifera [Indian lotus]
ref|XP_009803762.1|  PREDICTED: malate dehydrogenase, mitochondrial     352   4e-118   Nicotiana sylvestris
ref|XP_007213810.1|  hypothetical protein PRUPE_ppa008270mg             351   5e-118   Prunus persica
gb|AHN85657.1|  mitochondrial malate dehydrogenase                      351   6e-118   Prunus persica
ref|XP_006305270.1|  hypothetical protein CARUB_v10009646mg             351   7e-118   Capsella rubella
ref|XP_009106989.1|  PREDICTED: malate dehydrogenase 1, mitochond...    351   9e-118   Brassica rapa
emb|CDY26002.1|  BnaC06g06220D                                          351   9e-118   Brassica napus [oilseed rape]
sp|P17783.1|MDHM_CITLA  RecName: Full=Malate dehydrogenase, mitoc...    351   1e-117   Citrullus lanatus [wild melon]
ref|XP_010542305.1|  PREDICTED: malate dehydrogenase 1, mitochond...    350   1e-117   Tarenaya hassleriana [spider flower]
gb|AAM64855.1|  mitochondrial NAD-dependent malate dehydrogenase        350   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564625.1|  malate dehydrogenase 1                                350   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392810.1|  hypothetical protein EUTSA_v10011552mg             349   1e-117   
emb|CDY02518.1|  BnaA08g01250D                                          350   2e-117   
emb|CDY24107.1|  BnaA06g01050D                                          348   5e-117   Brassica napus [oilseed rape]
gb|KFK38851.1|  hypothetical protein AALP_AA3G168500                    348   5e-117   Arabis alpina [alpine rockcress]
ref|XP_008451713.1|  PREDICTED: malate dehydrogenase, mitochondrial     348   6e-117   
ref|XP_002882909.1|  hypothetical protein ARALYDRAFT_478929             348   7e-117   
emb|CDY59402.1|  BnaC03g78200D                                          348   8e-117   Brassica napus [oilseed rape]
sp|P83373.1|MDHM_FRAAN  RecName: Full=Malate dehydrogenase, mitoc...    348   1e-116   Fragaria x ananassa
ref|XP_004294095.1|  PREDICTED: malate dehydrogenase, mitochondrial     347   2e-116   Fragaria vesca subsp. vesca
ref|XP_010479877.1|  PREDICTED: malate dehydrogenase 1, mitochond...    347   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010500961.1|  PREDICTED: malate dehydrogenase 1, mitochond...    347   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010462202.1|  PREDICTED: malate dehydrogenase 1, mitochond...    347   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006392812.1|  hypothetical protein EUTSA_v10011552mg             348   4e-116   
ref|XP_009147616.1|  PREDICTED: malate dehydrogenase 1, mitochond...    346   4e-116   Brassica rapa
ref|NP_001078156.1|  malate dehydrogenase 2                             345   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137217.1|  PREDICTED: malate dehydrogenase, mitochondri...    347   5e-116   Cucumis sativus [cucumbers]
ref|XP_011006727.1|  PREDICTED: malate dehydrogenase, mitochondrial     345   1e-115   Populus euphratica
ref|NP_188120.1|  malate dehydrogenase 2                                345   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007021667.1|  Lactate/malate dehydrogenase family protein        345   1e-115   Theobroma cacao [chocolate]
ref|XP_002316794.1|  Malate dehydrogenase family protein                345   2e-115   Populus trichocarpa [western balsam poplar]
gb|KJB61647.1|  hypothetical protein B456_009G372600                    343   4e-115   Gossypium raimondii
ref|NP_001268095.1|  malate dehydrogenase                               344   5e-115   Vitis vinifera
gb|KJB61646.1|  hypothetical protein B456_009G372600                    343   5e-115   Gossypium raimondii
ref|XP_002300420.2|  Malate dehydrogenase family protein                343   1e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011044945.1|  PREDICTED: malate dehydrogenase, mitochondri...    342   1e-114   Populus euphratica
ref|XP_006852481.1|  hypothetical protein AMTR_s00021p00133930          343   1e-114   Amborella trichopoda
gb|AAF69549.1|AC008007_24  F12M16.14                                    342   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32500.1|  hypothetical protein JCGZ_14703                         341   6e-114   Jatropha curcas
ref|XP_002524262.1|  malate dehydrogenase, putative                     341   7e-114   Ricinus communis
ref|XP_011098245.1|  PREDICTED: malate dehydrogenase, mitochondrial     340   9e-114   Sesamum indicum [beniseed]
ref|XP_010279077.1|  PREDICTED: malate dehydrogenase, mitochondri...    341   9e-114   Nelumbo nucifera [Indian lotus]
ref|XP_002522546.1|  malate dehydrogenase, putative                     339   3e-113   Ricinus communis
gb|KDO48351.1|  hypothetical protein CISIN_1g018314mg                   336   4e-113   Citrus sinensis [apfelsine]
ref|XP_010060663.1|  PREDICTED: malate dehydrogenase, mitochondrial     339   4e-113   Eucalyptus grandis [rose gum]
gb|KHG11830.1|  Malate dehydrogenase-2C mitochondrial                   338   6e-113   Gossypium arboreum [tree cotton]
gb|KJB13224.1|  hypothetical protein B456_002G063300                    337   7e-113   Gossypium raimondii
ref|XP_011082746.1|  PREDICTED: malate dehydrogenase, mitochondrial     338   8e-113   Sesamum indicum [beniseed]
ref|XP_010915605.1|  PREDICTED: malate dehydrogenase, mitochondri...    338   8e-113   Elaeis guineensis
ref|XP_007025436.1|  Malate dehydrogenase                               338   1e-112   Theobroma cacao [chocolate]
ref|XP_004969321.1|  PREDICTED: malate dehydrogenase, mitochondri...    338   1e-112   Setaria italica
ref|XP_010912571.1|  PREDICTED: malate dehydrogenase, mitochondrial     338   1e-112   Elaeis guineensis
sp|P46487.1|MDHM_EUCGU  RecName: Full=Malate dehydrogenase, mitoc...    337   1e-112   Eucalyptus gunnii
gb|KJB13223.1|  hypothetical protein B456_002G063300                    337   2e-112   Gossypium raimondii
gb|KDO48350.1|  hypothetical protein CISIN_1g018314mg                   335   2e-112   Citrus sinensis [apfelsine]
ref|XP_008805887.1|  PREDICTED: malate dehydrogenase, mitochondri...    337   3e-112   Phoenix dactylifera
ref|XP_006485676.1|  PREDICTED: malate dehydrogenase, mitochondri...    335   8e-112   Citrus sinensis [apfelsine]
ref|XP_002456051.1|  hypothetical protein SORBIDRAFT_03g029570          335   8e-112   
ref|XP_009395766.1|  PREDICTED: malate dehydrogenase, mitochondri...    335   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386638.1|  PREDICTED: malate dehydrogenase, mitochondrial     335   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001140825.1|  uncharacterized protein LOC100272900               335   1e-111   Zea mays [maize]
ref|XP_006644438.1|  PREDICTED: malate dehydrogenase, mitochondri...    334   3e-111   Oryza brachyantha
gb|KDO48348.1|  hypothetical protein CISIN_1g018314mg                   334   4e-111   Citrus sinensis [apfelsine]
ref|XP_006451738.1|  hypothetical protein CICLE_v10008562mg             335   6e-111   
tpg|DAA58328.1|  TPA: malate dehydrogenase                              335   8e-111   
ref|NP_001043717.1|  Os01g0649100                                       332   1e-110   
ref|NP_001056389.1|  Os05g0574400                                       332   1e-110   
sp|Q43744.1|MDHM_BRANA  RecName: Full=Malate dehydrogenase, mitoc...    332   1e-110   Brassica napus [oilseed rape]
ref|XP_006654824.1|  PREDICTED: malate dehydrogenase, mitochondri...    331   4e-110   Oryza brachyantha
dbj|BAJ85181.1|  predicted protein                                      331   5e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007212766.1|  hypothetical protein PRUPE_ppa022676mg             330   9e-110   Prunus persica
ref|NP_001141337.1|  uncharacterized protein LOC100273428               330   1e-109   Zea mays [maize]
ref|XP_002285356.1|  PREDICTED: malate dehydrogenase, mitochondrial     330   1e-109   Vitis vinifera
ref|XP_008225206.1|  PREDICTED: malate dehydrogenase, mitochondri...    330   1e-109   Prunus mume [ume]
emb|CBI20215.3|  unnamed protein product                                330   2e-109   Vitis vinifera
ref|XP_004961146.1|  PREDICTED: malate dehydrogenase, mitochondri...    329   2e-109   Setaria italica
gb|ACG36184.1|  malate dehydrogenase                                    329   3e-109   Zea mays [maize]
ref|NP_001142100.1|  malate dehydrogenase2                              329   3e-109   Zea mays [maize]
ref|XP_010675402.1|  PREDICTED: malate dehydrogenase, mitochondrial     329   4e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003569456.1|  PREDICTED: malate dehydrogenase 1, mitochond...    328   4e-109   Brachypodium distachyon [annual false brome]
emb|CBL95261.1|  malate dehydrogenase                                   328   8e-109   Pinus pinaster [cluster pine]
ref|XP_002441555.1|  hypothetical protein SORBIDRAFT_09g029240          328   9e-109   Sorghum bicolor [broomcorn]
gb|KHN10168.1|  Malate dehydrogenase 1, mitochondrial                   325   2e-108   Glycine soja [wild soybean]
ref|XP_003567846.1|  PREDICTED: malate dehydrogenase 1, mitochond...    327   2e-108   Brachypodium distachyon [annual false brome]
ref|XP_002305754.2|  hypothetical protein POPTR_0004s05340g             326   4e-108   
emb|CDM83547.1|  unnamed protein product                                324   2e-107   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010527511.1|  PREDICTED: malate dehydrogenase 1, mitochond...    318   6e-107   Tarenaya hassleriana [spider flower]
gb|KEH19548.1|  malate dehydrogenase                                    320   8e-107   Medicago truncatula
emb|CDP18386.1|  unnamed protein product                                318   2e-105   Coffea canephora [robusta coffee]
ref|XP_010062799.1|  PREDICTED: malate dehydrogenase, mitochondrial     317   1e-104   Eucalyptus grandis [rose gum]
gb|EPS74425.1|  malate dehydrogenase, mitochondrial                     317   4e-104   Genlisea aurea
ref|XP_001767253.1|  predicted protein                                  314   9e-104   
ref|XP_001776138.1|  predicted protein                                  314   2e-103   
emb|CBI30662.3|  unnamed protein product                                310   2e-102   Vitis vinifera
gb|AFN53696.1|  mitochondrial malate dehydrogenase                      307   3e-101   Linum usitatissimum
ref|XP_002990694.1|  hypothetical protein SELMODRAFT_131967             309   3e-101   Selaginella moellendorffii
ref|XP_002969028.1|  hypothetical protein SELMODRAFT_90290              306   7e-100   Selaginella moellendorffii
ref|XP_006449475.1|  hypothetical protein CICLE_v10016114mg             303   9e-100   
ref|XP_002968321.1|  hypothetical protein SELMODRAFT_89860              304   2e-99    
ref|XP_002976052.1|  hypothetical protein SELMODRAFT_232627             303   3e-99    
ref|XP_002507824.1|  nad-dependent malate dehydrogenase                 301   1e-98    Micromonas commoda
gb|KDO77808.1|  hypothetical protein CISIN_1g022546mg                   300   2e-98    Citrus sinensis [apfelsine]
emb|CEF98358.1|  Lactate dehydrogenase/glycoside hydrolase, famil...    300   4e-98    Ostreococcus tauri
ref|XP_005649665.1|  malate dehydrogenase                               299   1e-97    Coccomyxa subellipsoidea C-169
ref|XP_003062229.1|  predicted protein                                  298   1e-97    Micromonas pusilla CCMP1545
ref|XP_005843566.1|  hypothetical protein CHLNCDRAFT_59812              297   6e-97    Chlorella variabilis
gb|EMS58229.1|  Malate dehydrogenase 1, mitochondrial                   299   1e-96    Triticum urartu
ref|XP_001418230.1|  predicted protein                                  295   6e-96    Ostreococcus lucimarinus CCE9901
gb|ACX50498.1|  malate dehydrogenase                                    293   7e-96    Zea mays [maize]
ref|XP_002953466.1|  malate dehydrogenase                               294   1e-95    Volvox carteri f. nagariensis
gb|AAT42189.1|  putative mitochondrial malate dehydrogenase             288   4e-95    Nicotiana tabacum [American tobacco]
ref|XP_007513166.1|  predicted protein                                  292   7e-95    Bathycoccus prasinos
ref|XP_006392811.1|  hypothetical protein EUTSA_v10011552mg             291   4e-94    
gb|EMT27196.1|  Malate dehydrogenase 1, mitochondrial                   288   4e-94    
ref|XP_001703167.1|  malate dehydrogenase                               289   3e-93    Chlamydomonas reinhardtii
ref|XP_011046119.1|  PREDICTED: malate dehydrogenase, mitochondri...    285   2e-91    Populus euphratica
gb|KDO48352.1|  hypothetical protein CISIN_1g018314mg                   279   2e-91    Citrus sinensis [apfelsine]
gb|EMT17715.1|  Malate dehydrogenase 1, mitochondrial                   279   1e-89    
gb|KIZ03193.1|  malate dehydrogenase                                    278   4e-89    Monoraphidium neglectum
gb|ABG22106.1|  Malate dehydrogenase, glyoxysomal precursor, puta...    274   7e-89    Oryza sativa Japonica Group [Japonica rice]
gb|KDD74483.1|  lactate/malate dehydrogenase                            278   1e-88    Helicosporidium sp. ATCC 50920
ref|XP_001759853.1|  predicted protein                                  276   3e-88    
ref|XP_003055830.1|  malate dehydrogenase                               276   4e-88    Micromonas pusilla CCMP1545
gb|ABA99939.2|  Malate dehydrogenase, glyoxysomal precursor, puta...    274   5e-88    Oryza sativa Japonica Group [Japonica rice]
gb|EPS70103.1|  malate dehydrogenase, glyoxysomal                       275   5e-88    Genlisea aurea
ref|XP_010268647.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    275   9e-88    Nelumbo nucifera [Indian lotus]
ref|XP_002323942.2|  hypothetical protein POPTR_0017s00790g             271   9e-88    
sp|Q42972.3|MDHG_ORYSJ  RecName: Full=Malate dehydrogenase, glyox...    275   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067346.2|  Os12g0632700                                       274   1e-87    
gb|ACN62414.1|  malate dehydrogenase                                    274   2e-87    Bambusa oldhamii
gb|ACF87717.1|  unknown                                                 273   2e-87    Zea mays [maize]
ref|XP_002732229.1|  PREDICTED: malate dehydrogenase, mitochondri...    273   2e-87    Saccoglossus kowalevskii
ref|XP_002500632.1|  malate dehydrogenase                               272   2e-87    Micromonas commoda
gb|AFX00023.1|  malate dehydrogenase                                    273   3e-87    Echinochloa crus-galli [barnyard grass]
gb|AHB50501.1|  malate dehydrogenase 2                                  273   3e-87    Mayetiola destructor
ref|XP_006664772.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    274   3e-87    Oryza brachyantha
dbj|BAK05961.1|  predicted protein                                      273   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001132077.2|  uncharacterized protein LOC100193491               273   3e-87    Zea mays [maize]
gb|ACG24454.1|  malate dehydrogenase, glyoxysomal precursor             273   3e-87    Zea mays [maize]
ref|XP_004963291.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    273   4e-87    Setaria italica
gb|ACR36673.1|  unknown                                                 272   4e-87    Zea mays [maize]
gb|KDO78776.1|  hypothetical protein CISIN_1g018265mg                   271   4e-87    Citrus sinensis [apfelsine]
gb|KDO78778.1|  hypothetical protein CISIN_1g018265mg                   270   4e-87    Citrus sinensis [apfelsine]
ref|XP_002443645.1|  hypothetical protein SORBIDRAFT_08g022770          273   5e-87    
ref|XP_006426175.1|  hypothetical protein CICLE_v10025945mg             271   6e-87    
ref|XP_003576179.1|  PREDICTED: malate dehydrogenase, glyoxysomal       272   8e-87    Brachypodium distachyon [annual false brome]
gb|KHG09742.1|  Malate dehydrogenase-2C glyoxysomal                     272   8e-87    Gossypium arboreum [tree cotton]
ref|NP_001148518.1|  malate dehydrogenase, glyoxysomal                  272   8e-87    Zea mays [maize]
gb|KDO78775.1|  hypothetical protein CISIN_1g018265mg                   270   8e-87    Citrus sinensis [apfelsine]
tpg|DAA51667.1|  TPA: malate dehydrogenase                              272   9e-87    
ref|XP_004963290.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    273   1e-86    
ref|XP_003611508.1|  Malate dehydrogenase, glyoxysomal                  271   2e-86    Medicago truncatula
ref|XP_010271551.1|  PREDICTED: malate dehydrogenase, glyoxysomal       271   2e-86    
gb|EPS68273.1|  malate dehydrogenase                                    269   3e-86    Genlisea aurea
ref|NP_179863.1|  peroxisomal NAD-malate dehydrogenase                  271   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006426177.1|  hypothetical protein CICLE_v10025945mg             270   4e-86    Citrus clementina [clementine]
ref|XP_006294611.1|  hypothetical protein CARUB_v10023648mg             269   4e-86    
ref|XP_006404741.1|  hypothetical protein EUTSA_v10000218mg             270   4e-86    Eutrema salsugineum [saltwater cress]
ref|NP_001051419.1|  Os03g0773800                                       270   4e-86    
ref|XP_009900530.1|  PREDICTED: malate dehydrogenase, mitochondrial     269   4e-86    Picoides pubescens
gb|KCW59620.1|  hypothetical protein EUGRSUZ_H02358                     268   4e-86    Eucalyptus grandis [rose gum]
gb|KCW59619.1|  hypothetical protein EUGRSUZ_H02358                     268   5e-86    Eucalyptus grandis [rose gum]
ref|NP_001239889.1|  malate dehydrogenase, glyoxysomal-like             270   5e-86    Glycine max [soybeans]
ref|XP_002880457.1|  peroxisomal NAD-malate dehydrogenase 1             270   5e-86    
ref|XP_006466391.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    270   5e-86    Citrus sinensis [apfelsine]
ref|XP_008787238.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    270   5e-86    Phoenix dactylifera
ref|XP_006422684.1|  hypothetical protein CICLE_v10028730mg             266   5e-86    
gb|KDP32142.1|  hypothetical protein JCGZ_12603                         269   5e-86    Jatropha curcas
ref|XP_010417036.1|  PREDICTED: probable malate dehydrogenase, gl...    270   5e-86    Camelina sativa [gold-of-pleasure]
ref|XP_002054903.1|  GJ22544                                            269   5e-86    Drosophila virilis
ref|XP_010105100.1|  Malate dehydrogenase                               270   6e-86    Morus notabilis
gb|KFV61776.1|  hypothetical protein N307_13393                         269   6e-86    Picoides pubescens
gb|KFK33003.1|  hypothetical protein AALP_AA6G317500                    270   6e-86    Arabis alpina [alpine rockcress]
ref|XP_007047659.1|  Peroxisomal NAD-malate dehydrogenase 1 isofo...    268   6e-86    Theobroma cacao [chocolate]
ref|XP_010646909.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    269   7e-86    Vitis vinifera
ref|XP_002310874.2|  malate dehydrogenase family protein                266   7e-86    
ref|XP_010943220.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    270   8e-86    Elaeis guineensis
ref|XP_001759620.1|  predicted protein                                  270   8e-86    
emb|CEF96952.1|  Lactate dehydrogenase/glycoside hydrolase, famil...    270   9e-86    Ostreococcus tauri
gb|KJB18106.1|  hypothetical protein B456_003G034300                    270   9e-86    Gossypium raimondii
ref|XP_010417035.1|  PREDICTED: probable malate dehydrogenase, gl...    269   1e-85    
ref|XP_011088014.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    269   1e-85    Sesamum indicum [beniseed]
ref|XP_010429212.1|  PREDICTED: probable malate dehydrogenase, gl...    269   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006650666.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    269   1e-85    Oryza brachyantha
gb|KCW59621.1|  hypothetical protein EUGRSUZ_H02358                     267   1e-85    Eucalyptus grandis [rose gum]
ref|XP_005525897.1|  PREDICTED: malate dehydrogenase, mitochondri...    268   1e-85    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006852732.1|  hypothetical protein AMTR_s00033p00085320          269   1e-85    Amborella trichopoda
ref|XP_010941982.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    269   1e-85    Elaeis guineensis
ref|XP_010472275.1|  PREDICTED: probable malate dehydrogenase, gl...    269   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_011002784.1|  PREDICTED: malate dehydrogenase, glyoxysomal       269   1e-85    Populus euphratica
ref|XP_009140390.1|  PREDICTED: probable malate dehydrogenase, gl...    269   1e-85    Brassica rapa
gb|KJB18107.1|  hypothetical protein B456_003G034300                    269   1e-85    Gossypium raimondii
gb|KDO67936.1|  hypothetical protein CISIN_1g016424mg                   265   2e-85    Citrus sinensis [apfelsine]
ref|XP_008493331.1|  PREDICTED: malate dehydrogenase, mitochondrial     268   2e-85    Calypte anna
ref|XP_008787758.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    267   2e-85    
ref|XP_004986217.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    269   2e-85    
emb|CDX89514.1|  BnaC04g35330D                                          269   2e-85    
gb|EYU44539.1|  hypothetical protein MIMGU_mgv1a008933mg                269   2e-85    Erythranthe guttata [common monkey flower]
ref|XP_001770159.1|  predicted protein                                  268   2e-85    
ref|XP_009399077.1|  PREDICTED: malate dehydrogenase, glyoxysomal       269   2e-85    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY25631.1|  BnaA04g13230D                                          268   2e-85    Brassica napus [oilseed rape]
emb|CBI29427.3|  unnamed protein product                                269   2e-85    Vitis vinifera
gb|KFP45870.1|  hypothetical protein N324_07336                         268   2e-85    Chlamydotis macqueenii
ref|XP_005648549.1|  malate dehydrogenase                               268   2e-85    Coccomyxa subellipsoidea C-169
gb|KDO67932.1|  hypothetical protein CISIN_1g016424mg                   266   2e-85    Citrus sinensis [apfelsine]
gb|KCW59622.1|  hypothetical protein EUGRSUZ_H02358                     268   2e-85    Eucalyptus grandis [rose gum]
ref|XP_003539223.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    268   2e-85    
pdb|1SMK|A  Chain A, Mature And Translocatable Forms Of Glyoxysom...    267   2e-85    Citrullus lanatus [wild melon]
gb|KDP35916.1|  hypothetical protein JCGZ_09888                         268   2e-85    Jatropha curcas
ref|XP_005056570.1|  PREDICTED: malate dehydrogenase, mitochondrial     268   3e-85    Ficedula albicollis
ref|XP_009558458.1|  PREDICTED: malate dehydrogenase, mitochondrial     268   3e-85    Cuculus canorus
ref|XP_003228877.1|  PREDICTED: malate dehydrogenase, mitochondrial     268   3e-85    Anolis carolinensis [Carolina anole]
ref|NP_001234005.1|  glyoxisomal malate dehydrogenase                   268   3e-85    Solanum lycopersicum
ref|XP_973533.1|  PREDICTED: malate dehydrogenase, mitochondrial        267   3e-85    Tribolium castaneum [rust-red flour beetle]
ref|XP_008787755.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    267   3e-85    
gb|KFW68513.1|  hypothetical protein AS28_06434                         265   3e-85    Pygoscelis adeliae
gb|KJB16076.1|  hypothetical protein B456_002G211700                    267   3e-85    Gossypium raimondii
ref|XP_008342632.1|  PREDICTED: malate dehydrogenase, glyoxysomal       266   4e-85    
ref|XP_004511797.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    268   4e-85    Cicer arietinum [garbanzo]
ref|XP_011099432.1|  PREDICTED: malate dehydrogenase, glyoxysomal       268   4e-85    Sesamum indicum [beniseed]
ref|XP_002522037.1|  malate dehydrogenase, putative                     268   4e-85    
sp|P46488.1|MDHG_CUCSA  RecName: Full=Malate dehydrogenase, glyox...    268   4e-85    Cucumis sativus [cucumbers]
ref|XP_010023359.1|  PREDICTED: malate dehydrogenase, glyoxysomal       268   4e-85    Eucalyptus grandis [rose gum]
gb|KCW59615.1|  hypothetical protein EUGRSUZ_H02358                     268   4e-85    Eucalyptus grandis [rose gum]
gb|KCW59616.1|  hypothetical protein EUGRSUZ_H02358                     268   4e-85    Eucalyptus grandis [rose gum]
gb|ABW79813.1|  malate dehydrogenase                                    268   4e-85    Perilla frutescens [beefsteak-mint]
ref|XP_006422681.1|  hypothetical protein CICLE_v10028730mg             267   4e-85    
gb|KFW94243.1|  hypothetical protein N336_05507                         264   5e-85    Phalacrocorax carbo [common cormorant]
ref|XP_010936241.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    267   5e-85    
ref|XP_007047657.1|  Peroxisomal NAD-malate dehydrogenase 1 isofo...    268   5e-85    Theobroma cacao [chocolate]
gb|KFZ53514.1|  hypothetical protein N321_05235                         266   5e-85    Antrostomus carolinensis
gb|AAB99754.1|  malate dehydrogenase precursor                          268   5e-85    Medicago sativa [alfalfa]
gb|KHN46221.1|  Malate dehydrogenase, glyoxysomal                       267   6e-85    Glycine soja [wild soybean]
sp|P19446.1|MDHG_CITLA  RecName: Full=Malate dehydrogenase, glyox...    267   6e-85    Citrullus lanatus [wild melon]
gb|KJB16075.1|  hypothetical protein B456_002G211700                    267   6e-85    Gossypium raimondii
ref|XP_002313205.1|  malate dehydrogenase family protein                267   6e-85    Populus trichocarpa [western balsam poplar]
ref|XP_001999857.1|  GI24757                                            266   6e-85    Drosophila mojavensis
ref|XP_009395011.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    267   6e-85    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK96312.1|  unknown                                                 267   6e-85    Populus trichocarpa x Populus deltoides
ref|XP_010936238.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    267   6e-85    Elaeis guineensis
gb|KGL93367.1|  hypothetical protein N301_12316                         266   7e-85    Charadrius vociferus
pdb|1SEV|A  Chain A, Mature And Translocatable Forms Of Glyoxysom...    267   7e-85    Citrullus lanatus [wild melon]
ref|XP_006422683.1|  hypothetical protein CICLE_v10028730mg             267   7e-85    Citrus clementina [clementine]
gb|KHN00213.1|  Malate dehydrogenase 1, mitochondrial                   264   8e-85    Glycine soja [wild soybean]
ref|XP_008638591.1|  PREDICTED: malate dehydrogenase, mitochondri...    266   8e-85    Corvus brachyrhynchos
ref|XP_010936239.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    267   9e-85    Elaeis guineensis
gb|ADB85313.1|  putative malate dehydrogenase                           266   9e-85    Phyllostachys edulis [kikko-chiku]
gb|KFV95633.1|  hypothetical protein N326_00455                         264   9e-85    Eurypyga helias
gb|ACU20055.1|  unknown                                                 267   9e-85    Glycine max [soybeans]
gb|KFV11953.1|  hypothetical protein N339_11022                         265   1e-84    Pterocles gutturalis
gb|KFP56162.1|  hypothetical protein N323_12358                         265   1e-84    
ref|XP_010695343.1|  PREDICTED: malate dehydrogenase, chloroplast...    269   1e-84    
gb|AAO27260.1|  putative malate dehydrogenase                           267   1e-84    
ref|XP_010126913.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    268   1e-84    
gb|KFQ15133.1|  hypothetical protein N330_05720                         265   1e-84    
ref|XP_008440462.1|  PREDICTED: malate dehydrogenase, glyoxysomal       267   1e-84    
gb|KFQ33716.1|  hypothetical protein N331_09455                         265   1e-84    
sp|P37228.2|MDHG_SOYBN  RecName: Full=Malate dehydrogenase, glyox...    266   1e-84    
gb|KFM01560.1|  hypothetical protein AS27_04257                         265   1e-84    
gb|KFQ97769.1|  hypothetical protein N306_05621                         265   1e-84    
gb|KDO67934.1|  hypothetical protein CISIN_1g016424mg                   266   1e-84    
ref|XP_001622276.1|  hypothetical protein NEMVEDRAFT_v1g248519          266   1e-84    
ref|XP_002970814.1|  malate dehydrogenase                               266   1e-84    
gb|KFP01814.1|  hypothetical protein N300_03449                         265   1e-84    
gb|KFZ63322.1|  hypothetical protein N338_12814                         265   1e-84    
gb|AAC37464.1|  malate dehydrogenase                                    266   1e-84    
ref|XP_008236937.1|  PREDICTED: malate dehydrogenase, glyoxysomal       266   1e-84    
ref|XP_007205427.1|  hypothetical protein PRUPE_ppa007722mg             266   1e-84    
ref|XP_005645132.1|  mitochondrial malate dehydrogenase                 266   1e-84    
ref|XP_002531998.1|  malate dehydrogenase, putative                     266   1e-84    
ref|XP_001989871.1|  GH18558                                            266   2e-84    
ref|XP_001964397.1|  GF23071                                            266   2e-84    
ref|XP_006486803.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    266   2e-84    
ref|XP_004288300.1|  PREDICTED: malate dehydrogenase, glyoxysomal       266   2e-84    
gb|KFV53476.1|  hypothetical protein N328_01403                         265   2e-84    
gb|ADQ00372.1|  glyoxysomal malate dehydrogenase                        266   2e-84    
ref|XP_009616819.1|  PREDICTED: malate dehydrogenase, glyoxysomal       266   2e-84    
emb|CDO97336.1|  unnamed protein product                                266   2e-84    
ref|XP_004143423.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    266   2e-84    
gb|ACH45805.1|  putative malate dehydrogenase mitochondrial varia...    265   2e-84    
gb|KDO67929.1|  hypothetical protein CISIN_1g016424mg                   266   2e-84    
gb|ACH45802.1|  putative malate dehydrogenase mitochondrial varia...    265   2e-84    
ref|XP_009955650.1|  PREDICTED: malate dehydrogenase, mitochondri...    265   2e-84    
gb|KFQ40408.1|  hypothetical protein N332_03389                         265   2e-84    
gb|KFQ49100.1|  hypothetical protein N333_08918                         265   2e-84    
ref|XP_006486804.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    266   2e-84    
gb|KDO67930.1|  hypothetical protein CISIN_1g016424mg                   266   2e-84    
gb|KDO67931.1|  hypothetical protein CISIN_1g016424mg                   266   2e-84    
ref|XP_009779239.1|  PREDICTED: malate dehydrogenase, glyoxysomal       266   2e-84    
ref|XP_009937859.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    266   2e-84    
gb|KFP21136.1|  hypothetical protein Z169_00590                         265   2e-84    
ref|XP_008942843.1|  PREDICTED: malate dehydrogenase, mitochondrial     265   2e-84    
ref|XP_009508992.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   2e-84    
gb|KFV49422.1|  hypothetical protein N341_05312                         265   2e-84    
ref|XP_008779217.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   3e-84    
ref|XP_009883505.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    266   3e-84    
ref|XP_005154369.1|  PREDICTED: malate dehydrogenase, mitochondrial     265   3e-84    
gb|EOB07860.1|  Malate dehydrogenase, mitochondrial                     264   3e-84    
ref|XP_009810230.1|  PREDICTED: malate dehydrogenase, mitochondrial     265   3e-84    
ref|XP_001416526.1|  predicted protein                                  264   3e-84    
ref|XP_008236171.1|  PREDICTED: malate dehydrogenase, glyoxysomal       266   3e-84    
ref|XP_002263670.3|  PREDICTED: malate dehydrogenase, glyoxysomal...    268   3e-84    
gb|KFO89171.1|  hypothetical protein N320_07761                         264   3e-84    
ref|XP_010077736.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    266   3e-84    
gb|KFV22894.1|  hypothetical protein N340_07230                         264   3e-84    
gb|KDO67933.1|  hypothetical protein CISIN_1g016424mg                   266   3e-84    
ref|XP_003558689.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   4e-84    
ref|XP_009375881.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   4e-84    
ref|XP_011021819.1|  PREDICTED: malate dehydrogenase, glyoxysomal       265   4e-84    
gb|AGV08374.1|  malate dehydrogenase                                    265   4e-84    
ref|XP_003741774.1|  PREDICTED: malate dehydrogenase, mitochondri...    265   4e-84    
ref|NP_001238487.1|  peroxisomal malate dehydrogenase                   265   4e-84    
ref|XP_010012352.1|  PREDICTED: malate dehydrogenase, mitochondrial     265   4e-84    
ref|XP_010190180.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   4e-84    
ref|XP_008779216.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   5e-84    
gb|KFP60896.1|  hypothetical protein N322_09230                         264   5e-84    
ref|XP_001849862.1|  mitochondrial malate dehydrogenase 2               265   5e-84    
ref|XP_009963978.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   5e-84    
ref|XP_010133536.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   5e-84    
ref|XP_003631692.1|  PREDICTED: malate dehydrogenase, glyoxysomal       265   5e-84    
ref|NP_001232112.1|  putative malate dehydrogenase mitochondrial ...    265   5e-84    
ref|XP_001359972.1|  GA20754                                            264   5e-84    
dbj|BAJ89240.1|  predicted protein                                      263   5e-84    
ref|XP_010680772.1|  PREDICTED: malate dehydrogenase, glyoxysomal       265   5e-84    
ref|XP_008779215.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   5e-84    
ref|XP_009577564.1|  PREDICTED: malate dehydrogenase, mitochondrial     263   5e-84    
ref|XP_010400948.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   6e-84    
ref|XP_009643299.1|  PREDICTED: malate dehydrogenase, mitochondrial     265   6e-84    
gb|KFV97259.1|  hypothetical protein N327_04853                         263   6e-84    
ref|XP_003211747.1|  PREDICTED: malate dehydrogenase, mitochondrial     265   6e-84    
ref|XP_009079183.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   6e-84    
ref|XP_007200600.1|  hypothetical protein PRUPE_ppa007769mg             265   6e-84    
ref|XP_008904152.1|  malate dehydrogenase, NAD-dependent                264   6e-84    
gb|KFB40725.1|  AGAP001903-PA-like protein                              264   6e-84    
ref|XP_003077929.1|  MDHG_ORYSA Malate dehydrogenase, glyoxysomal...    269   7e-84    
ref|XP_009989358.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   7e-84    
ref|XP_004289711.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   8e-84    
gb|KDO67928.1|  hypothetical protein CISIN_1g016424mg                   265   8e-84    
ref|XP_007433827.1|  PREDICTED: malate dehydrogenase, mitochondrial     264   9e-84    
ref|XP_001979676.1|  GG22759                                            264   9e-84    
ref|XP_011457778.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   9e-84    
ref|XP_008393801.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    265   9e-84    
ref|XP_321163.4|  AGAP001903-PA                                         264   9e-84    
ref|XP_006298004.1|  hypothetical protein CARUB_v10014049mg             264   9e-84    
ref|XP_004343487.1|  malate dehydrogenase                               263   1e-83    
gb|ABD77293.1|  mitochondrial malate dehydrogenase 2, NAD               262   1e-83    
ref|XP_415765.1|  PREDICTED: malate dehydrogenase, mitochondrial        264   1e-83    
gb|KFQ88961.1|  hypothetical protein N337_10534                         263   1e-83    
ref|XP_009790667.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    264   1e-83    
gb|KFR01272.1|  hypothetical protein Y956_03288                         263   1e-83    
gb|EMT13267.1|  Malate dehydrogenase, glyoxysomal                       263   1e-83    
ref|XP_009697540.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    264   1e-83    
ref|XP_010571843.1|  PREDICTED: malate dehydrogenase, mitochondrial     263   1e-83    
ref|XP_004154973.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    266   1e-83    
ref|XP_009324353.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   1e-83    
gb|EMC77063.1|  Malate dehydrogenase, mitochondrial                     263   1e-83    
gb|KFQ65225.1|  hypothetical protein N334_07172                         263   1e-83    
gb|KFO10935.1|  hypothetical protein N312_05871                         263   1e-83    
ref|XP_005425510.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    264   1e-83    
ref|XP_005010690.1|  PREDICTED: malate dehydrogenase, mitochondrial     265   2e-83    
ref|NP_001031860.1|  peroxisomal NAD-malate dehydrogenase 2             263   2e-83    
ref|XP_009865113.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    264   2e-83    
ref|XP_009467237.1|  PREDICTED: malate dehydrogenase, mitochondrial     263   2e-83    
gb|KFU95884.1|  hypothetical protein M959_10959                         262   2e-83    
ref|XP_005187487.1|  PREDICTED: malate dehydrogenase, mitochondrial     263   2e-83    
ref|XP_005502018.1|  PREDICTED: malate dehydrogenase, mitochondrial     263   2e-83    
gb|KFP93425.1|  hypothetical protein N329_04683                         262   2e-83    
ref|XP_005328566.1|  PREDICTED: malate dehydrogenase, mitochondrial     263   2e-83    
ref|XP_010107638.1|  Malate dehydrogenase                               263   2e-83    
ref|XP_792004.2|  PREDICTED: malate dehydrogenase, mitochondrial-...    263   2e-83    
ref|XP_849944.1|  PREDICTED: malate dehydrogenase, mitochondrial ...    263   2e-83    
ref|XP_009625012.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    263   2e-83    
ref|XP_007074058.1|  PREDICTED: malate dehydrogenase, mitochondrial     262   2e-83    
ref|XP_004233467.1|  PREDICTED: malate dehydrogenase, glyoxysomal       263   2e-83    
ref|XP_002298801.1|  malate dehydrogenase family protein                263   2e-83    
ref|XP_005495094.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    264   2e-83    
ref|NP_650696.1|  malate dehydrogenase 2                                263   2e-83    
ref|XP_002096156.1|  GE25523                                            263   2e-83    
ref|XP_004399137.1|  PREDICTED: malate dehydrogenase, mitochondrial     263   2e-83    
ref|XP_006346883.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    262   3e-83    
gb|AAF27650.1|AF218064_1  malate dehydrogenase precursor                263   3e-83    
ref|NP_001078556.1|  peroxisomal NAD-malate dehydrogenase 2             263   3e-83    
ref|XP_008928641.1|  PREDICTED: malate dehydrogenase, mitochondri...    263   3e-83    
gb|ABD77287.1|  mitochondrial malate dehydrogenase 2, NAD               261   3e-83    
ref|NP_001265782.1|  malate dehydrogenase, mitochondrial                263   3e-83    
ref|XP_007047658.1|  Malate dehydrogenase isoform 2                     263   3e-83    
ref|XP_004138301.1|  PREDICTED: malate dehydrogenase, chloroplast...    266   3e-83    
gb|KFK25287.1|  hypothetical protein AALP_AA8G092700                    263   3e-83    
ref|XP_004666330.1|  PREDICTED: malate dehydrogenase, mitochondrial     262   3e-83    
ref|XP_006733970.1|  PREDICTED: malate dehydrogenase, mitochondri...    262   3e-83    
dbj|BAJ99028.1|  predicted protein                                      263   3e-83    
gb|ABD77288.1|  mitochondrial malate dehydrogenase 2, NAD               261   3e-83    
ref|XP_004504885.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    263   3e-83    
ref|XP_007067189.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    263   3e-83    
gb|EFX69032.1|  mitochondrial malate dehydrogenase                      262   3e-83    
ref|XP_002873414.1|  peroxisomal NAD-malate dehydrogenase 2             263   3e-83    
ref|XP_004504884.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    263   3e-83    
gb|AIE54283.1|  glyoxisomal malate dehydrogenase                        263   4e-83    
ref|XP_009911306.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    263   4e-83    
ref|XP_009285679.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    265   4e-83    
ref|XP_002072326.1|  GK22386                                            262   4e-83    
ref|XP_009488203.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    263   4e-83    
ref|XP_006346882.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    263   4e-83    
ref|NP_196528.1|  peroxisomal NAD-malate dehydrogenase 2                263   4e-83    
ref|XP_009378560.1|  PREDICTED: malate dehydrogenase, glyoxysomal       263   4e-83    
ref|XP_001659012.1|  AAEL008166-PA                                      265   4e-83    
gb|ABK24757.1|  unknown                                                 263   5e-83    
ref|XP_010617282.1|  PREDICTED: malate dehydrogenase, mitochondri...    262   5e-83    
gb|ETN58378.1|  mitochondrial malate dehydrogenase 2                    262   5e-83    
ref|NP_001119199.1|  peroxisomal NAD-malate dehydrogenase 2             263   6e-83    
ref|XP_002711952.1|  PREDICTED: malate dehydrogenase, mitochondrial     261   6e-83    
ref|XP_007518008.1|  PREDICTED: malate dehydrogenase, mitochondri...    261   6e-83    
ref|XP_010274931.1|  PREDICTED: malate dehydrogenase, chloroplastic     264   6e-83    
ref|XP_007159190.1|  hypothetical protein PHAVU_002G216800g             262   6e-83    
gb|AAL15313.1|  AT5g09660/F17I14_150                                    262   7e-83    
ref|XP_005240619.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    263   7e-83    
ref|XP_010426197.1|  PREDICTED: malate dehydrogenase, chloroplast...    264   7e-83    
ref|NP_112413.2|  malate dehydrogenase, mitochondrial precursor         261   7e-83    
gb|ABD77283.1|  mitochondrial malate dehydrogenase 2, NAD               260   7e-83    
gb|KFP86726.1|  hypothetical protein N310_09243                         261   7e-83    
ref|XP_007209183.1|  hypothetical protein PRUPE_ppa006378mg             264   8e-83    
gb|AAA39509.1|  malate dehydrogenase                                    261   8e-83    
ref|XP_010491605.1|  PREDICTED: malate dehydrogenase 2, glyoxysomal     262   9e-83    
gb|ABD77279.1|  mitochondrial malate dehydrogenase 2, NAD               259   9e-83    
ref|XP_008696758.1|  PREDICTED: malate dehydrogenase, mitochondrial     261   9e-83    
ref|XP_010422957.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    262   1e-82    
ref|XP_010503352.1|  PREDICTED: malate dehydrogenase, chloroplastic     263   1e-82    
ref|XP_004761688.1|  PREDICTED: malate dehydrogenase, mitochondri...    261   1e-82    
ref|XP_005080427.1|  PREDICTED: malate dehydrogenase, mitochondrial     261   1e-82    
gb|ABD77294.1|  mitochondrial malate dehydrogenase 2, NAD               259   1e-82    
ref|XP_010515058.1|  PREDICTED: malate dehydrogenase, chloroplast...    263   1e-82    
ref|XP_003137632.1|  malate dehydrogenase                               261   1e-82    
emb|CAA30274.1|  malate dehydrogenase                                   261   1e-82    
ref|XP_005439992.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    262   1e-82    
gb|ABD77284.1|  mitochondrial malate dehydrogenase 2, NAD               259   1e-82    
ref|NP_032643.2|  malate dehydrogenase, mitochondrial precursor         261   1e-82    
ref|XP_003608327.1|  Malate dehydrogenase                               261   1e-82    
ref|XP_004568150.1|  PREDICTED: malate dehydrogenase, mitochondri...    261   1e-82    
ref|XP_004587040.1|  PREDICTED: malate dehydrogenase, mitochondrial     261   1e-82    
emb|CAG12894.1|  unnamed protein product                                261   2e-82    
gb|ACN40042.1|  unknown                                                 261   2e-82    
ref|XP_006971340.1|  PREDICTED: malate dehydrogenase, mitochondrial     261   2e-82    
ref|XP_002642936.1|  C. briggsae CBR-MDH-1 protein                      261   2e-82    
ref|XP_010300853.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    262   2e-82    
dbj|BAJ85761.1|  predicted protein                                      261   2e-82    
ref|XP_005284503.1|  PREDICTED: malate dehydrogenase, mitochondrial     260   2e-82    
ref|XP_003770242.1|  PREDICTED: malate dehydrogenase, mitochondrial     260   2e-82    
gb|AFA55184.1|  mitochondrial malate dehydrogenase 2                    260   2e-82    
gb|ABK25446.1|  unknown                                                 261   2e-82    
ref|XP_005852212.1|  hypothetical protein CHLNCDRAFT_18230              260   2e-82    
ref|XP_002991275.1|  hypothetical protein SELMODRAFT_133168             261   2e-82    
ref|XP_004688335.1|  PREDICTED: malate dehydrogenase, mitochondrial     260   2e-82    
gb|ACH45801.1|  putative malate dehydrogenase mitochondrial varia...    260   2e-82    
ref|XP_002991213.1|  hypothetical protein SELMODRAFT_133026             261   2e-82    
ref|XP_008056240.1|  PREDICTED: malate dehydrogenase, mitochondrial     260   2e-82    
ref|XP_007041454.1|  Malate dehydrogenase isoform 1                     261   2e-82    
gb|ABD77290.1|  mitochondrial malate dehydrogenase 2, NAD               259   3e-82    
ref|XP_004630505.1|  PREDICTED: malate dehydrogenase, mitochondrial     260   3e-82    
ref|XP_009401399.1|  PREDICTED: malate dehydrogenase, chloroplast...    262   3e-82    
emb|CAA27812.1|  unnamed protein product                                260   3e-82    
ref|XP_006640873.1|  PREDICTED: malate dehydrogenase, mitochondri...    260   3e-82    
gb|ACH45806.1|  putative malate dehydrogenase mitochondrial varia...    260   3e-82    
ref|XP_008372893.1|  PREDICTED: malate dehydrogenase, glyoxysomal       260   3e-82    
ref|XP_004761687.1|  PREDICTED: malate dehydrogenase, mitochondri...    261   3e-82    
gb|EFB20389.1|  hypothetical protein PANDA_012657                       259   4e-82    
ref|XP_009529225.1|  hypothetical protein PHYSODRAFT_286325             259   4e-82    
ref|XP_005396867.1|  PREDICTED: malate dehydrogenase, mitochondrial     259   4e-82    
ref|XP_006291231.1|  hypothetical protein CARUB_v10017362mg             262   4e-82    
ref|XP_006180995.1|  PREDICTED: malate dehydrogenase, mitochondri...    259   4e-82    
ref|XP_010780749.1|  PREDICTED: malate dehydrogenase, mitochondrial     259   4e-82    
ref|XP_001156205.1|  PREDICTED: malate dehydrogenase, mitochondri...    259   4e-82    



>gb|AIY53988.1| malate dehydrogenase [Stylosanthes guianensis]
Length=345

 Score =   359 bits (922),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV +LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSH+NTRSEVVG+ G+ 
Sbjct  34   RKVVVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHVNTRSEVVGYQGEG  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AI+KYCP ALVNMISNPV
Sbjct  94   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAISKYCPKALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA V VAEVNVPVIGGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVIGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL HDVIV LT RTQDGGT
Sbjct  214  ILPLFSQATPQANLDHDVIVALTKRTQDGGT  244



>ref|XP_006592546.1| PREDICTED: malate dehydrogenase, mitochondrial [Glycine max]
 gb|AAD56659.1| malate dehydrogenase [Glycine max]
Length=345

 Score =   359 bits (921),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAAD+SHINTRSEVVG+ GDE
Sbjct  34   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADISHINTRSEVVGYQGDE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHALVNMISNPV
Sbjct  94   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKTLCTAIAKYCPHALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV VA VNVPV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAGVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  DVI  LT RTQDGGT
Sbjct  214  ILPLFSQATPKANLDDDVIKALTKRTQDGGT  244



>emb|CAD33240.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=346

 Score =   358 bits (918),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRSEVVGF+G+E
Sbjct  34   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSEVVGFAGEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  94   QLGKALEGADIVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVT LDVVRAKTFYAGKA VNVAEVN+PV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKKLFGVTMLDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+++ IV LT RTQDGGT
Sbjct  214  ILPLFSQATPKANLSNEEIVALTKRTQDGGT  244



>emb|CAD33241.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
 emb|CAD33242.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=342

 Score =   358 bits (918),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRSEVVGF+G+E
Sbjct  30   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSEVVGFAGEE  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  90   QLGKALEGADIVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVT LDVVRAKTFYAGKA VNVAEVN+PV+GGHAGIT
Sbjct  150  NSTVPIAAEVFKKAGTYDEKKLFGVTMLDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGIT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+++ IV LT RTQDGGT
Sbjct  210  ILPLFSQATPKANLSNEEIVALTKRTQDGGT  240



>ref|XP_009611177.1| PREDICTED: malate dehydrogenase 2, mitochondrial [Nicotiana tomentosiformis]
Length=341

 Score =   357 bits (917),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V GF+GDE
Sbjct  29   RKVAILGAAGGIGQPLSLLMKLNPLVSQLSLYDIAGTPGVAADVSHINTRSQVSGFAGDE  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVNMISNPV
Sbjct  89   QLGQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNVA+V VPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVADVIVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLGDEEIEALTKRTQDGGT  239



>gb|AFK45866.1| unknown [Lotus japonicus]
Length=341

 Score =   357 bits (915),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV +LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAA VSHINTRSEVVG+ G+E
Sbjct  30   RKVVVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAAAVSHINTRSEVVGYQGEE  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCPHALVNMISNPV
Sbjct  90   QLGKALEGADIVIIPAGVPRKPGMTRDDLFNINAGIVKGLCSAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDE+RLFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  150  NSTVPIAAEVFKKAGTYDERRLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVVGGHAGIT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL HD+I  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLDHDLIQALTKRTQDGGT  240



>gb|AAB99755.1| malate dehydrogenase precursor [Medicago sativa]
Length=343

 Score =   356 bits (914),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+RS+V G++G++
Sbjct  31   RKVAILGAAGGIGQPLSLLMKLNPLVSTLSLYDIAGTPGVAADVSHINSRSQVTGYAGED  90

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL+ AI+KYCPHALVNMISNPV
Sbjct  91   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLATAISKYCPHALVNMISNPV  150

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  151  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  210

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL  DVI  LT RTQDGGT
Sbjct  211  ILPLFSQASPQANLDDDVIKALTARTQDGGT  241



>gb|KEH19547.1| malate dehydrogenase [Medicago truncatula]
Length=343

 Score =   356 bits (914),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+RS+V G++G++
Sbjct  31   RKVAILGAAGGIGQPLSLLMKLNPLVSTLSLYDIAGTPGVAADVSHINSRSQVTGYAGED  90

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL+ AI+KYCPHALVNMISNPV
Sbjct  91   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLATAISKYCPHALVNMISNPV  150

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  151  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  210

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL  DVI  LT RTQDGGT
Sbjct  211  ILPLFSQASPQANLDDDVIKALTARTQDGGT  241



>ref|NP_001234001.1| mitochondrial malate dehydrogenase [Solanum lycopersicum]
 gb|AAU29198.1| mitochondrial malate dehydrogenase [Solanum lycopersicum]
Length=346

 Score =   356 bits (913),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRSEV GF+G+E
Sbjct  34   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSEVAGFAGEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  94   QLGQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVT LDVVRAKTFYAGKA VNVAEVN+PV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKKLFGVTMLDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+++ IV LT RTQDGGT
Sbjct  214  ILPLFSQATPKANLSYEEIVALTKRTQDGGT  244



>ref|NP_001276183.1| malate dehydrogenase, mitochondrial-like [Glycine max]
 gb|ACU17786.1| unknown [Glycine max]
Length=345

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINT SEVVG+ GDE
Sbjct  34   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINTGSEVVGYQGDE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIV++L  AIAKYCPHALVNMISNPV
Sbjct  94   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVETLCTAIAKYCPHALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV VA VNVPV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAGVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  DVI  LT RTQDGGT
Sbjct  214  ILPLFSQATPKANLDDDVIKALTKRTQDGGT  244



>ref|XP_004510039.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Cicer arietinum]
Length=345

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DI GTPGVAADVSHIN+RSEV G+ G+E
Sbjct  33   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIGGTPGVAADVSHINSRSEVAGYQGEE  92

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVNMISNPV
Sbjct  93   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNMISNPV  152

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV VAEVNVPV+GGHAG+T
Sbjct  153  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVVGGHAGVT  212

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ D I  LT RTQ+GGT
Sbjct  213  ILPLFSQATPKANLSDDYIKALTKRTQEGGT  243



>ref|XP_009335198.1| PREDICTED: malate dehydrogenase, mitochondrial [Pyrus x bretschneideri]
Length=339

 Score =   355 bits (910),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVSHLSL+DIAGTPGVAADVSHINTRSEV G++G+E
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSHLSLYDIAGTPGVAADVSHINTRSEVKGYAGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+ AIAKYCP+AL+NMISNPV
Sbjct  87   QLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTTAIAKYCPNALINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KKAG YDEKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVLKKAGKYDEKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL HDVIV LT RTQDGGT
Sbjct  207  ILPLFSQATPAANLPHDVIVALTKRTQDGGT  237



>gb|AIE54296.1| mitochondrial malate dehydrogenase [Nicotiana tabacum]
Length=341

 Score =   355 bits (910),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V GF+GDE
Sbjct  29   RKVAILGAAGGIGQPLSLLMKLNPLVSQLSLYDIAGTPGVAADVSHINTRSQVSGFAGDE  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVNMISNPV
Sbjct  89   QLRQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNVA+  VPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVADAIVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLGDEEIEALTKRTQDGGT  239



>gb|KFK35713.1| hypothetical protein AALP_AA4G027400 [Arabis alpina]
Length=341

 Score =   354 bits (909),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GDE
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDE  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L AAIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCAAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VA+VNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVADVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSDDVLTALTKRTQDGGT  240



>ref|XP_009760199.1| PREDICTED: malate dehydrogenase 2, mitochondrial [Nicotiana sylvestris]
Length=341

 Score =   354 bits (909),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V GF+GDE
Sbjct  29   RKVAILGAAGGIGQPLSLLMKLNPLVSQLSLYDIAGTPGVAADVSHINTRSQVSGFAGDE  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVNMISNPV
Sbjct  89   QLRQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNVA+V VPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVADVIVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLGDEEIEALTKRTQDGGT  239



>ref|NP_001275034.1| malate dehydrogenase, mitochondrial-like [Solanum tuberosum]
 emb|CAD33244.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=346

 Score =   354 bits (909),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSL MKLNPLVS LSL+DIAGTPGVAADVSHINTRSEVVGF+G+E
Sbjct  34   RKVAVLGAAGGIGQPLSLPMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSEVVGFAGEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  94   QLGKALEGADIVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVT LDVVRAKTFYAGKA VNVAEVN+PV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKKLFGVTMLDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+++ IV LT RTQDGGT
Sbjct  214  ILPLFSQATPKANLSNEEIVALTKRTQDGGT  244



>ref|XP_010108267.1| Malate dehydrogenase 1 [Morus notabilis]
 gb|EXC18507.1| Malate dehydrogenase 1 [Morus notabilis]
Length=349

 Score =   354 bits (909),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVSHLSL+DIA TPGVAADVSHINTRSEV G++G+E
Sbjct  37   RKVAVLGAAGGIGQPLALLMKLNPLVSHLSLYDIAATPGVAADVSHINTRSEVKGYAGEE  96

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            N+ +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVNMISNPV
Sbjct  97   NIREALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNMISNPV  156

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA   VAEVNVPV+GGHAGIT
Sbjct  157  NSTVPIASEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKAPVAEVNVPVVGGHAGIT  216

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ + I  LT RTQDGGT
Sbjct  217  ILPLFSQATPQANLSAEDITALTKRTQDGGT  247



>ref|XP_008367914.1| PREDICTED: malate dehydrogenase, mitochondrial [Malus domestica]
Length=339

 Score =   353 bits (907),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVSHLSL+DIAGTPGVAADVSHINTRSEV G++G+E
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSHLSLYDIAGTPGVAADVSHINTRSEVKGYAGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+ AIAKYCP+AL+NMISNPV
Sbjct  87   QLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTTAIAKYCPNALINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KKAG YDEKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAG+T
Sbjct  147  NSTVPIAAEVLKKAGKYDEKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGVT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL HDVIV LT RTQDGGT
Sbjct  207  ILPLFSQATPAANLPHDVIVALTKRTQDGGT  237



>ref|XP_008226502.1| PREDICTED: malate dehydrogenase, mitochondrial [Prunus mume]
Length=339

 Score =   353 bits (906),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVSHLSL+DIAGTPGVAADVSHINTRSEV G++G++
Sbjct  27   RKVAVLGAAGGIGQPLSLLMKLNPLVSHLSLYDIAGTPGVAADVSHINTRSEVKGYAGED  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+AAIAKYCP+AL+NMISNPV
Sbjct  87   QLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTAAIAKYCPNALINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KKAG YDEKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVLKKAGKYDEKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL HDVI  LT RTQDGGT
Sbjct  207  ILPLFSQATPTANLPHDVIKALTKRTQDGGT  237



>ref|XP_006358950.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Solanum 
tuberosum]
Length=341

 Score =   353 bits (906),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTRSE++G++G+E
Sbjct  30   RKVAILGAAGGIGQPLSLLMKLNPLVSRLALYDIAGTPGVAADVSHINTRSEILGYAGEE  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVN+ISNPV
Sbjct  90   QLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNVISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNVA+V VPV+GGHAG+T
Sbjct  150  NSTVPIASEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVADVIVPVVGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL+ + I  LT RTQDGGT
Sbjct  210  ILPLFSQATPSANLSSEEIEALTKRTQDGGT  240



>ref|XP_007133189.1| hypothetical protein PHAVU_011G159000g [Phaseolus vulgaris]
 gb|ESW05183.1| hypothetical protein PHAVU_011G159000g [Phaseolus vulgaris]
Length=345

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+VVG+ G+E
Sbjct  34   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSKVVGYQGEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK+L  AI+KYCPHALVNMISNPV
Sbjct  94   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKALCTAISKYCPHALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV V  VNVPV+GGHAGIT
Sbjct  154  NSTVPIAAEIFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVDGVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  D+I  LT RTQ+GGT
Sbjct  214  ILPLFSQATPKANLDDDIIKALTKRTQEGGT  244



>ref|NP_001274946.1| malate dehydrogenase, mitochondrial-like [Solanum tuberosum]
 emb|CAD33243.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=344

 Score =   353 bits (905),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTRSE++G++G+E
Sbjct  30   RKVAILGAAGGIGQPLSLLMKLNPLVSRLALYDIAGTPGVAADVSHINTRSEILGYAGEE  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVN+ISNPV
Sbjct  90   QLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNVISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNVA+V VPV+GGHAG+T
Sbjct  150  NSTVPIASEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVADVIVPVVGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL+ + I  LT RTQDGGT
Sbjct  210  ILPLFSQATPSANLSSEEIEALTKRTQDGGT  240



>ref|XP_010313914.1| PREDICTED: malate dehydrogenase, mitochondrial [Solanum lycopersicum]
Length=342

 Score =   352 bits (904),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTRSE++G++G+E
Sbjct  31   RKVAILGAAGGIGQPLSLLMKLNPLVSRLALYDIAGTPGVAADVSHINTRSEILGYAGEE  90

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVN+ISNPV
Sbjct  91   QLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNVISNPV  150

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNVA+VNVPV+GGHAG+T
Sbjct  151  NSTVPIASEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVADVNVPVVGGHAGVT  210

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL+ + I  LT RTQDGGT
Sbjct  211  ILPLFSQATPSANLSSEDIQALTKRTQDGGT  241



>ref|XP_009593526.1| PREDICTED: malate dehydrogenase, mitochondrial [Nicotiana tomentosiformis]
Length=346

 Score =   352 bits (904),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V GF+G++
Sbjct  34   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSQVAGFAGED  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  94   QLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNV++V VPV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVSDVIVPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPL SQATP+ANL+ + IV LT RTQDGGT
Sbjct  214  ILPLLSQATPKANLSDEEIVALTKRTQDGGT  244



>ref|XP_009340262.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Pyrus x 
bretschneideri]
 gb|ADU20200.1| mitochondrial NAD-dependent malic acid dehydrogenase [Pyrus pyrifolia]
Length=339

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVSHLSL+DIAGTPGVAADVSHINTRSEV G++G+E
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSHLSLYDIAGTPGVAADVSHINTRSEVKGYAGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+ AIAKYCP+AL+NMISNPV
Sbjct  87   QLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTTAIAKYCPNALINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KKAG YDEKRLFGVTTLDVVRAKTFYAGKAN NVAEVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVLKKAGKYDEKRLFGVTTLDVVRAKTFYAGKANANVAEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL HDVI  LT RTQDGGT
Sbjct  207  ILPLFSQATPTANLPHDVIKALTKRTQDGGT  237



>emb|CDY55845.1| BnaCnng29330D [Brassica napus]
Length=341

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  240



>emb|CDY25868.1| BnaA05g14590D [Brassica napus]
Length=341

 Score =   352 bits (903),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  240



>ref|XP_002894430.1| mitochondrial malate dehydrogenase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70689.1| mitochondrial malate dehydrogenase [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   352 bits (902),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSSDVLTALTKRTQDGGT  240



>emb|CDP05985.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADVSHINTRSEVVGF G+E
Sbjct  39   RKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIAGTPGVAADVSHINTRSEVVGFMGEE  98

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVNMISNPV
Sbjct  99   QLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNMISNPV  158

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA VNVAEVNVPV+GGHAGIT
Sbjct  159  NSTVPIASEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVNVAEVNVPVVGGHAGIT  218

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  219  ILPLFSQATPKANLPDEDIKALTKRTQDGGT  249



>ref|XP_010277741.1| PREDICTED: malate dehydrogenase, mitochondrial [Nelumbo nucifera]
Length=350

 Score =   352 bits (902),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHINTRSEV GF G++
Sbjct  38   RKVAILGAAGGIGQPLALLMKLNPLVSKLSLYDIAGTPGVAADVSHINTRSEVAGFMGED  97

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  98   QLGQALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  157

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V V+EVNVPV+GGHAGIT
Sbjct  158  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVPVSEVNVPVVGGHAGIT  217

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP++NLA D I  LT RTQDGGT
Sbjct  218  ILPLFSQATPKSNLADDEIAALTKRTQDGGT  248



>ref|XP_009803762.1| PREDICTED: malate dehydrogenase, mitochondrial [Nicotiana sylvestris]
Length=346

 Score =   352 bits (902),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V GF+G++
Sbjct  34   RKVAILGAAGGIGQPLSLLMKLNPLVSTLSLYDIAGTPGVAADVSHINTRSQVAGFAGED  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  94   QLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA VNV++V VPV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVNVSDVIVPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPL SQATP+ANL+ + IV LT RTQDGGT
Sbjct  214  ILPLLSQATPKANLSDEEIVALTKRTQDGGT  244



>ref|XP_007213810.1| hypothetical protein PRUPE_ppa008270mg [Prunus persica]
 gb|EMJ15009.1| hypothetical protein PRUPE_ppa008270mg [Prunus persica]
Length=339

 Score =   351 bits (901),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVSHLSL+DIAGTPGVAADVSHINTRSEV G++G++
Sbjct  27   RKVAVLGAAGGIGQPLSLLMKLNPLVSHLSLYDIAGTPGVAADVSHINTRSEVKGYAGED  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+AAIAKYCP+AL+NMISNPV
Sbjct  87   QLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTAAIAKYCPNALINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KKAG YD+KRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVLKKAGKYDDKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL HDVI  LT RTQDGGT
Sbjct  207  ILPLFSQATPTANLPHDVIKALTKRTQDGGT  237



>gb|AHN85657.1| mitochondrial malate dehydrogenase [Prunus persica]
Length=339

 Score =   351 bits (900),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVSHLSL+DIAGTPGVAADVSHINTRSEV G++G++
Sbjct  27   RKVAVLGAAGGIGQPLSLLMKLNPLVSHLSLYDIAGTPGVAADVSHINTRSEVKGYAGED  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+AAIAKYCP+AL+NMISNPV
Sbjct  87   QLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTAAIAKYCPNALINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KKAG YD+KRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVLKKAGKYDDKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP ANL HDVI  LT RTQDGGT
Sbjct  207  ILPLFSQATPTANLPHDVIKALTKRTQDGGT  237



>ref|XP_006305270.1| hypothetical protein CARUB_v10009646mg [Capsella rubella]
 gb|EOA38168.1| hypothetical protein CARUB_v10009646mg [Capsella rubella]
Length=341

 Score =   351 bits (900),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  240



>ref|XP_009106989.1| PREDICTED: malate dehydrogenase 1, mitochondrial [Brassica rapa]
Length=341

 Score =   351 bits (900),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRS+VVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSQVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  240



>emb|CDY26002.1| BnaC06g06220D [Brassica napus]
Length=343

 Score =   351 bits (900),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSLFDIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  32   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLFDIANTPGVAADVGHINTRSEVVGYMGDD  91

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  92   ELAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPV  151

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  152  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  211

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  212  ILPLFSQATPQANLSSDVLTALTKRTQDGGT  242



>sp|P17783.1|MDHM_CITLA RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Citrullus lanatus]
 emb|CAA35239.1| unnamed protein product [Citrullus lanatus subsp. vulgaris]
Length=347

 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADV H+NTRSEV G+ G+E
Sbjct  35   RKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIAGTPGVAADVGHVNTRSEVTGYVGEE  94

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+AL+NMISNPV
Sbjct  95   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALINMISNPV  154

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAGIT
Sbjct  155  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGIT  214

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ D IV LT RTQDGGT
Sbjct  215  ILPLFSQATPRANLSDDTIVALTKRTQDGGT  245



>ref|XP_010542305.1| PREDICTED: malate dehydrogenase 1, mitochondrial [Tarenaya hassleriana]
Length=342

 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADVSHINTRS+VVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVSHINTRSQVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NLGKALEGAD+V+IPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHA+VNMISNPV
Sbjct  90   NLGKALEGADLVVIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHAIVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPV+GGHAG+T
Sbjct  150  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVVGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ + I  LT RTQDGGT
Sbjct  210  ILPLFSQATPKANLSDEDINALTKRTQDGGT  240



>gb|AAM64855.1| mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
Length=341

 Score =   350 bits (898),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRA+TFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRARTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ D++  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSSDILTALTKRTQDGGT  240



>ref|NP_564625.1| malate dehydrogenase 1 [Arabidopsis thaliana]
 sp|Q9ZP06.1|MDHM1_ARATH RecName: Full=Malate dehydrogenase 1, mitochondrial; AltName: 
Full=mNAD-MDH 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG40021.1|AF324670_1 At1g53240 [Arabidopsis thaliana]
 gb|AAK00366.1|AF339684_1 putative mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 emb|CAA10320.1| mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL32658.1| similar to mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM91183.1| similar to mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE32910.1| malate dehydrogenase 1 [Arabidopsis thaliana]
Length=341

 Score =   350 bits (898),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRA+TFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRARTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ D++  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSSDILTALTKRTQDGGT  240



>ref|XP_006392810.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
 gb|ESQ30096.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
Length=313

 Score =   349 bits (895),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEV G+ GD+
Sbjct  86   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVAGYMGDD  145

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  146  NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  205

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  206  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  265

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  266  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  296



>emb|CDY02518.1| BnaA08g01250D [Brassica napus]
Length=341

 Score =   350 bits (897),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSLFDIA TPGVAADV HINTRS+VVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLFDIANTPGVAADVGHINTRSQVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  90   ELAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  240



>emb|CDY24107.1| BnaA06g01050D [Brassica napus]
Length=340

 Score =   348 bits (894),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSLFDIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  29   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLFDIANTPGVAADVGHINTRSEVVGYMGDD  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L KAL GAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  89   ELAKALAGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  149  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL++DV+  LT RTQDGGT
Sbjct  209  ILPLFSQATPQANLSNDVLTALTKRTQDGGT  239



>gb|KFK38851.1| hypothetical protein AALP_AA3G168500 [Arabis alpina]
Length=341

 Score =   348 bits (894),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADV HINTRSEV GF GD+
Sbjct  30   RKVVILGAAGGIGQPLSLLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVAGFMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+LS AIAKYCP ALVNMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLSIAIAKYCPQALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANVNVA+VNVPV+GGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVNVADVNVPVVGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL+ D+I  LT RTQDGGT
Sbjct  210  ILPLFSQASPQANLSDDLIRALTKRTQDGGT  240



>ref|XP_008451713.1| PREDICTED: malate dehydrogenase, mitochondrial [Cucumis melo]
Length=347

 Score =   348 bits (894),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADV H+NTRSEV G+ G+E
Sbjct  35   RKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIAGTPGVAADVGHVNTRSEVTGYVGEE  94

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  95   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  154

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKA TYDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAGIT
Sbjct  155  NSTVPIAAEVFKKANTYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGIT  214

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  D IV LT RTQDGGT
Sbjct  215  ILPLFSQATPKANLTDDTIVALTKRTQDGGT  245



>ref|XP_002882909.1| hypothetical protein ARALYDRAFT_478929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59168.1| hypothetical protein ARALYDRAFT_478929 [Arabidopsis lyrata subsp. 
lyrata]
Length=337

 Score =   348 bits (893),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADV HINTRS+V G+ GD+
Sbjct  26   RKVVILGAAGGIGQPLSLLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSQVSGYMGDD  85

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NLGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+LS AIAKYCP ALVNMISNPV
Sbjct  86   NLGKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLSIAIAKYCPQALVNMISNPV  145

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAGTYDEK+LFGVTTLDVVRAKTFYAGK+N+NVAEVNVPV+GGHAGIT
Sbjct  146  NSTVPIAAEIFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKSNLNVAEVNVPVVGGHAGIT  205

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL+ D+I  LT RTQDGGT
Sbjct  206  ILPLFSQASPQANLSDDLIKALTKRTQDGGT  236



>emb|CDY59402.1| BnaC03g78200D [Brassica napus]
Length=341

 Score =   348 bits (893),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRS+VVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSQVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  90   ELAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  240



>sp|P83373.1|MDHM_FRAAN RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Fragaria x ananassa]
Length=339

 Score =   348 bits (892),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHINTRSEV G++G+E
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSQLSLYDIAGTPGVAADVSHINTRSEVKGYAGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG DVVIIPAGVPRKPGMTRDDLFNINAGIV+SL+AAIAKYCPHA++NMISNPV
Sbjct  87   QLGEALEGCDVVIIPAGVPRKPGMTRDDLFNINAGIVRSLTAAIAKYCPHAIINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EV KKAG YDEK+LFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  147  NSTVPIASEVLKKAGVYDEKKLFGVTTLDVVRAKTFYAGKAGVPVAEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ D I  LT RTQDGGT
Sbjct  207  ILPLFSQATPKANLSDDYIKALTKRTQDGGT  237



>ref|XP_004294095.1| PREDICTED: malate dehydrogenase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHINTRSEV G++G+E
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSQLSLYDIAGTPGVAADVSHINTRSEVKGYAGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG DVVIIPAGVPRKPGMTRDDLFNINAGIV+SL+AAIAKYCPHA++NMISNPV
Sbjct  87   QLGEALEGCDVVIIPAGVPRKPGMTRDDLFNINAGIVRSLTAAIAKYCPHAIINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EV KKAG YDEK+LFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  147  NSTVPIASEVLKKAGVYDEKKLFGVTTLDVVRAKTFYAGKAGVPVAEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ D I  LT RTQDGGT
Sbjct  207  ILPLFSQATPKANLSDDYIKALTKRTQDGGT  237



>ref|XP_010479877.1| PREDICTED: malate dehydrogenase 1, mitochondrial [Camelina sativa]
Length=341

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRS+V G+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSDVAGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQASPQANLSSDVLTALTKRTQDGGT  240



>ref|XP_010500961.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Camelina 
sativa]
Length=341

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRS+V G+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSDVAGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQASPQANLSSDVLTALTKRTQDGGT  240



>ref|XP_010462202.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Camelina 
sativa]
Length=341

 Score =   347 bits (890),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRS+V G+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSDVTGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL+ DV+  LT RTQDGGT
Sbjct  210  ILPLFSQASPQANLSSDVLTALTKRTQDGGT  240



>ref|XP_006392812.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
 gb|ESQ30098.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
Length=397

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEV G+ GD+
Sbjct  86   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVAGYMGDD  145

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  146  NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  205

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  206  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  265

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  266  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  296



>ref|XP_009147616.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Brassica 
rapa]
Length=340

 Score =   346 bits (888),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSLFDIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  29   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLFDIANTPGVAADVGHINTRSEVVGYMGDD  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L KALEGAD+VII AGVPRKPGMTRDDL+NINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  89   ELAKALEGADLVIIHAGVPRKPGMTRDDLYNINAGIVKNLCSAIAKYCPHALVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  149  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL++DV+  LT RTQDGGT
Sbjct  209  ILPLFSQATPQANLSNDVLTALTKRTQDGGT  239



>ref|NP_001078156.1| malate dehydrogenase 2 [Arabidopsis thaliana]
 gb|AEE75605.1| malate dehydrogenase 2 [Arabidopsis thaliana]
Length=316

 Score =   345 bits (886),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADV HINTRS+V G+ GD+
Sbjct  30   RKVVILGAAGGIGQPLSLLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSQVSGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            +LGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+LS AIAKYCP ALVNMISNPV
Sbjct  90   DLGKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLSIAIAKYCPQALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAGTYDEK+LFGVTTLDVVRA+TFYAGK++VNVAEVNVPV+GGHAGIT
Sbjct  150  NSTVPIAAEIFKKAGTYDEKKLFGVTTLDVVRARTFYAGKSDVNVAEVNVPVVGGHAGIT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL+ D+I  LT RTQDGGT
Sbjct  210  ILPLFSQASPQANLSDDLIRALTKRTQDGGT  240



>ref|XP_004137217.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004156521.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
 gb|KGN53596.1| Malate dehydrogenase, mitochondrial [Cucumis sativus]
Length=347

 Score =   347 bits (889),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DI  TPGVAADV H+NTRSEV G+ G+E
Sbjct  35   RKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIGATPGVAADVGHVNTRSEVTGYMGEE  94

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  95   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  154

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV VAEVNVPV+GGHAGIT
Sbjct  155  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVVGGHAGIT  214

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  D IV LT RTQDGGT
Sbjct  215  ILPLFSQATPKANLTDDTIVALTKRTQDGGT  245



>ref|XP_011006727.1| PREDICTED: malate dehydrogenase, mitochondrial [Populus euphratica]
 ref|XP_011010080.1| PREDICTED: malate dehydrogenase, mitochondrial [Populus euphratica]
Length=344

 Score =   345 bits (886),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS+L+L+DIA TPGVAADVSHINTRSEVVG++ D 
Sbjct  33   RKVAVLGAAGGIGQPLSLLMKLNPLVSNLALYDIANTPGVAADVSHINTRSEVVGYASDA  92

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AIAK+CP ALVNMISNPV
Sbjct  93   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCEAIAKHCPKALVNMISNPV  152

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYD KRLFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  153  NSTVPIAAEVFKKAGTYDPKRLFGVTTLDVVRAKTFYAGKAMVPVAEVNVPVVGGHAGIT  212

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ +VI  LT RTQDGGT
Sbjct  213  ILPLFSQATPKANLSDEVITALTKRTQDGGT  243



>ref|NP_188120.1| malate dehydrogenase 2 [Arabidopsis thaliana]
 sp|Q9LKA3.1|MDHM2_ARATH RecName: Full=Malate dehydrogenase 2, mitochondrial; AltName: 
Full=mNAD-MDH 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA97065.1| NAD-dependent malate dehydrogenase [Arabidopsis thaliana]
 gb|AAK73950.1| AT3g15020/K15M2_16 [Arabidopsis thaliana]
 gb|AAM10404.1| AT3g15020/K15M2_16 [Arabidopsis thaliana]
 gb|AEE75604.1| malate dehydrogenase 2 [Arabidopsis thaliana]
Length=341

 Score =   345 bits (886),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADV HINTRS+V G+ GD+
Sbjct  30   RKVVILGAAGGIGQPLSLLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSQVSGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            +LGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+LS AIAKYCP ALVNMISNPV
Sbjct  90   DLGKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLSIAIAKYCPQALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAGTYDEK+LFGVTTLDVVRA+TFYAGK++VNVAEVNVPV+GGHAGIT
Sbjct  150  NSTVPIAAEIFKKAGTYDEKKLFGVTTLDVVRARTFYAGKSDVNVAEVNVPVVGGHAGIT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL+ D+I  LT RTQDGGT
Sbjct  210  ILPLFSQASPQANLSDDLIRALTKRTQDGGT  240



>ref|XP_007021667.1| Lactate/malate dehydrogenase family protein [Theobroma cacao]
 gb|EOY13192.1| Lactate/malate dehydrogenase family protein [Theobroma cacao]
Length=339

 Score =   345 bits (885),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSHINTRSEV G+ G+E
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSQLALYDIANTPGVAADVSHINTRSEVAGYVGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK L AAIAKYCP+ALVNMISNPV
Sbjct  87   QLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCAAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDE++LFGVTTLDVVRAKTFYAGKA V VA+VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDERKLFGVTTLDVVRAKTFYAGKAKVPVADVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPKANLSEEEITALTKRTQDGGT  237



>ref|XP_002316794.1| Malate dehydrogenase family protein [Populus trichocarpa]
 gb|ABK94163.1| unknown [Populus trichocarpa]
 gb|EEE97406.1| Malate dehydrogenase family protein [Populus trichocarpa]
Length=341

 Score =   345 bits (884),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSHINTRSEV G+SG+ 
Sbjct  30   RKVAVLGAAGGIGQPLALLMKLNPLVSSLALYDIANTPGVAADVSHINTRSEVSGYSGEA  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AIAKYCPHALVNMISNPV
Sbjct  90   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCQAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYD KRLFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  150  NSTVPIAAEVFKKAGTYDPKRLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVVGGHAGIT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+   I  LT RTQDGGT
Sbjct  210  ILPLFSQATPKANLSDAEITALTKRTQDGGT  240



>gb|KJB61647.1| hypothetical protein B456_009G372600 [Gossypium raimondii]
Length=313

 Score =   343 bits (880),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSHIN+RSEV G+ G+E
Sbjct  26   RKVAVLGAAGGIGQPLALLMKLNPLVSQLALYDIANTPGVAADVSHINSRSEVAGYVGEE  85

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+ALVNMISNPV
Sbjct  86   QLGKALEGCDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCSAIAKYCPNALVNMISNPV  145

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA VNVA+VNVPV+GGHAGIT
Sbjct  146  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVNVADVNVPVVGGHAGIT  205

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  206  ILPLFSQATPKANLPEEDIKALTKRTQDGGT  236



>ref|NP_001268095.1| malate dehydrogenase [Vitis vinifera]
 gb|AAF69802.1|AF195869_1 malate dehydrogenase [Vitis vinifera]
Length=352

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V G+ GD+
Sbjct  38   RKVAVLGAAGGIGQPLALLMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSQVAGYMGDD  97

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  98   QLGQALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  157

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V VAE NVPV+GGHAGIT
Sbjct  158  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVPVAEANVPVVGGHAGIT  217

Query  542  ILPLFSQATPQA-NLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP++ NL+ + IV LT RTQDGGT
Sbjct  218  ILPLFSQATPKSNNLSDEDIVALTKRTQDGGT  249



>gb|KJB61646.1| hypothetical protein B456_009G372600 [Gossypium raimondii]
Length=338

 Score =   343 bits (881),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSHIN+RSEV G+ G+E
Sbjct  26   RKVAVLGAAGGIGQPLALLMKLNPLVSQLALYDIANTPGVAADVSHINSRSEVAGYVGEE  85

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+ALVNMISNPV
Sbjct  86   QLGKALEGCDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCSAIAKYCPNALVNMISNPV  145

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA VNVA+VNVPV+GGHAGIT
Sbjct  146  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVNVADVNVPVVGGHAGIT  205

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  206  ILPLFSQATPKANLPEEDIKALTKRTQDGGT  236



>ref|XP_002300420.2| Malate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE85225.2| Malate dehydrogenase family protein [Populus trichocarpa]
Length=344

 Score =   343 bits (879),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQ LSLLMKLNPLVS+L+L+DIA TPGVAADVSHINTRSEVVG++ D 
Sbjct  33   RKVAVLGAAGGIGQSLSLLMKLNPLVSNLALYDIANTPGVAADVSHINTRSEVVGYASDA  92

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AIAK+CP+ALVNMISNPV
Sbjct  93   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCEAIAKHCPNALVNMISNPV  152

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYD KRLFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  153  NSTVPIAAEVFKKAGTYDPKRLFGVTTLDVVRAKTFYAGKAMVPVAEVNVPVVGGHAGIT  212

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ +VI  LT RTQDGGT
Sbjct  213  ILPLFSQATPKANLSDEVITALTKRTQDGGT  243



>ref|XP_011044945.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Populus 
euphratica]
Length=340

 Score =   342 bits (878),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSHINTRSEV G+SG+ 
Sbjct  29   RKVAVLGAAGGIGQPLALLMKLNPLVSSLALYDIANTPGVAADVSHINTRSEVSGYSGEA  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AIAKYCP ALVNMISNPV
Sbjct  89   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCQAIAKYCPQALVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYD KRLFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYDPKRLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+   I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLSDAEITALTKRTQDGGT  239



>ref|XP_006852481.1| hypothetical protein AMTR_s00021p00133930 [Amborella trichopoda]
 gb|ERN13948.1| hypothetical protein AMTR_s00021p00133930 [Amborella trichopoda]
Length=344

 Score =   343 bits (879),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V GF+G++
Sbjct  31   RKVAVLGAAGGIGQPLALLMKLNPLVSSLSLYDIAGTPGVAADVSHINTRSQVAGFTGED  90

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCPHAL+NMISNPV
Sbjct  91   QLGQALEGCDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALINMISNPV  150

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V V +VNVPV+GGHAGIT
Sbjct  151  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVPVEQVNVPVVGGHAGIT  210

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQA P++N L+ + I  LT RTQDGGT
Sbjct  211  ILPLFSQANPKSNALSDEEIQALTKRTQDGGT  242



>gb|AAF69549.1|AC008007_24 F12M16.14 [Arabidopsis thaliana]
Length=352

 Score =   342 bits (877),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/222 (83%), Positives = 198/222 (89%), Gaps = 11/222 (5%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEVVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVRA+TFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRARTFYAGKANVPVAEVNVPVIGGHAGVT  209

Query  542  ILPLFSQ-----------ATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQ           ATPQANL+ D++  LT RTQDGGT
Sbjct  210  ILPLFSQVSSHFLSTQTVATPQANLSSDILTALTKRTQDGGT  251



>gb|KDP32500.1| hypothetical protein JCGZ_14703 [Jatropha curcas]
Length=345

 Score =   341 bits (875),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS+L+L+DIA TPGVAADVSHINTRSEV G+ G++
Sbjct  34   RKVAVLGAAGGIGQPLALLMKLNPLVSNLALYDIANTPGVAADVSHINTRSEVKGYVGED  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AI+KYCP+ALVNMISNPV
Sbjct  94   QLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCQAISKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ + I  LT RTQDGGT
Sbjct  214  ILPLFSQATPKANLSSEDIEALTKRTQDGGT  244



>ref|XP_002524262.1| malate dehydrogenase, putative [Ricinus communis]
 gb|EEF38101.1| malate dehydrogenase, putative [Ricinus communis]
Length=345

 Score =   341 bits (874),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS+L+L+DIA TPGVAADVSHINTRS+V G+ G++
Sbjct  34   RKVAVLGAAGGIGQPLALLMKLNPLVSNLALYDIANTPGVAADVSHINTRSDVKGYVGED  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AIAKYCP+ALVNMISNPV
Sbjct  94   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCEAIAKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPL SQATP+ANL  + IV LT RTQDGGT
Sbjct  214  ILPLLSQATPKANLPDEEIVALTKRTQDGGT  244



>ref|XP_011098245.1| PREDICTED: malate dehydrogenase, mitochondrial [Sesamum indicum]
Length=347

 Score =   340 bits (873),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTRSEV G++ +E
Sbjct  35   RKVAILGAAGGIGQPLSLLMKLNPLVSRLALYDIAGTPGVAADVSHINTRSEVKGYAAEE  94

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLF INAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  95   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFKINAGIVKSLCEAIAKYCPNALVNMISNPV  154

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFK  G YDE++LFGVTTLDVVRAKTFYAGKA VNVA+VNVPVIGGHAGIT
Sbjct  155  NSTVPIAAEVFKSKGVYDERKLFGVTTLDVVRAKTFYAGKAKVNVADVNVPVIGGHAGIT  214

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ + I  LT RTQDGGT
Sbjct  215  ILPLFSQATPKANLSDEDIKALTKRTQDGGT  245



>ref|XP_010279077.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Nelumbo 
nucifera]
Length=351

 Score =   341 bits (874),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 198/212 (93%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADVSHINTRSEV G+ G++
Sbjct  38   RKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIAGTPGVAADVSHINTRSEVAGYMGED  97

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  98   QLGQALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  157

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDE++LFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAGIT
Sbjct  158  NSTVPIAAEVFKKAGTYDERKLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVVGGHAGIT  217

Query  542  ILPLFSQATPQA-NLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP++ NL+ D I  LT RTQDGGT
Sbjct  218  ILPLFSQATPKSNNLSDDEIKALTKRTQDGGT  249



>ref|XP_002522546.1| malate dehydrogenase, putative [Ricinus communis]
 gb|EEF39846.1| malate dehydrogenase, putative [Ricinus communis]
Length=343

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 198/212 (93%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADVSHIN+R++V G++G+E
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVSHINSRAQVSGYAGEE  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  90   QLGQALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFY GKA V VAEV+VPV+GGHAGIT
Sbjct  150  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYGGKAKVAVAEVDVPVVGGHAGIT  209

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP++N L+++ I  LT RTQDGGT
Sbjct  210  ILPLFSQATPKSNGLSNEDIKALTKRTQDGGT  241



>gb|KDO48351.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=256

 Score =   336 bits (861),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADV HINTRSEV G+ G++
Sbjct  29   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVGHINTRSEVAGYMGND  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALE +DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+A+VNMISNPV
Sbjct  89   QLGQALEDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKDLCSAIAKYCPNAIVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANLA + I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLADEDIKALTKRTQDGGT  239



>ref|XP_010060663.1| PREDICTED: malate dehydrogenase, mitochondrial [Eucalyptus grandis]
 gb|KCW67466.1| hypothetical protein EUGRSUZ_F01209 [Eucalyptus grandis]
Length=348

 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV +LGAAGGIGQPL+LLMK+NPLVS LSL+DIAGTPGVAADV HIN+RSEV G+ G++
Sbjct  36   RKVVVLGAAGGIGQPLALLMKINPLVSKLSLYDIAGTPGVAADVGHINSRSEVAGYVGED  95

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP A+VNMISNPV
Sbjct  96   QLGQALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPSAIVNMISNPV  155

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAG YDEK+LFGVTTLDVVRAKTFYAGKAN+ VA V+VPV+GGHAGIT
Sbjct  156  NSTVPIAAEVFKKAGIYDEKKLFGVTTLDVVRAKTFYAGKANLPVAGVDVPVVGGHAGIT  215

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+PQANL  DVI  LT RTQDGGT
Sbjct  216  ILPLFSQASPQANLPEDVIKALTKRTQDGGT  246



>gb|KHG11830.1| Malate dehydrogenase-2C mitochondrial [Gossypium arboreum]
Length=339

 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSH+NTRSEV G+ G++
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVSHVNTRSEVAGYVGED  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEG DVVIIPAGVPRKPGMTRDDLFNINAGIVK L AAIAKYCP+ALVNMISNPV
Sbjct  87   QLKQALEGCDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCAAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA VNVA+VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVNVADVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPKANLPEEDIKALTKRTQDGGT  237



>gb|KJB13224.1| hypothetical protein B456_002G063300 [Gossypium raimondii]
Length=300

 Score =   337 bits (863),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSH+NTRSEV G+ G++
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVSHVNTRSEVAGYVGED  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEG DVVIIPAGVPRKPGMTRDDLFNINAGIVK L AAIAKYCP+ALVNMISNPV
Sbjct  87   QLKQALEGCDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCAAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLD VRAKTFYAGKA  NVA+VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDAVRAKTFYAGKAKANVADVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPKANLPEEDIKALTKRTQDGGT  237



>ref|XP_011082746.1| PREDICTED: malate dehydrogenase, mitochondrial [Sesamum indicum]
Length=346

 Score =   338 bits (867),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTRSEV G++ +E
Sbjct  34   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLALYDIAGTPGVAADVSHINTRSEVKGYAAEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLF INAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  94   QLGQALEGSDVVIIPAGVPRKPGMTRDDLFKINAGIVKSLCEAIAKYCPNALVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFK  G YDE++LFGVTTLDVVRAKTFYAGKA VNVA+VNVPVIGGHAGIT
Sbjct  154  NSTVPIAAEVFKNKGVYDERKLFGVTTLDVVRAKTFYAGKAKVNVADVNVPVIGGHAGIT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL+ + I  LT RTQDGGT
Sbjct  214  ILPLFSQATPKANLSDEEIQALTKRTQDGGT  244



>ref|XP_010915605.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Elaeis guineensis]
Length=348

 Score =   338 bits (867),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADVSHINTR++V GF G+E
Sbjct  35   RKVAVLGAAGGIGQPLALLMKLNPLVSSLALYDIAGTPGVAADVSHINTRAQVAGFMGEE  94

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  95   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  154

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V V EV+VPV+GGHAGIT
Sbjct  155  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVPVEEVDVPVVGGHAGIT  214

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L  + I  LT RTQDGGT
Sbjct  215  ILPLFSQATPVSNALTDEDIKALTKRTQDGGT  246



>ref|XP_007025436.1| Malate dehydrogenase [Theobroma cacao]
 gb|EOY28058.1| Malate dehydrogenase [Theobroma cacao]
Length=355

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNP VS LSL+DIA TPGVAADVSHIN  ++V G+ G+E
Sbjct  43   RKVAILGAAGGIGQPLALLMKLNPFVSSLSLYDIANTPGVAADVSHINYPAQVAGYVGEE  102

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  103  ELGKALEGSDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLCVAIAKYCPNALVNMISNPV  162

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V VA+V+VPVIGGHAGIT
Sbjct  163  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVPVADVDVPVIGGHAGIT  222

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  D I  LT RTQDGGT
Sbjct  223  ILPLFSQATPKANLPDDDIEALTKRTQDGGT  253



>ref|XP_004969321.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Setaria 
italica]
Length=340

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHINT + V GF G++
Sbjct  27   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIAGTPGVAADVSHINTPALVKGFMGED  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK+LSAAIAKYCP+ALVNMISNPV
Sbjct  87   KLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKNLSAAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV V +VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVTDVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+H+ I  LT RTQDGGT
Sbjct  207  ILPLFSQATPATNALSHEDIEALTKRTQDGGT  238



>ref|XP_010912571.1| PREDICTED: malate dehydrogenase, mitochondrial [Elaeis guineensis]
Length=354

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVSHL+L+DIAGTPGVAADVSHINTR+EV G+  +E
Sbjct  41   RKVAVLGAAGGIGQPLALLMKLNPLVSHLALYDIAGTPGVAADVSHINTRAEVKGYMAEE  100

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  101  QLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV  160

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVT LDVVRAKTFYAGKAN+ VA+V+VPV+GGHAGIT
Sbjct  161  NSTVPIAAEVFKKAGTYDEKKLFGVTMLDVVRAKTFYAGKANIPVADVDVPVVGGHAGIT  220

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ D I  LT RTQDGGT
Sbjct  221  ILPLFSQATPATNALSEDDIKALTKRTQDGGT  252



>sp|P46487.1|MDHM_EUCGU RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Eucalyptus gunnii]
 emb|CAA55383.1| mitochondrial malate dehydrogenase [Eucalyptus gunnii]
Length=347

 Score =   337 bits (865),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADV HINTRSEV G+ G+E
Sbjct  35   RKVAVLGAAGGIGQPLALLMKLNPLVSQLALYDIAGTPGVAADVGHINTRSEVAGYVGEE  94

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+A+VNMISNPV
Sbjct  95   QLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNAVVNMISNPV  154

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAGTY+EK+L GVTTLDVVRAKTFYAGKA V V EVNVPV+GGHAGIT
Sbjct  155  NSTVPIAAEIFKKAGTYNEKKLLGVTTLDVVRAKTFYAGKAKVPVEEVNVPVVGGHAGIT  214

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA P+ANLA + I  LT RTQDGGT
Sbjct  215  ILPLFSQAVPKANLADEDIKALTKRTQDGGT  245



>gb|KJB13223.1| hypothetical protein B456_002G063300 [Gossypium raimondii]
Length=339

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADVSH+NTRSEV G+ G++
Sbjct  27   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVSHVNTRSEVAGYVGED  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEG DVVIIPAGVPRKPGMTRDDLFNINAGIVK L AAIAKYCP+ALVNMISNPV
Sbjct  87   QLKQALEGCDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCAAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLD VRAKTFYAGKA  NVA+VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDAVRAKTFYAGKAKANVADVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPKANLPEEDIKALTKRTQDGGT  237



>gb|KDO48350.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=300

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADV HINTRSEV G+ G++
Sbjct  29   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVGHINTRSEVAGYMGND  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALE +DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+A+VNMISNPV
Sbjct  89   QLGQALEDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKDLCSAIAKYCPNAIVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANLA + I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLADEDIKALTKRTQDGGT  239



>ref|XP_008805887.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Phoenix 
dactylifera]
Length=354

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTR+EV G++ +E
Sbjct  41   RKVAILGAAGGIGQPLSLLMKLNPLVSRLALYDIAGTPGVAADVSHINTRAEVKGYAAEE  100

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP ALVNMISNPV
Sbjct  101  QLGQALEGSDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPDALVNMISNPV  160

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVT LDVVRAKTFYAGKANV V+EVNVPV+GGHAGIT
Sbjct  161  NSTVPIAAEVFKKAGTYDEKKLFGVTMLDVVRAKTFYAGKANVPVSEVNVPVVGGHAGIT  220

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ D I  LT RTQDGGT
Sbjct  221  ILPLFSQATPATNALSEDDIKALTKRTQDGGT  252



>ref|XP_006485676.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Citrus sinensis]
 gb|KDO48349.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=340

 Score =   335 bits (860),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADV HINTRSEV G+ G++
Sbjct  29   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVGHINTRSEVAGYMGND  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALE +DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+A+VNMISNPV
Sbjct  89   QLGQALEDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKDLCSAIAKYCPNAIVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANLA + I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLADEDIKALTKRTQDGGT  239



>ref|XP_002456051.1| hypothetical protein SORBIDRAFT_03g029570 [Sorghum bicolor]
 gb|EES01171.1| hypothetical protein SORBIDRAFT_03g029570 [Sorghum bicolor]
Length=340

 Score =   335 bits (860),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF G+E
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFMGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK+LSAAIAKYCP+ALVNMISNPV
Sbjct  87   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKNLSAAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKAN+ V +VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANLPVTDVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPATNSLSDEDIKALTKRTQDGGT  238



>ref|XP_009395766.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTR+EVVG++GDE
Sbjct  34   RKVAILGAAGGIGQPLSLLMKLNPLVSSLALYDIAGTPGVAADVSHINTRAEVVGYAGDE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKAL+ +DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AI+KYCP+A+V MISNPV
Sbjct  94   QLGKALDDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAISKYCPNAVVTMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYDE++LFGVTTLDVVRAKTFYAGKA V VA VNVPV+GGHAGIT
Sbjct  154  NSTVPIASEVFKKAGTYDERKLFGVTTLDVVRAKTFYAGKAKVPVAGVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+ D I  LT RTQDGGT
Sbjct  214  ILPLFSQATPASNDLSDDDIEALTKRTQDGGT  245



>ref|XP_009386638.1| PREDICTED: malate dehydrogenase, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS+L+L+DIAGTPGVAADV HINTR++V G+ G+E
Sbjct  34   RKVAILGAAGGIGQPLALLMKLNPLVSNLALYDIAGTPGVAADVGHINTRAQVAGYVGEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP A+VNMISNPV
Sbjct  94   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPSAVVNMISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V VA+VNVPV+GGHAGIT
Sbjct  154  NSTVPIASEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVPVADVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N LA + I  LT RTQDGGT
Sbjct  214  ILPLFSQATPASNDLATEDIKALTKRTQDGGT  245



>ref|NP_001140825.1| uncharacterized protein LOC100272900 [Zea mays]
 gb|ACF84734.1| unknown [Zea mays]
Length=340

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF GDE
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK+LS AIAKYCP+ALVNMISNPV
Sbjct  87   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKNLSTAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKAN+ V +VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANLPVTDVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPATNALSDEDIKALTKRTQDGGT  238



>ref|XP_006644438.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Oryza brachyantha]
Length=341

 Score =   334 bits (856),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ ++V GF GD+
Sbjct  28   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPAQVKGFMGDD  87

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCP+ALVNMISNPV
Sbjct  88   QLGEALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPNALVNMISNPV  147

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV+V +VNVPV+GGHAGIT
Sbjct  148  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVHVTDVNVPVVGGHAGIT  207

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ + I  LT RTQDGGT
Sbjct  208  ILPLFSQATPATNALSAEDIKALTKRTQDGGT  239



>gb|KDO48348.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=358

 Score =   334 bits (857),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADV HINTRSEV G+ G++
Sbjct  29   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVGHINTRSEVAGYMGND  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALE +DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+A+VNMISNPV
Sbjct  89   QLGQALEDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKDLCSAIAKYCPNAIVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  149  NSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANLA + I  LT RTQDGGT
Sbjct  209  ILPLFSQATPKANLADEDIKALTKRTQDGGT  239



>ref|XP_006451738.1| hypothetical protein CICLE_v10008562mg [Citrus clementina]
 gb|ESR64978.1| hypothetical protein CICLE_v10008562mg [Citrus clementina]
Length=392

 Score =   335 bits (859),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADV HINTRSEV G+ G++
Sbjct  81   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVGHINTRSEVAGYMGND  140

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALE +DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+A+VNMISNPV
Sbjct  141  QLGQALEDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKDLCSAIAKYCPNAIVNMISNPV  200

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFYAGKANVNVAEVNVPV+GGHAGIT
Sbjct  201  NSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFYAGKANVNVAEVNVPVVGGHAGIT  260

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ANLA + I  LT RTQDGGT
Sbjct  261  ILPLFSQATPKANLADEDIKALTKRTQDGGT  291



>tpg|DAA58328.1| TPA: malate dehydrogenase [Zea mays]
Length=410

 Score =   335 bits (860),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF GDE
Sbjct  97   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDE  156

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK+LS AIAKYCP+ALVNMISNPV
Sbjct  157  QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKNLSTAIAKYCPNALVNMISNPV  216

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKAN+ V +VNVPV+GGHAGIT
Sbjct  217  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANLPVTDVNVPVVGGHAGIT  276

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ + I  LT RTQDGGT
Sbjct  277  ILPLFSQATPATNALSDEDIKALTKRTQDGGT  308



>ref|NP_001043717.1| Os01g0649100 [Oryza sativa Japonica Group]
 gb|AAM00435.1|AF444195_1 malate dehydrogenase [Oryza sativa]
 dbj|BAB55686.1| putative malate dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAC00625.1| putative mitochondrial malate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF05631.1| Os01g0649100 [Oryza sativa Japonica Group]
 gb|EAY75180.1| hypothetical protein OsI_03070 [Oryza sativa Indica Group]
 gb|EAZ12901.1| hypothetical protein OsJ_02822 [Oryza sativa Japonica Group]
 dbj|BAG96942.1| unnamed protein product [Oryza sativa Japonica Group]
Length=340

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN  ++V GF GD+
Sbjct  28   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINAPAQVKGFMGDD  87

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCP+ALVNMISNPV
Sbjct  88   QLGEALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPNALVNMISNPV  147

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV V +VNVPV+GGHAGIT
Sbjct  148  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVTDVNVPVVGGHAGIT  207

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ + I  LT RTQDGGT
Sbjct  208  ILPLFSQATPATNALSDEDIKALTKRTQDGGT  239



>ref|NP_001056389.1| Os05g0574400 [Oryza sativa Japonica Group]
 gb|AAT69584.1| putative malate dehydrogenase [Oryza sativa Japonica Group]
 gb|AAU44114.1| putative malate dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF18303.1| Os05g0574400 [Oryza sativa Japonica Group]
 gb|EAY99124.1| hypothetical protein OsI_21084 [Oryza sativa Indica Group]
 gb|EEE64778.1| hypothetical protein OsJ_19634 [Oryza sativa Japonica Group]
 gb|AGT38446.1| malate dehydrogenase [Oryza sativa Japonica Group]
Length=340

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF G+E
Sbjct  27   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFVGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AI+KYCP+ALVNMISNPV
Sbjct  87   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCTAISKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV V EVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVTEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+H+ I  LT RTQDGGT
Sbjct  207  ILPLFSQATPASNALSHEDIKALTKRTQDGGT  238



>sp|Q43744.1|MDHM_BRANA RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Brassica napus]
 emb|CAA61621.1| malate dehydrogenase [Brassica napus]
Length=341

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRS+VVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSQVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +AIAKYCPHALVNMISNPV
Sbjct  90   NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLWSAIAKYCPHALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKAG YDEK+LFGVTTLDVVR KT YAGKANV VAEVNVP I GHAG+T
Sbjct  150  NSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRVKTSYAGKANVPVAEVNVPAIVGHAGVT  209

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQA L+ D +   T RTQDGGT
Sbjct  210  ILPLFSQATPQAILSGDALTVTTKRTQDGGT  240



>ref|XP_006654824.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Oryza brachyantha]
Length=344

 Score =   331 bits (849),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF G+E
Sbjct  31   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFVGEE  90

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AI+KYCP+ALVNMISNPV
Sbjct  91   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCTAISKYCPNALVNMISNPV  150

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV V EVNVPV+GGHAGIT
Sbjct  151  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVTEVNVPVVGGHAGIT  210

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L H+ I  LT RTQDGGT
Sbjct  211  ILPLFSQATPATNALCHEDIKALTKRTQDGGT  242



>dbj|BAJ85181.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   331 bits (849),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADVSHINTR+ V GF GD+
Sbjct  32   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIAATPGVAADVSHINTRALVKGFVGDD  91

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEGAD+VIIPAGVPRKPGMTRDDLF INAGIVK L  AIA++CP+ALVNMISNPV
Sbjct  92   QLGEALEGADLVIIPAGVPRKPGMTRDDLFKINAGIVKGLCTAIARHCPNALVNMISNPV  151

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV V  VNVPV+GGHAGIT
Sbjct  152  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVTGVNVPVVGGHAGIT  211

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+H+ +V LT RTQDGGT
Sbjct  212  ILPLFSQATPASNALSHEDLVALTKRTQDGGT  243



>ref|XP_007212766.1| hypothetical protein PRUPE_ppa022676mg [Prunus persica]
 gb|EMJ13965.1| hypothetical protein PRUPE_ppa022676mg [Prunus persica]
Length=340

 Score =   330 bits (846),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSH+NT ++V GF+G+E
Sbjct  27   RKVTILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHVNTLAQVSGFAGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAK+CP+ALVNMISNPV
Sbjct  87   QLGKALEGSDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKFCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAG +DEK+LFGVTTLDVVRAKTFYAGKANV  +EV+VPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGMFDEKKLFGVTTLDVVRAKTFYAGKANVEASEVDVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQ T ++  L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQVTLKSKTLSDEEIKALTKRTQDGGT  238



>ref|NP_001141337.1| uncharacterized protein LOC100273428 [Zea mays]
 gb|ACF86114.1| unknown [Zea mays]
Length=340

 Score =   330 bits (845),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF GD+
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDD  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK+CP+ALVNMISNPV
Sbjct  87   QLGEALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKALCTAIAKHCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V V EVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAGVPVTEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPASNSLSQEDIEALTKRTQDGGT  238



>ref|XP_002285356.1| PREDICTED: malate dehydrogenase, mitochondrial [Vitis vinifera]
 emb|CAN83064.1| hypothetical protein VITISV_004210 [Vitis vinifera]
Length=351

 Score =   330 bits (846),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPL+LLMK+NPLVS+L+L+DIAGTPGVAADVSH+NT S+V GF G++
Sbjct  38   RKVTILGAAGGIGQPLALLMKINPLVSNLALYDIAGTPGVAADVSHVNTISQVAGFMGED  97

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVN+ISNPV
Sbjct  98   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCIAIAKYCPNALVNVISNPV  157

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGT+DEK+LFGVTTLDVVRAKTFYA KA V V+EVNVPV+GGHAGIT
Sbjct  158  NSTVPIAAEVFKKAGTFDEKKLFGVTTLDVVRAKTFYAAKAKVPVSEVNVPVVGGHAGIT  217

Query  542  ILPLFSQATPQA-NLAHDVIVGLTXRTQDGGT  634
            ILPLFSQ TP++ NL+ + I  LT RTQDGGT
Sbjct  218  ILPLFSQTTPKSNNLSDEDIQALTKRTQDGGT  249



>ref|XP_008225206.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Prunus mume]
Length=340

 Score =   330 bits (845),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSH+NT ++V GF+G+E
Sbjct  27   RKVTILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHVNTLAQVSGFAGEE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAK+CP+ALVNMISNPV
Sbjct  87   QLGKALEGSDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKFCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAG +DEK+LFGVTTLDVVRAKTFYAGKANV  +EV+VPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGMFDEKKLFGVTTLDVVRAKTFYAGKANVEASEVDVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQ T ++  L  + I  LT RTQDGGT
Sbjct  207  ILPLFSQVTLKSKTLLDEEIKALTKRTQDGGT  238



>emb|CBI20215.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPL+LLMK+NPLVS+L+L+DIAGTPGVAADVSH+NT S+V GF G++
Sbjct  34   RKVTILGAAGGIGQPLALLMKINPLVSNLALYDIAGTPGVAADVSHVNTISQVAGFMGED  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVN+ISNPV
Sbjct  94   QLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCIAIAKYCPNALVNVISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGT+DEK+LFGVTTLDVVRAKTFYA KA V V+EVNVPV+GGHAGIT
Sbjct  154  NSTVPIAAEVFKKAGTFDEKKLFGVTTLDVVRAKTFYAAKAKVPVSEVNVPVVGGHAGIT  213

Query  542  ILPLFSQATPQA-NLAHDVIVGLTXRTQDGGT  634
            ILPLFSQ TP++ NL+ + I  LT RTQDGGT
Sbjct  214  ILPLFSQTTPKSNNLSDEDIQALTKRTQDGGT  245



>ref|XP_004961146.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Setaria 
italica]
Length=341

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF GD+
Sbjct  28   RKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPAFVKGFMGDD  87

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK+CP+ALVNMISNPV
Sbjct  88   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKALCTAIAKHCPNALVNMISNPV  147

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V V +VNVPV+GGHAGIT
Sbjct  148  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAGVPVTDVNVPVVGGHAGIT  207

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+ + I  LT RTQDGGT
Sbjct  208  ILPLFSQATPASNSLSQEDIEALTKRTQDGGT  239



>gb|ACG36184.1| malate dehydrogenase [Zea mays]
Length=340

 Score =   329 bits (843),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + + GF GD+
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALMKGFMGDD  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK+CP+ALVNMISNPV
Sbjct  87   QLGEALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKALCTAIAKHCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V V EVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAGVPVTEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPASNSLSQEDIEALTKRTQDGGT  238



>ref|NP_001142100.1| malate dehydrogenase2 [Zea mays]
 gb|ACF87641.1| unknown [Zea mays]
 gb|AFW79275.1| malate dehydrogenase2 [Zea mays]
Length=340

 Score =   329 bits (843),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF GD+
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDD  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AIAK+CP+ALVNMISNPV
Sbjct  87   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCTAIAKHCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V V  VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAGVPVTGVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPASNSLSQEDIEALTKRTQDGGT  238



>ref|XP_010675402.1| PREDICTED: malate dehydrogenase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=350

 Score =   329 bits (843),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV +LGAAGGIGQPLS+LMKLNPLVS LSL+D+AGTPGVAAD SH+NTR++V G++GD 
Sbjct  38   RKVTVLGAAGGIGQPLSMLMKLNPLVSTLSLYDLAGTPGVAADCSHVNTRAQVFGYAGDN  97

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            ++G+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK+L  A+AK+CP+ALV MISNPV
Sbjct  98   DMGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKNLCNAVAKHCPNALVAMISNPV  157

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIA+EVFKKAGTYD KRLFGVTTLDVVRAKTFYA KA V V  VNVPV+GGHAGIT
Sbjct  158  NSTVPIASEVFKKAGTYDPKRLFGVTTLDVVRAKTFYASKAGVPVEGVNVPVVGGHAGIT  217

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA PQANL+   I  LT RTQDGGT
Sbjct  218  ILPLFSQAVPQANLSEQDIEALTKRTQDGGT  248



>ref|XP_003569456.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=340

 Score =   328 bits (842),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAAD+SHIN+ + V GF GDE
Sbjct  27   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIAATPGVAADISHINSPALVKGFMGDE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +ALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCP+AL+NMISNPV
Sbjct  87   QLAEALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPNALINMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV V  VNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVTGVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPASNALSAEEIKALTKRTQDGGT  238



>emb|CBL95261.1| malate dehydrogenase [Pinus pinaster]
Length=354

 Score =   328 bits (841),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV +LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADV HIN+R+EV G+ G+E
Sbjct  40   RKVVVLGAAGGIGQPLALLMKLNPLVSKLALYDIAGTPGVAADVGHINSRAEVAGYMGEE  99

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG ALE A+VVIIPAGVPRKPGMTRDDLFNINAGIVKSL +AIAKYCP A+VNMISNPV
Sbjct  100  QLGTALENANVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCSAIAKYCPEAIVNMISNPV  159

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFYA KA V V EV+VPV+GGHAG+T
Sbjct  160  NSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFYASKAGVPVEEVDVPVVGGHAGVT  219

Query  542  ILPLFSQATPQAN--LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ N  L+ + I  LT RTQDGGT
Sbjct  220  ILPLFSQATPKPNSVLSEEDIKALTKRTQDGGT  252



>ref|XP_002441555.1| hypothetical protein SORBIDRAFT_09g029240 [Sorghum bicolor]
 gb|EES19985.1| hypothetical protein SORBIDRAFT_09g029240 [Sorghum bicolor]
Length=340

 Score =   328 bits (840),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ + V GF GD+
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDD  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVK L  AIAK+CP+ALVNMISNPV
Sbjct  87   QLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKGLCTAIAKHCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYD+K+LFGVTTLDVVRAKTFYAGKA V V EVNVPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDKKKLFGVTTLDVVRAKTFYAGKAGVPVTEVNVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+ + I  LT RTQDGGT
Sbjct  207  ILPLFSQATPASNSLSQEDIEALTKRTQDGGT  238



>gb|KHN10168.1| Malate dehydrogenase 1, mitochondrial [Glycine soja]
Length=293

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKLNPLVS LSL+DIAGTPGVAAD+SHINTRSEVVG+ GDE LGKALEGADVVIIPAGVP
Sbjct  1    MKLNPLVSSLSLYDIAGTPGVAADISHINTRSEVVGYQGDEELGKALEGADVVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVK+L  AIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKTLCTAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQANLAHDVI  598
            KRLFGVTTLDVVRAKTFYAGKANV VA VNVPV+GGHAGITILPLFSQATP+ANL  DVI
Sbjct  121  KRLFGVTTLDVVRAKTFYAGKANVPVAGVNVPVVGGHAGITILPLFSQATPKANLDDDVI  180

Query  599  VGLTXRTQDGGT  634
              LT RTQDGGT
Sbjct  181  KALTKRTQDGGT  192



>ref|XP_003567846.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=341

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADVSHIN+ + V GF GD+
Sbjct  28   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIAATPGVAADVSHINSPALVKGFVGDD  87

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEGAD+VIIPAGVPRKPGMTRDDLF INAGIVK L  AI+KYCP+ALVNMISNPV
Sbjct  88   QLGEALEGADLVIIPAGVPRKPGMTRDDLFKINAGIVKGLCTAISKYCPNALVNMISNPV  147

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKANV V  VNVPV+GGHAGIT
Sbjct  148  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVTGVNVPVVGGHAGIT  207

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP +N L+H+ +  LT RTQDGGT
Sbjct  208  ILPLFSQATPSSNALSHEDLKALTKRTQDGGT  239



>ref|XP_002305754.2| hypothetical protein POPTR_0004s05340g [Populus trichocarpa]
 gb|EEE86265.2| hypothetical protein POPTR_0004s05340g [Populus trichocarpa]
Length=348

 Score =   326 bits (836),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 194/211 (92%), Gaps = 1/211 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMKLNPL+S LSL+DIA TPGVAADVSHIN+R++V G++G+E 
Sbjct  36   KVAILGAAGGIGQPLALLMKLNPLISSLSLYDIANTPGVAADVSHINSRAQVAGYAGEEQ  95

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG+AL+G+D+VIIPAGVPRKPGMTRDDLF INAGIVKSL  AIAKYCP+ALVNMISNPVN
Sbjct  96   LGEALDGSDIVIIPAGVPRKPGMTRDDLFKINAGIVKSLCTAIAKYCPNALVNMISNPVN  155

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+DE++LFGVTTLDVVRA+TFYAGK  V VAEVNVPV+GGHAGITI
Sbjct  156  STVPIAAEVFKKAGTFDERKLFGVTTLDVVRARTFYAGKVKVPVAEVNVPVVGGHAGITI  215

Query  545  LPLFSQATPQ-ANLAHDVIVGLTXRTQDGGT  634
            LPLFSQA P+ +NL+ D I  LT RTQDGGT
Sbjct  216  LPLFSQAAPKSSNLSDDDIKALTKRTQDGGT  246



>emb|CDM83547.1| unnamed protein product [Triticum aestivum]
Length=340

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADVSHIN+ + V GF  D+
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAATPGVAADVSHINSPALVKGFMADD  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +AL+GAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCP+ALVNMISNPV
Sbjct  87   QLAEALDGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRA+TFYAGKANV+V  V+VPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRARTFYAGKANVDVNTVDVPVVGGHAGIT  206

Query  542  ILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP  N L+ + I  LT RTQ+GGT
Sbjct  207  ILPLFSQATPSTNALSAEEIKALTKRTQEGGT  238



>ref|XP_010527511.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like, partial 
[Tarenaya hassleriana]
Length=220

 Score =   318 bits (816),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADVSHINTRS+VVG+ GD+
Sbjct  30   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVSHINTRSQVVGYMGDD  89

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NLGKALEGAD+V+IPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP ALVNMISNPV
Sbjct  90   NLGKALEGADLVVIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPQALVNMISNPV  149

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFYAGKA V VAEVNVPV+GGHAG+T
Sbjct  150  NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKAKVPVAEVNVPVVGGHAGVT  209

Query  542  ILPLFSQAT  568
            ILPLFSQ +
Sbjct  210  ILPLFSQVS  218



>gb|KEH19548.1| malate dehydrogenase [Medicago truncatula]
Length=251

 Score =   320 bits (819),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+RS+V G++G++
Sbjct  31   RKVAILGAAGGIGQPLSLLMKLNPLVSTLSLYDIAGTPGVAADVSHINSRSQVTGYAGED  90

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL+ AI+KYCPHALVNMISNPV
Sbjct  91   ELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLATAISKYCPHALVNMISNPV  150

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAG+T
Sbjct  151  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVT  210

Query  542  ILPLFSQ  562
            ILPLFSQ
Sbjct  211  ILPLFSQ  217



>emb|CDP18386.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKLNPLVS L+L+DIAGTPGVAADVSHINTRSEVVGF G+E LG+ALEG+DVVIIPAGVP
Sbjct  1    MKLNPLVSKLALYDIAGTPGVAADVSHINTRSEVVGFMGEEQLGQALEGSDVVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVKSL  AIAKYCPHALVNMISNPVNSTVPIA+EVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKSLCTAIAKYCPHALVNMISNPVNSTVPIASEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQANLAHDVI  598
            K+LFGVTTLDVVRAKTFYAGKA VNVAEVNVPV+GGHAGITILPLFSQATP+ANL  + I
Sbjct  121  KKLFGVTTLDVVRAKTFYAGKAKVNVAEVNVPVVGGHAGITILPLFSQATPKANLPDEDI  180

Query  599  VGLTXRTQDGGT  634
              LT RTQDGGT
Sbjct  181  KALTKRTQDGGT  192



>ref|XP_010062799.1| PREDICTED: malate dehydrogenase, mitochondrial [Eucalyptus grandis]
 gb|KCW69927.1| hypothetical protein EUGRSUZ_F03251 [Eucalyptus grandis]
Length=344

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 192/213 (90%), Gaps = 5/213 (2%)
 Frame = +2

Query  11   AILGAAGGIGQPLSLL-----MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSG  175
            ++LGAAGGIGQPL+LL     MKLNPLVS L+L+DIAGTPGVAADV HINTRSEV G+ G
Sbjct  31   SVLGAAGGIGQPLALLPLALLMKLNPLVSQLALYDIAGTPGVAADVGHINTRSEVAGYVG  90

Query  176  DENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISN  355
            +E LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  AIAKYCP+A+VNMISN
Sbjct  91   EEQLGQALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNAVVNMISN  150

Query  356  PVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAG  535
            PVNSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFYAGKA V V EVNVPV+GGHAG
Sbjct  151  PVNSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFYAGKAKVPVEEVNVPVVGGHAG  210

Query  536  ITILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ITILPLFSQA P+ANLA + I  LT RTQDGGT
Sbjct  211  ITILPLFSQAVPKANLADEDIKALTKRTQDGGT  243



>gb|EPS74425.1| malate dehydrogenase, mitochondrial [Genlisea aurea]
Length=356

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 187/220 (85%), Gaps = 9/220 (4%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSE--------  157
            RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADV HINTRSE        
Sbjct  35   RKVTILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAATPGVAADVGHINTRSENFLSADDF  94

Query  158  -VVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHA  334
             V G+ G+E + +ALEG+DVVIIPAGVPRKPGMTRDDLF INAGIVKSL  A+AK+ P A
Sbjct  95   GVKGYVGEEQIKEALEGSDVVIIPAGVPRKPGMTRDDLFTINAGIVKSLIEAVAKFSPKA  154

Query  335  LVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvp  514
            L+NMISNPVNSTVPIAAEV K  G YDEKRL GVTTLDVVRAKTFYAGKAN NVA+V VP
Sbjct  155  LINMISNPVNSTVPIAAEVLKSNGVYDEKRLLGVTTLDVVRAKTFYAGKANANVADVKVP  214

Query  515  vIGGHAGITILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            V+GGHAGITILPLFSQA P+ANL+HDV+  LT RTQDGGT
Sbjct  215  VVGGHAGITILPLFSQANPKANLSHDVLHALTKRTQDGGT  254



>ref|XP_001767253.1| predicted protein [Physcomitrella patens]
 gb|EDQ67934.1| predicted protein [Physcomitrella patens]
Length=322

 Score =   314 bits (805),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL LLMKLNPLV+ LSL+DIAGTPGVA D+SHINT + V GF+G+E
Sbjct  8    RKVAVLGAAGGIGQPLGLLMKLNPLVTDLSLYDIAGTPGVACDISHINTGANVKGFAGEE  67

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            +L KAL+G D+VIIPAGVPRKPGMTRDDLFNINAGIV+SL++AIA++CP ALVNMISNPV
Sbjct  68   DLAKALKGCDLVIIPAGVPRKPGMTRDDLFNINAGIVRSLASAIAEHCPGALVNMISNPV  127

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFK+ GTYD KRLFGVTTLDVVRA+TF A +  +NV +V+VPV+GGHAGIT
Sbjct  128  NSTVPIAAEVFKQKGTYDPKRLFGVTTLDVVRARTFLAHRKGLNVRDVDVPVVGGHAGIT  187

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ +L+ + +  LT RTQDGGT
Sbjct  188  ILPLFSQATPKVDLSDEELDALTKRTQDGGT  218



>ref|XP_001776138.1| predicted protein [Physcomitrella patens]
 gb|EDQ59049.1| predicted protein [Physcomitrella patens]
Length=322

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL LLMKLNPLV+ LSL+DIAGTPGVA+D+SHINT + V GF+G++
Sbjct  8    RKVAVLGAAGGIGQPLGLLMKLNPLVTDLSLYDIAGTPGVASDLSHINTGANVEGFAGEQ  67

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L KAL+G D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL++AIA++CP ALVNMISNPV
Sbjct  68   ELAKALKGCDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLASAIAEHCPGALVNMISNPV  127

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FK+ GTYD KRLFGVTTLDVVRA+TF A K  +NV +V+VPV+GGHAGIT
Sbjct  128  NSTVPIAAEIFKQKGTYDPKRLFGVTTLDVVRARTFLAHKKGLNVKDVDVPVVGGHAGIT  187

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ +L+ + +  LT RTQDGGT
Sbjct  188  ILPLFSQATPKVDLSDEELEALTKRTQDGGT  218



>emb|CBI30662.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKLNPLVS LSL+DIAGTPGVAADVSHINTRS+V G+ GD+ LG+ALEGAD+VIIPAGVP
Sbjct  1    MKLNPLVSSLSLYDIAGTPGVAADVSHINTRSQVAGYMGDDQLGQALEGADLVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQA-NLAHDV  595
            K+LFGVTTLDVVRAKTFYAGKA V VAE NVPV+GGHAGITILPLFSQATP++ NL+ + 
Sbjct  121  KKLFGVTTLDVVRAKTFYAGKAKVPVAEANVPVVGGHAGITILPLFSQATPKSNNLSDED  180

Query  596  IVGLTXRTQDGGT  634
            IV LT RTQDGGT
Sbjct  181  IVALTKRTQDGGT  193



>gb|AFN53696.1| mitochondrial malate dehydrogenase [Linum usitatissimum]
Length=293

 Score =   307 bits (786),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKLNPL+S+L+L+DIA TPGVAADVSHINT SEV G+ GDE LGKALEG+D+VIIPAGVP
Sbjct  1    MKLNPLLSNLALYDIANTPGVAADVSHINTGSEVSGYVGDEQLGKALEGSDIVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVK L  AIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKGLCQAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQANLAHDVI  598
            KRLFGVT+LDVVRA+TFYAGKANV VA VN+PV+GGHAG+TILPLFSQA P+ANL+ + I
Sbjct  121  KRLFGVTSLDVVRARTFYAGKANVPVAGVNIPVVGGHAGVTILPLFSQANPKANLSDEEI  180

Query  599  VGLTXRTQDGGT  634
            V LT RTQDGGT
Sbjct  181  VALTKRTQDGGT  192



>ref|XP_002990694.1| hypothetical protein SELMODRAFT_131967 [Selaginella moellendorffii]
 gb|EFJ08326.1| hypothetical protein SELMODRAFT_131967 [Selaginella moellendorffii]
Length=358

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGA GGIGQPLSLLMKL+PLVS L L+DI GTPGVAADVSH+N+R++V GF+G+E
Sbjct  34   RKVVILGANGGIGQPLSLLMKLSPLVSDLGLYDIVGTPGVAADVSHVNSRAQVAGFAGEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NLGK L+ AD+VIIPAGVPRKPGM RDDLFNINAGIV++L AA+AK CP ALVN+ISNPV
Sbjct  94   NLGKCLKDADLVIIPAGVPRKPGMDRDDLFNINAGIVQTLCAAVAKNCPKALVNIISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKK+GTYD  RLFGVTTLDVVRA+TF A    +N +EV++PVIGGHAG T
Sbjct  154  NSTVPIAAEVFKKSGTYDPSRLFGVTTLDVVRARTFLASAKKLNPSEVDLPVIGGHAGAT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+P+ +L+   +  LT RTQDGGT
Sbjct  214  ILPLFSQASPKVSLSTKELDALTKRTQDGGT  244



>ref|XP_002969028.1| hypothetical protein SELMODRAFT_90290 [Selaginella moellendorffii]
 gb|EFJ30144.1| hypothetical protein SELMODRAFT_90290 [Selaginella moellendorffii]
Length=358

 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            R+V ILGA GGIGQPLSLLMKL+PLVS L L+DI GTPGVAADVSH+N+R++V GF+G+E
Sbjct  34   RRVVILGANGGIGQPLSLLMKLSPLVSDLGLYDIVGTPGVAADVSHVNSRAQVAGFAGEE  93

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NLGK L+ AD+VIIPAGVPRKPGM RDDLFN+NAGIV++L  A+AK CP ALVN+ISNPV
Sbjct  94   NLGKCLKDADLVIIPAGVPRKPGMDRDDLFNVNAGIVQTLCTAVAKNCPKALVNIISNPV  153

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKK+GTYD  RLFGVTTLDVVRA+TF A    +N +EV++PVIGGHAG T
Sbjct  154  NSTVPIAAEVFKKSGTYDPNRLFGVTTLDVVRARTFLASAKKLNPSEVDLPVIGGHAGAT  213

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA+P+ +L+   +  LT RTQDGGT
Sbjct  214  ILPLFSQASPKVSLSTKELDALTKRTQDGGT  244



>ref|XP_006449475.1| hypothetical protein CICLE_v10016114mg [Citrus clementina]
 gb|ESR62715.1| hypothetical protein CICLE_v10016114mg [Citrus clementina]
Length=295

 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 178/193 (92%), Gaps = 1/193 (1%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKLNPLVS LSL+DIA TPGVAADVSHIN+ ++V G++G+E LGKALEG+DVVIIPAGVP
Sbjct  1    MKLNPLVSSLSLYDIANTPGVAADVSHINSPAQVEGYAGEEQLGKALEGSDVVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVKSL  AIA YCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKSLCTAIANYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQA-NLAHDV  595
            K+LFGVTTLDVVRAKTFYAGKANV VAEVNVPVIGGHAGITILPLFSQATP++ NL+ + 
Sbjct  121  KKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGITILPLFSQATPKSNNLSDEE  180

Query  596  IVGLTXRTQDGGT  634
            I  LT RTQDGGT
Sbjct  181  IKALTKRTQDGGT  193



>ref|XP_002968321.1| hypothetical protein SELMODRAFT_89860 [Selaginella moellendorffii]
 gb|EFJ30575.1| hypothetical protein SELMODRAFT_89860 [Selaginella moellendorffii]
Length=341

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            R+V +LGAAGGIGQPLS+L+KLNPLVS LSL+DIAGTPGVA D+SHINTR+EV GF+GD+
Sbjct  19   RRVTVLGAAGGIGQPLSMLLKLNPLVSKLSLYDIAGTPGVATDLSHINTRTEVHGFAGDD  78

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L  AL+ AD+VIIPAGVPRKPGMTRD+LF+INAGIVK L  AIAK+CP AL+NMISNPV
Sbjct  79   QLKDALKDADLVIIPAGVPRKPGMTRDELFDINAGIVKKLVQAIAKHCPFALINMISNPV  138

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV K  GTYD  RLFGVTTLDVVRA+TFYA   N+ + +V+VPV+GGHAG T
Sbjct  139  NSTVPIAAEVLKVEGTYDHTRLFGVTTLDVVRARTFYAKAKNLPIEDVDVPVVGGHAGKT  198

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQ  L+ + +  LT +TQDGGT
Sbjct  199  ILPLFSQATPQVPLSKEEVEELTRKTQDGGT  229



>ref|XP_002976052.1| hypothetical protein SELMODRAFT_232627 [Selaginella moellendorffii]
 gb|EFJ22957.1| hypothetical protein SELMODRAFT_232627 [Selaginella moellendorffii]
Length=341

 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            R+V +LGAAGGIGQPLS+L+KLNPLVS LSL+DIAGTPGVA D+SHINTR+EV GF+GD+
Sbjct  19   RRVTVLGAAGGIGQPLSMLLKLNPLVSKLSLYDIAGTPGVATDLSHINTRTEVHGFAGDD  78

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L  AL+ AD+VIIPAGVPRKPGMTRD+LF+INAGIVK L  AIAK+CP AL+NMISNPV
Sbjct  79   QLKDALKDADLVIIPAGVPRKPGMTRDELFDINAGIVKKLVQAIAKHCPFALINMISNPV  138

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV K  GTYD  RLFGVTTLDVVRA+TFYA   N+ + +V+VPV+GGHAG T
Sbjct  139  NSTVPIAAEVLKVEGTYDHTRLFGVTTLDVVRARTFYAKAKNLPIEDVDVPVVGGHAGKT  198

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQ  L+ + +  LT +TQDGGT
Sbjct  199  ILPLFSQATPQVPLSKEEVEELTRKTQDGGT  229



>ref|XP_002507824.1| nad-dependent malate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO69082.1| nad-dependent malate dehydrogenase [Micromonas sp. RCC299]
Length=335

 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 176/210 (84%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQP  LLMK+NPLV+ LSL+DIAGTPGVAADVSH+NT ++V G++GD  
Sbjct  24   KVAVLGAAGGIGQPCGLLMKMNPLVTELSLYDIAGTPGVAADVSHVNTGAQVKGYAGDAE  83

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG AL+ ADVVIIPAGVPRKPGMTRDDLF INAGIV  L+ A A +CP A++NMISNPVN
Sbjct  84   LGAALKDADVVIIPAGVPRKPGMTRDDLFKINAGIVAGLTEACAAHCPKAMINMISNPVN  143

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAE+ KK G YD K+LFGVTTLDVVRAKTFYA K  +  A+V+VPV+GGHAGITI
Sbjct  144  STVPIAAEILKKKGVYDPKKLFGVTTLDVVRAKTFYAEKNGLETAKVDVPVVGGHAGITI  203

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQATP   +  DVI  LT RTQDGGT
Sbjct  204  LPLLSQATPAVAMTDDVIDALTKRTQDGGT  233



>gb|KDO77808.1| hypothetical protein CISIN_1g022546mg [Citrus sinensis]
Length=295

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKL+PLVS LSL+DIA TPGVAADVSHIN+ ++V G++G+E LGKALEG+DVVIIPAGVP
Sbjct  1    MKLDPLVSSLSLYDIANTPGVAADVSHINSPAQVEGYAGEEQLGKALEGSDVVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVKSL  AIA YCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKSLCTAIANYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQA-NLAHDV  595
            K+LFGVTTLDVVRAKTFYAGK NV VAEVNVPVIGGHAG+TILPLFSQATP++ NL+ + 
Sbjct  121  KKLFGVTTLDVVRAKTFYAGKVNVPVAEVNVPVIGGHAGVTILPLFSQATPKSNNLSDEE  180

Query  596  IVGLTXRTQDGGT  634
            I  LT RTQDGGT
Sbjct  181  IKALTKRTQDGGT  193



>emb|CEF98358.1| Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 
[Ostreococcus tauri]
Length=336

 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 179/211 (85%), Gaps = 1/211 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQP  LLMK+NPLV+ LSL+DIAGTPGVAADVSH+NT ++V G++G+  
Sbjct  24   KVAVLGAAGGIGQPCGLLMKMNPLVTELSLYDIAGTPGVAADVSHVNTAAQVKGYAGEAE  83

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG AL+  DVVIIPAGVPRKPGMTRDDLF IN GIVK L  AIA  CP+A++NMISNPVN
Sbjct  84   LGAALKDCDVVIIPAGVPRKPGMTRDDLFAINGGIVKGLVEAIADNCPNAMINMISNPVN  143

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEV K  G YD K+LFGVTTLDVVRAKTFYA KA +  ++V+VPV+GGHAGITI
Sbjct  144  STVPIAAEVLKAKGKYDPKKLFGVTTLDVVRAKTFYAEKAGLETSKVDVPVVGGHAGITI  203

Query  545  LPLFSQATPQA-NLAHDVIVGLTXRTQDGGT  634
            LPLFSQATPQA NL+ D I  LT RTQDGGT
Sbjct  204  LPLFSQATPQAKNLSADDIDALTKRTQDGGT  234



>ref|XP_005649665.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE25121.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=340

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMK+NP VS L+L+DI GTPGVAAD+SHIN++++  G++G E
Sbjct  27   RKVAILGAAGGIGQPLSLLMKMNPYVSDLALYDIQGTPGVAADISHINSKAKTKGYAGAE  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+AL+GADVVIIPAGVPRKPGMTRDDLF  NAGIVK L  A+A++ P A++N+ISNPV
Sbjct  87   QLGEALKGADVVIIPAGVPRKPGMTRDDLFKTNAGIVKDLITAVAQHAPTAILNIISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV K AG YD +RLFGVTTLDVVRA+TFYA K  + VA+V VPV+GGHAG+T
Sbjct  147  NSTVPIAAEVLKAAGVYDPRRLFGVTTLDVVRARTFYAEKKGLPVADVEVPVVGGHAGVT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILP FSQATP  +LA + +V LT RTQDGGT
Sbjct  207  ILPFFSQATPFQDLAQEELVALTKRTQDGGT  237



>ref|XP_003062229.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53941.1| predicted protein [Micromonas pusilla CCMP1545]
Length=319

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQP  LLMK+NPLV+ LSL+DIAGTPGVAADVSHINT ++V G++GD  
Sbjct  8    KVAVLGAAGGIGQPCGLLMKMNPLVTELSLYDIAGTPGVAADVSHINTAAQVKGYAGDAE  67

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG AL+ AD+VIIPAGVPRKPGMTR+DLF INAGIV  L+ A A +CP+A++NMISNPVN
Sbjct  68   LGAALKDADLVIIPAGVPRKPGMTREDLFKINAGIVAGLTEACATHCPNAMINMISNPVN  127

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEV KK G YD K+LFGVTTLDVVRAKTFYA K  +  A+V+VPV+GGHAGITI
Sbjct  128  STVPIAAEVLKKRGAYDPKKLFGVTTLDVVRAKTFYAEKNGLETAKVDVPVVGGHAGITI  187

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQATP+A +    I  LT RTQDGGT
Sbjct  188  LPLLSQATPKAEMDAATIEALTKRTQDGGT  217



>ref|XP_005843566.1| hypothetical protein CHLNCDRAFT_59812 [Chlorella variabilis]
 gb|EFN51464.1| hypothetical protein CHLNCDRAFT_59812 [Chlorella variabilis]
Length=337

 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 184/213 (86%), Gaps = 2/213 (1%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMKL+P VS L+L+DIAGTPGVAADVSHIN+++ V G++G++
Sbjct  23   RKVAVLGAAGGIGQPLSLLMKLSPYVSELALYDIAGTPGVAADVSHINSKATVKGYAGED  82

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+AL+GADVVIIPAGVPRKPGMTRDDLF INAGIV++L  A  K+CP AL+N+ISNPV
Sbjct  83   QLGEALKGADVVIIPAGVPRKPGMTRDDLFKINAGIVRALVEACGKHCPKALLNIISNPV  142

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE  K+ G YDEKR+ GVTTLDVVRAKTFYA KA ++V++V+VPV+GGHAG+T
Sbjct  143  NSTVPIAAETLKRLGVYDEKRVLGVTTLDVVRAKTFYAEKAGLDVSKVDVPVVGGHAGVT  202

Query  542  ILPLFSQATPQA--NLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA P A   L+   I  LT RTQDGGT
Sbjct  203  ILPLFSQAVPNAANKLSEADIDALTKRTQDGGT  235



>gb|EMS58229.1| Malate dehydrogenase 1, mitochondrial [Triticum urartu]
Length=405

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADVSHIN+ + V GF  D+
Sbjct  27   RKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAATPGVAADVSHINSPALVKGFMADD  86

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +AL+GAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCP+ALVNMISNPV
Sbjct  87   QLAEALDGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPNALVNMISNPV  146

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRA+TFYAGKANV+V  V+VPV+GGHAGIT
Sbjct  147  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRARTFYAGKANVDVNTVDVPVVGGHAGIT  206

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQ  622
            ILPLFSQ     N   +V+ GL   TQ
Sbjct  207  ILPLFSQVRLGKNGVEEVL-GLGQLTQ  232



>ref|XP_001418230.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96523.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=335

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQP  LLMK+NPLV+ L+L+DIAGTPGVAADVSH+NT ++  G++GD  
Sbjct  23   KVAVLGAAGGIGQPCGLLMKMNPLVTELALYDIAGTPGVAADVSHVNTAAQTKGYAGDGE  82

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG AL+ ADVVIIPAGVPRKPGMTRDDLF IN GIVK L  AIA  CP+A++NMISNPVN
Sbjct  83   LGAALKDADVVIIPAGVPRKPGMTRDDLFAINGGIVKGLVEAIADNCPNAMINMISNPVN  142

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEV K  G YD ++LFGVTTLDVVRAKTFYA KA +  A+V+VPV+GGHAGITI
Sbjct  143  STVPIAAEVLKAKGKYDARKLFGVTTLDVVRAKTFYAEKAGLETAKVDVPVVGGHAGITI  202

Query  545  LPLFSQATPQA-NLAHDVIVGLTXRTQDGGT  634
            LPLFSQATP+A NL+   I  LT RTQDGGT
Sbjct  203  LPLFSQATPKASNLSEADIDALTKRTQDGGT  233



>gb|ACX50498.1| malate dehydrogenase [Zea mays]
Length=295

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKLNPLVS LSL+DIAGTPGVAADVSHIN+ + + GF GD+ LG+ALEG+D+VIIPAGVP
Sbjct  1    MKLNPLVSSLSLYDIAGTPGVAADVSHINSPALMKGFMGDDQLGEALEGSDIVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVK+L  AIAK+CP+ALVNMISNPVNSTVPIAAEVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKALCTAIAKHCPNALVNMISNPVNSTVPIAAEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQAN-LAHDV  595
            K+LFGVTTLDVVRAKTFYAGKA V V EVNVPV+GGHAGITILPLFSQATP +N L+ + 
Sbjct  121  KKLFGVTTLDVVRAKTFYAGKAGVPVTEVNVPVVGGHAGITILPLFSQATPASNSLSQED  180

Query  596  IVGLTXRTQDGGT  634
            I  LT RTQDGGT
Sbjct  181  IEALTKRTQDGGT  193



>ref|XP_002953466.1| malate dehydrogenase [Volvox carteri f. nagariensis]
 gb|EFJ45439.1| malate dehydrogenase [Volvox carteri f. nagariensis]
Length=340

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLS+LMK+N  VS LSL+D+ GTPGVAADVSHINT+++  GF  D 
Sbjct  30   RKVAVLGAAGGIGQPLSMLMKMNAQVSQLSLYDVIGTPGVAADVSHINTKAQAKGFDKD-  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV+ L  A+ K+CP AL+N+ISNPV
Sbjct  89   GLAEALRGCDLVIIPAGVPRKPGMTRDDLFKINAGIVRDLVEAVGKHCPGALLNIISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE  KK G YD++++ GVTTLDVVRAKTFYA K  ++VA V+VPV+GGHAG+T
Sbjct  149  NSTVPIAAEQLKKMGVYDKRKVMGVTTLDVVRAKTFYAEKNGLDVASVDVPVVGGHAGVT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+ N+ HDV+  LT RTQDGGT
Sbjct  209  ILPLFSQATPKVNMPHDVLDALTKRTQDGGT  239



>gb|AAT42189.1| putative mitochondrial malate dehydrogenase [Nicotiana tabacum]
Length=212

 Score =   288 bits (738),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = +2

Query  110  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI  289
            TPGVAADVSHINTRS+V GF+GDE L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGI
Sbjct  1    TPGVAADVSHINTRSQVSGFAGDEQLRQALEGADVVIIPAGVPRKPGMTRDDLFNINAGI  60

Query  290  VKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF  469
            VKSL  AIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF
Sbjct  61   VKSLCTAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF  120

Query  470  YagkanvnvaevnvpvIGGHAGITILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            YAGKA VNVA+V VPV+GGHAGITILPLFSQATP+ANL  + I  LT RTQDGGT
Sbjct  121  YAGKAKVNVADVIVPVVGGHAGITILPLFSQATPKANLGDEEIEALTKRTQDGGT  175



>ref|XP_007513166.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16724.1| predicted protein [Bathycoccus prasinos]
Length=347

 Score =   292 bits (748),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 177/214 (83%), Gaps = 4/214 (2%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFS----  172
            KVA+LGAAGGIGQP  LLMK+NPLV+ L L+DIAGTPGVAADVSHINT+++V G+S    
Sbjct  31   KVAVLGAAGGIGQPCGLLMKMNPLVTELRLYDIAGTPGVAADVSHINTKAQVKGYSQADD  90

Query  173  GDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMIS  352
            G++ L  AL+  D+VIIPAGVPRKPGMTRDDLF INAGIVK L  A A+ CP A++N+IS
Sbjct  91   GEDGLKNALKDCDLVIIPAGVPRKPGMTRDDLFKINAGIVKGLVEACAENCPKAMLNIIS  150

Query  353  NPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHA  532
            NPVNSTVPIAAE  K+ G YD+K+LFGVTTLDVVRAKTFYA K  +  A+V+VPVIGGHA
Sbjct  151  NPVNSTVPIAAETLKQKGVYDKKKLFGVTTLDVVRAKTFYAEKKGLETAKVDVPVIGGHA  210

Query  533  GITILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            G+TILPLFSQATP+A L  D I  LT RTQDGGT
Sbjct  211  GVTILPLFSQATPKAALTDDEIDALTKRTQDGGT  244



>ref|XP_006392811.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
 gb|ESQ30097.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
Length=365

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 167/211 (79%), Gaps = 32/211 (15%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LLMKLNPLVS LSL+DIA TPGVAADV HINTRSEV G+ GD+
Sbjct  86   RKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVAGYMGDD  145

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            NL KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL+NMISNPV
Sbjct  146  NLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPV  205

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE+FKKA                                EVNVPVIGGHAG+T
Sbjct  206  NSTVPIAAEIFKKA--------------------------------EVNVPVIGGHAGVT  233

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATPQANL+ DV+  LT RTQDGGT
Sbjct  234  ILPLFSQATPQANLSGDVLTALTKRTQDGGT  264



>gb|EMT27196.1| Malate dehydrogenase 1, mitochondrial [Aegilops tauschii]
Length=295

 Score =   288 bits (738),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 172/193 (89%), Gaps = 1/193 (1%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  238
            MKLNPLVS LSL+DIA TPGVAADVSHIN+ + V GF  D+ L +AL+GAD+VIIPAGVP
Sbjct  1    MKLNPLVSSLSLYDIAATPGVAADVSHINSPALVKGFMADDQLAEALDGADLVIIPAGVP  60

Query  239  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE  418
            RKPGMTRDDLFNINAGIVK+L  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDE
Sbjct  61   RKPGMTRDDLFNINAGIVKNLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDE  120

Query  419  KRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITILPLFSQATPQAN-LAHDV  595
            KRLFGVTTLDVVRA+TFYAGKANV+V  V+VPV+GGHAGITILPLFSQATP  N L+ + 
Sbjct  121  KRLFGVTTLDVVRARTFYAGKANVDVNTVDVPVVGGHAGITILPLFSQATPSTNALSAEE  180

Query  596  IVGLTXRTQDGGT  634
            I  LT RTQ+GGT
Sbjct  181  IKALTKRTQEGGT  193



>ref|XP_001703167.1| malate dehydrogenase [Chlamydomonas reinhardtii]
 sp|Q42686.1|MDHM_CHLRE RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Chlamydomonas reinhardtii]
 gb|AAA84971.1| malate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDO96543.1| malate dehydrogenase [Chlamydomonas reinhardtii]
Length=373

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 180/211 (85%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLS+LMK+N  VS LSL+DIAGTPGVAADVSHINT+++V GF  D 
Sbjct  63   RKVAVLGAAGGIGQPLSMLMKMNSQVSSLSLYDIAGTPGVAADVSHINTKAQVKGFDKD-  121

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV+ L  A+ ++CP A++N+ISNPV
Sbjct  122  GLAEALRGCDLVIIPAGVPRKPGMTRDDLFKINAGIVRDLVTAVGQHCPGAVLNIISNPV  181

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAE  KK G YD++++ GVTTLDVVRAKTFYA K  ++VA V+VPV+GGHAG+T
Sbjct  182  NSTVPIAAEQLKKMGVYDKRKVMGVTTLDVVRAKTFYAEKNGLDVASVDVPVVGGHAGVT  241

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQATP+A ++ +V+  LT RTQDGGT
Sbjct  242  ILPLFSQATPKATMSAEVLDALTKRTQDGGT  272



>ref|XP_011046119.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Populus 
euphratica]
Length=363

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 188/212 (89%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAA GIGQPL+LL+KLNPL+S LSL+D A TPGVAADVSHIN+R++V  ++G+E
Sbjct  58   RKVAILGAAVGIGQPLALLLKLNPLISSLSLYDKANTPGVAADVSHINSRAQVARYAGEE  117

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +AL+G+DVVIIPA  PRKPGMTRDDLF INAGIVKSL  AIAKYCP+ALVNMI NPV
Sbjct  118  QLVEALDGSDVVIIPARFPRKPGMTRDDLFKINAGIVKSLCTAIAKYCPNALVNMIRNPV  177

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFKKAGT+DE++LFGVTTLDVVRAKTFYAGK  V VAEVNVPV+GG AGIT
Sbjct  178  NSTVPIAAEVFKKAGTFDERKLFGVTTLDVVRAKTFYAGKVKVLVAEVNVPVVGGRAGIT  237

Query  542  ILPLFSQATPQ-ANLAHDVIVGLTXRTQDGGT  634
            ILP+FSQA+P+ +NL+ D I  LT RT+DGGT
Sbjct  238  ILPIFSQASPKSSNLSDDDIKALTKRTRDGGT  269



>gb|KDO48352.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=209

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIA TPGVAADV HINTRSEV G+ G++
Sbjct  29   RKVAVLGAAGGIGQPLALLMKLNPLVSRLALYDIANTPGVAADVGHINTRSEVAGYMGND  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALE +DVVIIPAGVPRKPGMTRDDLFNINAGIVK L +AIAKYCP+A+VNMISNPV
Sbjct  89   QLGQALEDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKDLCSAIAKYCPNAIVNMISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFY  472
            NSTVPIAAEVFKKAGTY+EK+LFGVTTLDVVRAKTFY
Sbjct  149  NSTVPIAAEVFKKAGTYNEKKLFGVTTLDVVRAKTFY  185



>gb|EMT17715.1| Malate dehydrogenase 1, mitochondrial [Aegilops tauschii]
Length=337

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 176/235 (75%), Gaps = 43/235 (18%)
 Frame = +2

Query  59   MKLNPLVSHLSLFDIAGTPGVAADVSHINTRS----------------------------  154
            MKLNPLVS LSL+DIA TPGVAADVSHINTR+                            
Sbjct  1    MKLNPLVSSLSLYDIAATPGVAADVSHINTRALVKGFVGDDQLGEALEGADLVIIPAGAP  60

Query  155  --------------EVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIV  292
                          +V GF GD+ LG+ALEGAD+VIIPAGVPRKPGMTRDDLF INAGIV
Sbjct  61   TSPTSTPAPCPMGPQVKGFVGDDQLGEALEGADLVIIPAGVPRKPGMTRDDLFKINAGIV  120

Query  293  KSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFY  472
            K L  AIA++CP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVRAKTFY
Sbjct  121  KGLCTAIARHCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFY  180

Query  473  agkanvnvaevnvpvIGGHAGITILPLFSQATPQAN-LAHDVIVGLTXRTQDGGT  634
            AGKANV V  VNVPV+GGHAGITILPLFSQATP +N L+H+ +V LT RTQDGGT
Sbjct  181  AGKANVPVTGVNVPVVGGHAGITILPLFSQATPASNALSHEDLVALTKRTQDGGT  235



>gb|KIZ03193.1| malate dehydrogenase [Monoraphidium neglectum]
Length=341

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 172/215 (80%), Gaps = 4/215 (2%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPLSLLMK+NP VS LSL+D+A   GVAAD+SH+NT++   G+ G +
Sbjct  25   RKVAVLGAAGGIGQPLSLLMKMNPAVSQLSLYDVANVKGVAADISHVNTKAVTAGYEGPD  84

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFN----INAGIVKSLSAAIAKYCPHALVNMI  349
             L  AL+G D+VIIPAGVPRKPGMTRDDLF     INAGIVK L  A  KYCP A++N+I
Sbjct  85   ALADALKGCDLVIIPAGVPRKPGMTRDDLFKASRAINAGIVKGLVEACGKYCPGAILNII  144

Query  350  SNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGH  529
            SNPVNSTVPIAAE  KK G YD +++ GVTTLDVVRAKTFYA K  V+VA V++PV+GGH
Sbjct  145  SNPVNSTVPIAAETLKKLGVYDARKVLGVTTLDVVRAKTFYADKLGVDVASVDIPVVGGH  204

Query  530  AGITILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            AGITILPLFSQATP  +L  + I  LT RTQDGGT
Sbjct  205  AGITILPLFSQATPGHSLKAEDINALTKRTQDGGT  239



>gb|ABG22106.1| Malate dehydrogenase, glyoxysomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=260

 Score =   274 bits (701),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH+NT + V GF G   
Sbjct  46   KVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  106  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  +VNVPVIGGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVIGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPPCSFTSEEISYLTTRIQNGGT  255



>gb|KDD74483.1| lactate/malate dehydrogenase [Helicosporidium sp. ATCC 50920]
Length=389

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKV ILGAAGGIGQPLSLLMKL+P V+ L+L+D+ GT GVAAD SHIN+  +V G+ GD+
Sbjct  74   RKVTILGAAGGIGQPLSLLMKLSPYVTELALYDLTGTLGVAADTSHINSSGKVSGYEGDD  133

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG+ALEGADVVIIPAGVPRKPGMTRDDLF INAGIV  L  A A + P A++N+ISNPV
Sbjct  134  QLGQALEGADVVIIPAGVPRKPGMTRDDLFRINAGIVYKLVDACAMHAPGAILNIISNPV  193

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KK G YD++++ GVTTLDVVRAKTFYA KA V V  V++PVIGGHAGIT
Sbjct  194  NSTVPIAAEVLKKRGVYDKRKVMGVTTLDVVRAKTFYAEKAQVGVDRVDIPVIGGHAGIT  253

Query  542  ILPLFSQA--TPQANLAHDVIVGLTXRTQDGGT  634
            ILPLFSQA  +P A L+   +  LT RTQDGGT
Sbjct  254  ILPLFSQAAPSPNAELSAADVEALTKRTQDGGT  286



>ref|XP_001759853.1| predicted protein [Physcomitrella patens]
 gb|EDQ75357.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK++PLVS L L+D+  TPGV AD+SH NT + V GF G++ 
Sbjct  45   KVAILGAAGGIGQPLSLLMKMSPLVSTLHLYDVFNTPGVVADLSHTNTSAVVRGFLGNDQ  104

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG AL+G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   +AK+CP A++N+ISNPVN
Sbjct  105  LGPALDGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLIEGVAKHCPRAIINIISNPVN  164

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEV KKAG YD KRLFGVTTLDVVRA TF A    V+   V+VPV+GGHAGITI
Sbjct  165  STVPIAAEVLKKAGVYDPKRLFGVTTLDVVRANTFVADVIGVDPKMVDVPVLGGHAGITI  224

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LP+ SQATP+       +  LT R Q+GGT
Sbjct  225  LPILSQATPKFTFTDKEVAYLTNRIQNGGT  254



>ref|XP_003055830.1| malate dehydrogenase [Micromonas pusilla CCMP1545]
 gb|EEH59206.1| malate dehydrogenase [Micromonas pusilla CCMP1545]
Length=362

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 173/210 (82%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQ LSLL+K+NP+++ L+L+DI GTPGVAAD+SH NT+++V G++G ++
Sbjct  52   KVAVLGAAGGIGQSLSLLLKMNPMIAQLNLYDIQGTPGVAADLSHTNTQTKVTGYAGADS  111

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL+G D+VIIPAGVPRKPGMTRDDLF INAGIVK+L  A+A  CP ALVN+ISNPVN
Sbjct  112  LADALKGCDLVIIPAGVPRKPGMTRDDLFEINAGIVKTLCEAVAANCPGALVNIISNPVN  171

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD K++FGVTTLDVVR+ TF A    ++V +V++PV+GGHAGITI
Sbjct  172  STVPIAAEVFKKAGTYDPKKVFGVTTLDVVRSNTFVAEAKGLDVNDVDIPVVGGHAGITI  231

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ+ P      D +  +T R Q+ GT
Sbjct  232  LPLLSQSYPATKFDADELEAMTVRIQNAGT  261



>gb|ABA99939.2| Malate dehydrogenase, glyoxysomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=320

 Score =   274 bits (701),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH+NT + V GF G   
Sbjct  46   KVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  106  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  +VNVPVIGGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVIGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPPCSFTSEEISYLTTRIQNGGT  255



>gb|EPS70103.1| malate dehydrogenase, glyoxysomal [Genlisea aurea]
Length=353

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  42   KVAILGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTSAVVRGFLGAQE  101

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP+A+VN+ISNPVN
Sbjct  102  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKSCPNAVVNLISNPVN  161

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD K+L GVT LDVVRA TF A    ++  +V+VPV+GGHAG+TI
Sbjct  162  STVPIAAEVFKKAGTYDPKKLLGVTMLDVVRANTFVAEVLGLDPQQVSVPVVGGHAGVTI  221

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++   + I  LT R QDGGT
Sbjct  222  LPLLSQVKPSSSFTQEEIEYLTKRIQDGGT  251



>ref|XP_010268647.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Nelumbo nucifera]
Length=356

 Score =   275 bits (702),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  +PGV AD+SH++T + V GF G + 
Sbjct  46   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNSPGVTADISHMDTSAVVRGFLGQQQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CPHA+VN+ISNPVN
Sbjct  106  LGSALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPHAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVT LDVVRA T  A    ++  EV+VPVIGGHAGITI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTVVAEVLGIDPREVDVPVIGGHAGITI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++     I  LT R Q+GGT
Sbjct  226  LPLLSQVKPPSSFTPQEINYLTDRIQNGGT  255



>ref|XP_002323942.2| hypothetical protein POPTR_0017s00790g [Populus trichocarpa]
 gb|EEF04075.2| hypothetical protein POPTR_0017s00790g [Populus trichocarpa]
Length=262

 Score =   271 bits (694),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVAILGAAGGIGQPL+LL+KLNPL+S LSL+DIA TPGVAADVSHIN+R++V G++G+E
Sbjct  35   RKVAILGAAGGIGQPLALLLKLNPLISSLSLYDIANTPGVAADVSHINSRAQVAGYAGEE  94

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L +AL+G+DVVIIPAGVPRKPGMTRDDLF INAGIVKSL  AIAKYCP+ALVNMISNPV
Sbjct  95   QLVEALDGSDVVIIPAGVPRKPGMTRDDLFKINAGIVKSLCTAIAKYCPNALVNMISNPV  154

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEVFK AGT+DE++LFGVTTLDVVRAKTFYAGK  V VAEVNVPV+GGHAGIT
Sbjct  155  NSTVPIAAEVFKNAGTFDERKLFGVTTLDVVRAKTFYAGKVKVPVAEVNVPVVGGHAGIT  214

Query  542  ILPLFSQ  562
            ILP+F  
Sbjct  215  ILPIFCH  221



>sp|Q42972.3|MDHG_ORYSJ RecName: Full=Malate dehydrogenase, glyoxysomal; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAA12870.1| glyoxysomal malate dehydrogenase [Oryza sativa Japonica Group]
 gb|ABA99938.2| Malate dehydrogenase, glyoxysomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG89751.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88115.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69729.1| hypothetical protein OsI_39238 [Oryza sativa Indica Group]
 gb|EEE53658.1| hypothetical protein OsJ_36976 [Oryza sativa Japonica Group]
Length=356

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH+NT + V GF G   
Sbjct  46   KVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  106  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  +VNVPVIGGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVIGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPPCSFTSEEISYLTTRIQNGGT  255



>ref|NP_001067346.2| Os12g0632700 [Oryza sativa Japonica Group]
 dbj|BAF30365.2| Os12g0632700 [Oryza sativa Japonica Group]
Length=356

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH+NT + V GF G   
Sbjct  46   KVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGKPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  106  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  +VNVPVIGGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVIGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPPCSFTSEEISYLTTRIQNGGT  255



>gb|ACN62414.1| malate dehydrogenase [Bambusa oldhamii]
Length=357

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPLSLLMK+NPLVS L L+D+  TPGV AD+SH+NT + V GF G   
Sbjct  47   KVAILGASGGIGQPLSLLMKMNPLVSALHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQ  106

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  107  LENALCGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  166

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  +VN+PV+GGHAG+TI
Sbjct  167  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPRDVNIPVVGGHAGVTI  226

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++   + I  LT R Q+GGT
Sbjct  227  LPLLSQVNPPSSFTPEEISYLTSRVQNGGT  256



>gb|ACF87717.1| unknown [Zea mays]
Length=348

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+   PGV AD+SH+NT + V GF G   
Sbjct  39   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNAPGVTADISHMNTGAVVRGFLGQPQ  98

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  99   LENALAGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  158

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  EVNVPVIGGHAGITI
Sbjct  159  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPREVNVPVIGGHAGITI  218

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + +  LT R Q+GGT
Sbjct  219  LPLLSQVNPSCSFTSEEVKYLTSRIQNGGT  248



>ref|XP_002732229.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Saccoglossus 
kowalevskii]
Length=341

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGA+GGIGQP+SLL+K +PL+SHLSLFDI  TPGVAAD+SHI TR++V G +G++
Sbjct  29   RKVAVLGASGGIGQPMSLLLKQSPLISHLSLFDIVHTPGVAADLSHIETRAKVTGHTGND  88

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             LG AL+G +VV+IPAGVPRKPGMTRDDLFN NA IV++L+   AK+CP A++ +ISNPV
Sbjct  89   ELGAALDGCEVVVIPAGVPRKPGMTRDDLFNTNASIVQTLAEGCAKHCPEAMICIISNPV  148

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPI +EVFKKAG YD K++FGVTTLD+VR+ TF A    ++V++ + PV+GGH+GIT
Sbjct  149  NSTVPITSEVFKKAGVYDPKKIFGVTTLDIVRSNTFIAEGKGLDVSKTSCPVVGGHSGIT  208

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            I+PL SQ +P+ +   D +  LT R Q+ GT
Sbjct  209  IVPLISQCSPKVSYPQDELEKLTNRIQNAGT  239



>ref|XP_002500632.1| malate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO61890.1| malate dehydrogenase [Micromonas sp. RCC299]
Length=319

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQ LSLL+K+NPL+S L+L+DIA TPGVAAD+SH NT   V G++G+E 
Sbjct  8    KVAVLGAAGGIGQSLSLLLKMNPLISDLALYDIANTPGVAADLSHTNTTCSVKGYAGEEQ  67

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL+G D+VIIPAGVPRKPGMTRDDLF+INAGIVK+L  A AK CP A++N+ISNPVN
Sbjct  68   LADALKGCDLVIIPAGVPRKPGMTRDDLFSINAGIVKNLCEACAKNCPKAILNIISNPVN  127

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIA+EV+KKAG YD K++FGVTTLDVVR+ TF +    ++V +V+VPV+GGHAGITI
Sbjct  128  STVPIASEVYKKAGVYDPKKIFGVTTLDVVRSNTFISEAKGLDVNDVDVPVVGGHAGITI  187

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P      + +  LT R Q+ GT
Sbjct  188  LPLLSQTYPSTKFTAEELEALTVRIQNAGT  217



>gb|AFX00023.1| malate dehydrogenase [Echinochloa crus-galli]
Length=361

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH+NT + V GF G   
Sbjct  51   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQ  110

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  111  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPKAIVNVISNPVN  170

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  EVNVPVIGGHAG+TI
Sbjct  171  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPREVNVPVIGGHAGVTI  230

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + +  LT R Q+GGT
Sbjct  231  LPLLSQVNPACSFTPEEVNHLTSRIQNGGT  260



>gb|AHB50501.1| malate dehydrogenase 2 [Mayetiola destructor]
Length=337

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+ GA+GGIGQPLSLL+K +PLVSHLSL+DI  TPGVAAD+SHI+T ++V GF+G EN
Sbjct  26   KVAVCGASGGIGQPLSLLLKQSPLVSHLSLYDIVHTPGVAADLSHIDTPAKVEGFNGAEN  85

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L KAL+GADVVIIPAGVPRKPGMTRDDLFN NAG+V+ L+ AI+K CP ALV +I+NPVN
Sbjct  86   LEKALKGADVVIIPAGVPRKPGMTRDDLFNTNAGVVRDLAVAISKACPKALVGIITNPVN  145

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            S VPIA+EV KKAGTYD  R+FGV+TLDVVRA  F    +  N  +V +PVIGGH+G+TI
Sbjct  146  SCVPIASEVLKKAGTYDANRIFGVSTLDVVRACAFIGEASKTNPMDVKIPVIGGHSGVTI  205

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ +P  N     +  LT R Q+ GT
Sbjct  206  IPLLSQCSPAVNFPEAQVKALTQRIQEAGT  235



>ref|XP_006664772.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Oryza brachyantha]
Length=364

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  T GV AD+SH+NT + V GF G   
Sbjct  54   KVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTSGVTADISHMNTGAVVRGFLGQPQ  113

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G DVVIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+ALVN+ISNPVN
Sbjct  114  LENALTGMDVVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNALVNVISNPVN  173

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  +VNVPV+GGHAG+TI
Sbjct  174  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVVGGHAGVTI  233

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  234  LPLLSQVNPPCSFTSEEISYLTSRIQNGGT  263



>dbj|BAK05961.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLLMK+NPLVS L L+D+  TPGV AD+SH+NT + V GF G   
Sbjct  48   KVAVLGASGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  108  LESALTGMDLVIIPAGIPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  +VNVPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPRDVNVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  228  LPLLSQVNPPCSFTSEEISYLTSRIQNGGT  257



>ref|NP_001132077.2| uncharacterized protein LOC100193491 [Zea mays]
 gb|ACF87658.1| unknown [Zea mays]
 gb|ACF80764.2| unknown [Zea mays]
 gb|ACF86594.2| unknown [Zea mays]
Length=360

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+   PGV AD+SH+NT + V GF G   
Sbjct  51   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNAPGVTADISHMNTGAVVRGFLGQPQ  110

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  111  LENALAGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  170

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  EVNVPVIGGHAGITI
Sbjct  171  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPREVNVPVIGGHAGITI  230

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + +  LT R Q+GGT
Sbjct  231  LPLLSQVNPSCSFTSEEVKYLTSRIQNGGT  260



>gb|ACG24454.1| malate dehydrogenase, glyoxysomal precursor [Zea mays]
Length=360

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+   PGV AD+SH+NT + V GF G   
Sbjct  51   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNAPGVTADISHMNTGAVVRGFLGQPQ  110

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  111  LENALAGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  170

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  EVNVPVIGGHAGITI
Sbjct  171  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPREVNVPVIGGHAGITI  230

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + +  LT R Q+GGT
Sbjct  231  LPLLSQVNPSCSFTSEEVKYLTSRIQNGGT  260



>ref|XP_004963291.1| PREDICTED: malate dehydrogenase, glyoxysomal-like isoform X2 
[Setaria italica]
Length=363

 Score =   273 bits (698),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+   PGV AD+SH+NT + V GF G   
Sbjct  53   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNAPGVTADISHMNTGAVVRGFLGQPQ  112

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+V+IPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  113  LENALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPKAIVNVISNPVN  172

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  EVNVPVIGGHAG+TI
Sbjct  173  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPREVNVPVIGGHAGVTI  232

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L  + +  LT R Q+GGT
Sbjct  233  LPLLSQVNPACSLTSEEVNHLTSRIQNGGT  262



>gb|ACR36673.1| unknown [Zea mays]
Length=333

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV ADVSH++T + V GF G + 
Sbjct  23   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADVSHMDTSAVVRGFLGAQQ  82

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFN NAGIV++L   +A+ CP+A+VN+ISNPVN
Sbjct  83   LDAALTGMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRTLCEGVARCCPNAIVNLISNPVN  142

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDV RA TF A    V+  +V+VPV+GGHAGITI
Sbjct  143  STVPIAAEVFKKAGTYDPKRLLGVTTLDVARANTFVAEVLGVDPRDVSVPVVGGHAGITI  202

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ TP ++   D    LT R Q+GGT
Sbjct  203  LPLLSQVTPPSSFTQDETRYLTDRIQNGGT  232



>gb|KDO78776.1| hypothetical protein CISIN_1g018265mg [Citrus sinensis]
 gb|KDO78777.1| hypothetical protein CISIN_1g018265mg [Citrus sinensis]
Length=289

 Score =   271 bits (692),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  48   KVAVLGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTNAVVRGFLGQQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKK GTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L    I  LT R Q+GGT
Sbjct  228  LPLLSQVKPSCSLTPTEIDYLTDRIQNGGT  257



>gb|KDO78778.1| hypothetical protein CISIN_1g018265mg [Citrus sinensis]
Length=270

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  48   KVAVLGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTNAVVRGFLGQQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKK GTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L    I  LT R Q+GGT
Sbjct  228  LPLLSQVKPSCSLTPTEIDYLTDRIQNGGT  257



>ref|XP_002443645.1| hypothetical protein SORBIDRAFT_08g022770 [Sorghum bicolor]
 gb|EES17483.1| hypothetical protein SORBIDRAFT_08g022770 [Sorghum bicolor]
Length=365

 Score =   273 bits (698),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  55   KVAILGAAGGIGQPLALLMKINPLVSVLHLYDVVNTPGVTADISHMSTGAVVRGFLGQPQ  114

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  115  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  174

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  EVNVPVIGGHAGITI
Sbjct  175  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPREVNVPVIGGHAGITI  234

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + +  LT R Q+GGT
Sbjct  235  LPLLSQVNPSCSFTSEEVKYLTSRIQNGGT  264



>ref|XP_006426175.1| hypothetical protein CICLE_v10025945mg [Citrus clementina]
 gb|ESR39415.1| hypothetical protein CICLE_v10025945mg [Citrus clementina]
Length=305

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  48   KVAVLGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTNAVVRGFLGQQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKK GTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L    I  LT R Q+GGT
Sbjct  228  LPLLSQVKPSCSLTPTEIDYLTDRIQNGGT  257



>ref|XP_003576179.1| PREDICTED: malate dehydrogenase, glyoxysomal [Brachypodium distachyon]
Length=359

 Score =   272 bits (696),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLLMK+NPLVS L L+D+   PGV AD+SH+NT + V GF G   
Sbjct  49   KVAVLGASGGIGQPLSLLMKMNPLVSVLHLYDVVNMPGVTADISHMNTGAVVRGFLGQPQ  108

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  109  LENALTGMDLVIIPAGIPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVN  168

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  +VNVPV+GGHAGITI
Sbjct  169  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPRDVNVPVVGGHAGITI  228

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  229  LPLLSQVNPSCSFTSEEISYLTSRIQNGGT  258



>gb|KHG09742.1| Malate dehydrogenase-2C glyoxysomal [Gossypium arboreum]
Length=359

 Score =   272 bits (696),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  49   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQQQ  108

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  109  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  168

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D  RL GVT LDVVRA TF A    ++  EV+VPVIGGHAGITI
Sbjct  169  STVPIAAEVFKKAGTFDPNRLLGVTMLDVVRANTFVAEVMGLDPREVDVPVIGGHAGITI  228

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  229  LPLLSQVKPPCSFTQKEIEYLTNRIQNGGT  258



>ref|NP_001148518.1| malate dehydrogenase, glyoxysomal [Zea mays]
 gb|ACG31813.1| malate dehydrogenase, glyoxysomal precursor [Zea mays]
Length=358

 Score =   272 bits (696),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV ADVSH++T + V GF G + 
Sbjct  48   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADVSHMDTSAVVRGFLGAQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFN NAGIV++L   +A+ CP+A+VN+ISNPVN
Sbjct  108  LDAALTGMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRTLCEGVARCCPNAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDV RA TF A    V+  +V+VPV+GGHAGITI
Sbjct  168  STVPIAAEVFKKAGTYDPKRLLGVTTLDVARANTFVAEVLGVDPRDVSVPVVGGHAGITI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ TP ++   D    LT R Q+GGT
Sbjct  228  LPLLSQVTPPSSFTQDETRYLTDRIQNGGT  257



>gb|KDO78775.1| hypothetical protein CISIN_1g018265mg [Citrus sinensis]
Length=305

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  48   KVAVLGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTNAVVRGFLGQQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKK GTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L    I  LT R Q+GGT
Sbjct  228  LPLLSQVKPSCSLTPTEIDYLTDRIQNGGT  257



>tpg|DAA51667.1| TPA: malate dehydrogenase [Zea mays]
Length=358

 Score =   272 bits (696),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV ADVSH++T + V GF G + 
Sbjct  48   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADVSHMDTSAVVRGFLGAQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFN NAGIV++L   +A+ CP+A+VN+ISNPVN
Sbjct  108  LDAALTGMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRTLCEGVARCCPNAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDV RA TF A    V+  +V+VPV+GGHAGITI
Sbjct  168  STVPIAAEVFKKAGTYDPKRLLGVTTLDVARANTFVAEVLGVDPRDVSVPVVGGHAGITI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ TP ++   D    LT R Q+GGT
Sbjct  228  LPLLSQVTPPSSFTQDETRYLTDRIQNGGT  257



>ref|XP_004963290.1| PREDICTED: malate dehydrogenase, glyoxysomal-like isoform X1 
[Setaria italica]
Length=391

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+   PGV AD+SH+NT + V GF G   
Sbjct  53   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNAPGVTADISHMNTGAVVRGFLGQPQ  112

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+V+IPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  113  LENALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPKAIVNVISNPVN  172

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF      ++  EVNVPVIGGHAG+TI
Sbjct  173  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVGEVLGLDPREVNVPVIGGHAGVTI  232

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L  + +  LT R Q+GGT
Sbjct  233  LPLLSQVNPACSLTSEEVNHLTSRIQNGGT  262



>ref|XP_003611508.1| Malate dehydrogenase, glyoxysomal [Medicago truncatula]
 gb|AES94466.1| glyoxysomal malate dehydrogenase [Medicago truncatula]
Length=358

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLS+LMK+NPLVS L L+D+  TPGV +D+SH++T + V GF G   
Sbjct  48   KVAILGAAGGIGQPLSMLMKINPLVSVLHLYDVVNTPGVTSDISHMDTSAVVRGFLGQNQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAIAKQCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AGTYD KRL GVT LDVVRA TF A    ++  +V+VPV+GGHAGITI
Sbjct  168  STVPIAAEVFKRAGTYDPKRLLGVTMLDVVRANTFVAEVMGLDPRDVDVPVVGGHAGITI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++     I  LT R Q+GGT
Sbjct  228  LPLLSQVKPPSSFTPKEIEYLTDRIQNGGT  257



>ref|XP_010271551.1| PREDICTED: malate dehydrogenase, glyoxysomal [Nelumbo nucifera]
 ref|XP_010271552.1| PREDICTED: malate dehydrogenase, glyoxysomal [Nelumbo nucifera]
Length=356

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  +PGV ADVSH++T + V GF G + 
Sbjct  46   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNSPGVTADVSHMDTGAVVRGFLGQQQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+V+IPAGVPRKPGMTRDDLF INAGIVK+L   IAK CPHA++N+ISNPVN
Sbjct  106  LESALTGMDLVVIPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPHAIINLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTFDPKRLLGVTMLDVVRANTFVAEILGLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVKPPCSFTQEEIKYLTDRIQNGGT  255



>gb|EPS68273.1| malate dehydrogenase, partial [Genlisea aurea]
Length=313

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++L+K+NPLVS L L+D+  +PGV AD+SH++T S V GF G++N
Sbjct  3    KVAILGAAGGIGQPLAMLVKMNPLVSLLHLYDVVNSPGVTADISHMDTASMVRGFLGEQN  62

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G ++VIIPAG+PRKPGMTRDDLFNINAGIVK+LS AIA++CP A+VN+ISNPVN
Sbjct  63   LSDALTGMELVIIPAGIPRKPGMTRDDLFNINAGIVKTLSEAIAEFCPKAIVNIISNPVN  122

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEV K AG YD +RL GVT LDVVRA TF      ++  +V VPV+GGHAG+TI
Sbjct  123  STVPIAAEVLKNAGVYDPRRLLGVTKLDVVRANTFLGEVLGLDPRDVYVPVVGGHAGVTI  182

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQA P  +L  +    LT R Q+GGT
Sbjct  183  LPLLSQAKPPCSLTEEETKVLTYRIQNGGT  212



>ref|NP_179863.1| peroxisomal NAD-malate dehydrogenase [Arabidopsis thaliana]
 sp|O82399.1|MDHG2_ARATH RecName: Full=Probable malate dehydrogenase, glyoxysomal; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL16276.1|AF428346_1 At2g22780/T30L20.4 [Arabidopsis thaliana]
 gb|AAC63589.1| putative glyoxysomal malate dehydrogenase precursor [Arabidopsis 
thaliana]
 gb|AAO23574.1| At2g22780/T30L20.4 [Arabidopsis thaliana]
 dbj|BAE99124.1| putative glyoxysomal malate dehydrogenase precursor [Arabidopsis 
thaliana]
 gb|AEC07353.1| malate dehydrogenase [Arabidopsis thaliana]
Length=354

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  44   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAVVRGFLGQPQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  104  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAIVNIISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVEVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPPCSFTQKEIEYLTDRIQNGGT  253



>ref|XP_006426177.1| hypothetical protein CICLE_v10025945mg [Citrus clementina]
 gb|ESR39417.1| hypothetical protein CICLE_v10025945mg [Citrus clementina]
Length=358

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  48   KVAVLGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTNAVVRGFLGQQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKK GTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L    I  LT R Q+GGT
Sbjct  228  LPLLSQVKPSCSLTPTEIDYLTDRIQNGGT  257



>ref|XP_006294611.1| hypothetical protein CARUB_v10023648mg [Capsella rubella]
 gb|EOA27509.1| hypothetical protein CARUB_v10023648mg [Capsella rubella]
Length=321

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  44   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAIVRGFLGQPQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  104  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAVVNIISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPPCSFTQKEIEYLTGRIQNGGT  253



>ref|XP_006404741.1| hypothetical protein EUTSA_v10000218mg [Eutrema salsugineum]
 gb|ESQ46194.1| hypothetical protein EUTSA_v10000218mg [Eutrema salsugineum]
Length=353

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  43   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAIVRGFLGQPQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  103  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAIVNIISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  163  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  223  LPLLSQVKPPCSFTQKEIEYLTDRIQNGGT  252



>ref|NP_001051419.1| Os03g0773800 [Oryza sativa Japonica Group]
 gb|AAP68889.1| putative glyoxysomal malate dehydrogenase [Oryza sativa Japonica 
Group]
 gb|ABF99109.1| Malate dehydrogenase, glyoxysomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13333.1| Os03g0773800 [Oryza sativa Japonica Group]
 gb|EAY92009.1| hypothetical protein OsI_13699 [Oryza sativa Indica Group]
 gb|EAZ28741.1| hypothetical protein OsJ_12762 [Oryza sativa Japonica Group]
 dbj|BAG89302.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90270.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96976.1| unnamed protein product [Oryza sativa Japonica Group]
Length=354

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPLSLLMKLNPLVS L L+D+  TPGV ADVSH++T + V GF G   
Sbjct  44   KVAVLGAAGGIGQPLSLLMKLNPLVSVLHLYDVVNTPGVTADVSHMDTTAVVRGFLGPNQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFN NAGIV+SL   +AK CP+A+VN+ISNPVN
Sbjct  104  LEAALTGMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRSLCEGVAKCCPNAIVNLISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDV RA TF A    ++  +VNVPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTYDPKRLLGVTTLDVARANTFVAEVLGIDPKDVNVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   D I  LT R Q+GGT
Sbjct  224  LPLLSQVHPPCSFTPDEISYLTKRIQNGGT  253



>ref|XP_009900530.1| PREDICTED: malate dehydrogenase, mitochondrial, partial [Picoides 
pubescens]
Length=321

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  9    KVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIETRATVKGFMGPEQ  68

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+ A AK+CP A++ +ISNPVN
Sbjct  69   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTTACAKHCPEAMICIISNPVN  128

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PI +EVFKK G Y+ K++FGVTTLD+VRA TF A    ++ A V VPVIGGHAG TI
Sbjct  129  STIPITSEVFKKQGVYNPKKIFGVTTLDIVRANTFVAELKGLDPARVTVPVIGGHAGKTI  188

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+ +   D +V LT R Q+ GT
Sbjct  189  IPLISQCTPKVDFPQDQLVKLTGRIQEAGT  218



>gb|KCW59620.1| hypothetical protein EUGRSUZ_H02358 [Eucalyptus grandis]
Length=280

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLALLMKINPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  106  LEEALVGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGIAKSCPKAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  226  LPLLSQVKPPCSFTPPEIDYLTSRIQNGGT  255



>gb|KCW59619.1| hypothetical protein EUGRSUZ_H02358 [Eucalyptus grandis]
Length=277

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLALLMKINPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  106  LEEALVGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGIAKSCPKAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  226  LPLLSQVKPPCSFTPPEIDYLTSRIQNGGT  255



>ref|NP_001239889.1| malate dehydrogenase, glyoxysomal-like [Glycine max]
 gb|ACU23945.1| unknown [Glycine max]
Length=356

 Score =   270 bits (691),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV ADVSH++T + V GF G + 
Sbjct  46   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADVSHMDTGAVVRGFLGQQQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  106  LESALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGIAKSCPNAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STV IAAEVFKKAGTYD KRL GVTTLDVVRA TF A    V+  EV+VPV+GGHAG+TI
Sbjct  166  STVAIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGVDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P+++   +    LT R Q+GGT
Sbjct  226  LPLLSQVKPRSSFTAEETEYLTNRIQNGGT  255



>ref|XP_002880457.1| peroxisomal NAD-malate dehydrogenase 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56716.1| peroxisomal NAD-malate dehydrogenase 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  44   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAVVRGFLGQPQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  104  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAVVNIISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPPCSFTQKEIEYLTDRIQNGGT  253



>ref|XP_006466391.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Citrus sinensis]
 gb|KDO78772.1| hypothetical protein CISIN_1g018265mg [Citrus sinensis]
Length=358

 Score =   270 bits (691),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  48   KVAVLGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTNAVVRGFLGQQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKK GTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +L    I  LT R Q+GGT
Sbjct  228  LPLLSQVKPSCSLTPTEIDYLTDRIQNGGT  257



>ref|XP_008787238.1| PREDICTED: malate dehydrogenase, glyoxysomal-like isoform X1 
[Phoenix dactylifera]
Length=356

 Score =   270 bits (691),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQSQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK+CP+A+VN+ISNPVN
Sbjct  106  LESALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKWCPNAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AG YD K L GVTTLDVVRA TF A    ++  EVNVPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKQAGIYDPKHLLGVTTLDVVRANTFVAEVLGIDPREVNVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPPCSFTSEEIRYLTDRIQNGGT  255



>ref|XP_006422684.1| hypothetical protein CICLE_v10028730mg [Citrus clementina]
 gb|ESR35924.1| hypothetical protein CICLE_v10028730mg [Citrus clementina]
Length=239

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  22   KVAILGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  81

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  82   LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNLISNPVN  141

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD K+L GVT LDVVRA TF A    ++  +V+VPV+GGHAG+TI
Sbjct  142  STVPIAAEVFKKAGTYDPKKLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTI  201

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   +    LT R Q+GGT
Sbjct  202  LPLLSQVKPPCSFTQEEAEYLTNRIQNGGT  231



>gb|KDP32142.1| hypothetical protein JCGZ_12603 [Jatropha curcas]
Length=332

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  22   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQQQ  81

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  82   LEDALIGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPQAIVNIISNPVN  141

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  142  STVPIAAEVFKKAGTFDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  201

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++     I  LT R Q+GGT
Sbjct  202  LPLLSQVKPPSSFTQKEIDYLTDRIQNGGT  231



>ref|XP_010417036.1| PREDICTED: probable malate dehydrogenase, glyoxysomal isoform 
X2 [Camelina sativa]
Length=356

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAIVRGFLGQSQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+V+IPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  106  LEEALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAVVNIISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  226  LPLLSQVKPPCSFTQKEIEYLTGRIQNGGT  255



>ref|XP_002054903.1| GJ22544 [Drosophila virilis]
 gb|EDW68423.1| GJ22544 [Drosophila virilis]
Length=336

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KV + GA+GGIGQPLSLL+K NPLV+ LSL+DI  TPGVAAD+SHI+T+S+ VGF G + 
Sbjct  26   KVTVCGASGGIGQPLSLLLKQNPLVTDLSLYDIVHTPGVAADLSHIDTKSKTVGFMGADQ  85

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG +L+G+DVV+IPAGVPRKPGMTRDDLFN+NAGI+K +S AIAK CP ALV +I+NPVN
Sbjct  86   LGASLKGSDVVVIPAGVPRKPGMTRDDLFNVNAGIIKDISNAIAKNCPKALVAIITNPVN  145

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            + VPIAAE+ KKAG YD KRLFGV+TLDVVRA+ F      V+   V +PVIGGH+G+TI
Sbjct  146  TCVPIAAEILKKAGVYDPKRLFGVSTLDVVRARAFIGHALGVDPQSVQIPVIGGHSGVTI  205

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LP+ SQ+ PQ     D I  LT R Q+ GT
Sbjct  206  LPVLSQSQPQFKGNQDAIEKLTVRIQEAGT  235



>ref|XP_010105100.1| Malate dehydrogenase [Morus notabilis]
 gb|EXC03885.1| Malate dehydrogenase [Morus notabilis]
Length=362

 Score =   270 bits (691),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  52   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQAQ  111

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK CP+A+VN+ISNPVN
Sbjct  112  LEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAIAKCCPNAIVNLISNPVN  171

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D KRL GVT LDVVRA TF A    ++  +V+VPV+GGHAG+TI
Sbjct  172  STVPIAAEVFKKAGTFDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTI  231

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  232  LPLLSQVKPACSFTDKEIDYLTDRIQNGGT  261



>gb|KFV61776.1| hypothetical protein N307_13393, partial [Picoides pubescens]
Length=319

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  7    KVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIETRATVKGFMGPEQ  66

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+ A AK+CP A++ +ISNPVN
Sbjct  67   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTTACAKHCPEAMICIISNPVN  126

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PI +EVFKK G Y+ K++FGVTTLD+VRA TF A    ++ A V VPVIGGHAG TI
Sbjct  127  STIPITSEVFKKQGVYNPKKIFGVTTLDIVRANTFVAELKGLDPARVTVPVIGGHAGKTI  186

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+ +   D +V LT R Q+ GT
Sbjct  187  IPLISQCTPKVDFPQDQLVKLTGRIQEAGT  216



>gb|KFK33003.1| hypothetical protein AALP_AA6G317500 [Arabis alpina]
Length=353

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK NPLVS L L+D+A  PGV AD+SH++T + V GF G + 
Sbjct  43   KVAILGAAGGIGQPLAMLMKTNPLVSLLHLYDVANAPGVTADISHMDTSAIVRGFLGQQQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  103  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPQAIVNVISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG++I
Sbjct  163  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVSI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  223  LPLLSQVKPPCSFTQKEIEYLTDRIQNGGT  252



>ref|XP_007047659.1| Peroxisomal NAD-malate dehydrogenase 1 isoform 3 [Theobroma cacao]
 gb|EOX91816.1| Peroxisomal NAD-malate dehydrogenase 1 isoform 3 [Theobroma cacao]
Length=288

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   PGV AD+SH++T + V GF G + 
Sbjct  48   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQQQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  108  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKAGTFDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  228  LPLLSQVKPPCSFTQKEIDYLTDRIQNGGT  257



>ref|XP_010646909.1| PREDICTED: malate dehydrogenase, glyoxysomal isoform X2 [Vitis 
vinifera]
Length=332

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV +D+SH++T + V GF G + 
Sbjct  22   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNTPGVTSDISHMDTGAVVRGFLGQQQ  81

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP+A+VN+ISNPVN
Sbjct  82   LEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPNAIVNLISNPVN  141

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  142  STVPIAAEVFKKAGTFDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  201

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  202  LPLLSQVKPPCSFTPEEIDYLTARIQNGGT  231



>ref|XP_002310874.2| malate dehydrogenase family protein, partial [Populus trichocarpa]
 gb|EEE91324.2| malate dehydrogenase family protein, partial [Populus trichocarpa]
Length=257

 Score =   266 bits (681),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   PGV AD+SH++T + V GF G + 
Sbjct  44   KVAILGAAGGIGQPLAMLMKMNPLVSLLHLYDVVNAPGVTADISHMDTSAVVRGFLGQQQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK CP A+VN+ISNPVN
Sbjct  104  LEDALIGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAIAKCCPKAIVNIISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAG +D KR+ GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGVFDPKRVLGVTMLDVVRANTFVAEIMGLDPREVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPLCSFTQKEIDYLTDRIQNGGT  253



>ref|XP_010943220.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Elaeis guineensis]
Length=356

 Score =   270 bits (689),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  46   KVALLGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   I+K CP+A+VN+ISNPVN
Sbjct  106  LESALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGISKCCPNAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AGTYD KRL GVTTLDVVRA TF A    ++  EVNVPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKQAGTYDPKRLLGVTTLDVVRANTFVAEVLGIDPREVNVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPSCSFTTEEISYLTDRIQNGGT  255



>ref|XP_001759620.1| predicted protein [Physcomitrella patens]
 gb|EDQ75532.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   270 bits (689),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPLSLLMK++PLVS L L+D+  TPGV AD+SH NT + V GF G++ 
Sbjct  45   KVAVLGAAGGIGQPLSLLMKMHPLVSTLHLYDVFNTPGVVADLSHTNTSAVVRGFLGNDQ  104

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            LG AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L    AK+CP A +N+ISNPVN
Sbjct  105  LGPALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLIEGCAKHCPRAFINIISNPVN  164

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEV K AG YD KRLFGVTTLDVVRA TF A    V+   V+VPV+GGHAGITI
Sbjct  165  STVPIAAEVLKLAGVYDPKRLFGVTTLDVVRANTFVAEVIGVDPKTVDVPVLGGHAGITI  224

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LP+ SQ TPQ       +  LT R Q+GGT
Sbjct  225  LPILSQVTPQFTFTDKEVAYLTNRIQNGGT  254



>emb|CEF96952.1| Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 
[Ostreococcus tauri]
Length=360

 Score =   270 bits (689),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQ LSLL+K+NPL+S L L+D+A TPGVAAD+SH NT  +V GF G + 
Sbjct  50   KVAVLGAAGGIGQSLSLLLKMNPLISDLRLYDLANTPGVAADLSHTNTGCKVTGFMGADQ  109

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL+G D+V+IPAGVPRKPGMTRDDLF INAGIV+ L  A  K CP+AL+N+ISNPVN
Sbjct  110  LEDALKGCDLVVIPAGVPRKPGMTRDDLFAINAGIVRDLCQACTKACPNALINIISNPVN  169

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIA EVFKKAG YD +++FGVTTLD+VR+ TF A    +++ +V+VPVIGGHAGITI
Sbjct  170  STVPIATEVFKKAGCYDARKIFGVTTLDIVRSNTFVAEAKGLDINDVDVPVIGGHAGITI  229

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P+     D I  LT R Q+ GT
Sbjct  230  LPLLSQTYPKCEFTSDEIEKLTVRIQNAGT  259



>gb|KJB18106.1| hypothetical protein B456_003G034300 [Gossypium raimondii]
Length=359

 Score =   270 bits (689),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  49   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQQQ  108

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP+A+VN+ISNPVN
Sbjct  109  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPNAIVNLISNPVN  168

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D  RL GVT LD VRA TF A    ++  EV+VPVIGGHAG+TI
Sbjct  169  STVPIAAEVFKKAGTFDPNRLLGVTMLDAVRANTFVAEVMGLDPREVDVPVIGGHAGVTI  228

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  229  LPLLSQVKPPCSFTQKEIDYLTNRIQNGGT  258



>ref|XP_010417035.1| PREDICTED: probable malate dehydrogenase, glyoxysomal isoform 
X1 [Camelina sativa]
Length=354

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  44   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAIVRGFLGQSQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+V+IPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  104  LEEALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAVVNIISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPPCSFTQKEIEYLTGRIQNGGT  253



>ref|XP_011088014.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Sesamum indicum]
Length=353

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  +PGV AD+SH++T + V GF G + 
Sbjct  43   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNSPGVTADISHMDTGAVVRGFLGQQQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+V+IPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP+A+VN+ISNPVN
Sbjct  103  LESALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKSCPNAIVNLISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD K+L GVT LDVVRA TF A    ++  EVNVPV+GGHAG+TI
Sbjct  163  STVPIAAEVFKKAGTYDPKKLLGVTMLDVVRANTFVAEVLGLDPREVNVPVVGGHAGVTI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   +    LT R QDGGT
Sbjct  223  LPLLSQVKPPCSFTSEETEYLTKRIQDGGT  252



>ref|XP_010429212.1| PREDICTED: probable malate dehydrogenase, glyoxysomal [Camelina 
sativa]
Length=354

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  44   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAIVRGFLGQPQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+V+IPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  104  LEEALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAVVNIISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPPCSFTQKEIEYLTDRIQNGGT  253



>ref|XP_006650666.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Oryza brachyantha]
Length=354

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQ LSLLMK+NPLVS L L+D+  TPGV ADVSH++T + V GF G + 
Sbjct  44   KVAVLGAAGGIGQSLSLLMKMNPLVSVLHLYDVVNTPGVTADVSHMDTTAVVRGFLGAQQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFN NAGIV++L   +AK CP+A+VN+ISNPVN
Sbjct  104  LEAALTGMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRTLCEGVAKCCPNAIVNLISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDV RA TF A    V+  EVNVPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTYDPKRLLGVTTLDVARANTFVAEVLGVDPKEVNVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ TP  +   D I  LT R Q+GGT
Sbjct  224  LPLLSQVTPPCSFTPDEISYLTKRIQNGGT  253



>gb|KCW59621.1| hypothetical protein EUGRSUZ_H02358 [Eucalyptus grandis]
Length=294

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLALLMKINPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  106  LEEALVGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGIAKSCPKAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  226  LPLLSQVKPPCSFTPPEIDYLTSRIQNGGT  255



>ref|XP_005525897.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005525898.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Pseudopodoces 
humilis]
Length=336

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  24   KVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIETRASVKGFMGPEQ  83

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL++A AK+CP A++ +ISNPVN
Sbjct  84   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTSACAKHCPEAMICIISNPVN  143

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIA+EVFKK G Y+  ++FGVTTLD+VRA TF A    ++ A V VPVIGGHAG TI
Sbjct  144  STVPIASEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVTVPVIGGHAGKTI  203

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+     D +  LT R Q+ GT
Sbjct  204  IPLISQCTPKVEFPQDQLEKLTARIQEAGT  233



>ref|XP_006852732.1| hypothetical protein AMTR_s00033p00085320 [Amborella trichopoda]
 gb|ERN14199.1| hypothetical protein AMTR_s00033p00085320 [Amborella trichopoda]
Length=354

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+  +PGV ADVSH++T + V GF G E 
Sbjct  44   KVAVLGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNSPGVTADVSHMDTSAVVRGFLGKEQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   I   CP+A+VN+ISNPVN
Sbjct  104  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIVNCCPNAIVNLISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D KRL GVT LDVVRA TF A    V+  +V+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTFDPKRLLGVTMLDVVRANTFVAEVLGVDPKDVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  PQ     D +  LT R Q+GGT
Sbjct  224  LPLLSQVKPQYTFTADEVRYLTDRIQNGGT  253



>ref|XP_010941982.1| PREDICTED: malate dehydrogenase, glyoxysomal isoform X1 [Elaeis 
guineensis]
Length=356

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK+CP+A+VN+ISNPVN
Sbjct  106  LESALIGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKWCPNAIVNVISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AGTYD K L GVTTLDVVRA TF A    +N  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKQAGTYDPKHLLGVTTLDVVRANTFVAEVLGINPREVSVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPPYSFTTEEIRYLTDRIQNGGT  255



>ref|XP_010472275.1| PREDICTED: probable malate dehydrogenase, glyoxysomal [Camelina 
sativa]
Length=354

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  44   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAIVRGFLGQPQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+V+IPAGVPRKPGMTRDDLFNINAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  104  LEEALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAVVNIISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPPCSFTQKEIEYLTGRIQNGGT  253



>ref|XP_011002784.1| PREDICTED: malate dehydrogenase, glyoxysomal [Populus euphratica]
Length=354

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGAAGGIGQPL++LMK+NPLVS L L+D+   PGV AD+SH++T + V GF G   
Sbjct  44   KVAVLGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQPQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   +AK CP+A+VN+ISNPVN
Sbjct  104  LESALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGVAKCCPNAIVNLISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  164  STVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQA P ++   +    LT R QDGGT
Sbjct  224  LPLLSQAKPPSSFTPEETEYLTKRIQDGGT  253



>ref|XP_009140390.1| PREDICTED: probable malate dehydrogenase, glyoxysomal [Brassica 
rapa]
Length=353

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  43   KVAILGAAGGIGQPLAMLMKMNPLVSLLHLYDVANAPGVTADISHMDTSAIVRGFLGQSQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  103  LEEALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLSEAIAKCCPKAIVNIISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  163  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  223  LPLLSQVKPPCSFTQNEIEYLTDRIQNGGT  252



>gb|KJB18107.1| hypothetical protein B456_003G034300 [Gossypium raimondii]
Length=357

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G + 
Sbjct  49   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQQQ  108

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP+A+VN+ISNPVN
Sbjct  109  LEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPNAIVNLISNPVN  168

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D  RL GVT LD VRA TF A    ++  EV+VPVIGGHAG+TI
Sbjct  169  STVPIAAEVFKKAGTFDPNRLLGVTMLDAVRANTFVAEVMGLDPREVDVPVIGGHAGVTI  228

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  229  LPLLSQVKPPCSFTQKEIDYLTNRIQNGGT  258



>gb|KDO67936.1| hypothetical protein CISIN_1g016424mg [Citrus sinensis]
Length=258

 Score =   265 bits (678),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  22   KVAILGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  81

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A VN+ISNPVN
Sbjct  82   LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNATVNLISNPVN  141

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD K+L GVT LDVVRA TF A    ++  +V+VPV+GGHAG+TI
Sbjct  142  STVPIAAEVFKKAGTYDPKKLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTI  201

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   +    LT R Q+GGT
Sbjct  202  LPLLSQVKPPCSFTQEETEYLTNRIQNGGT  231



>ref|XP_008493331.1| PREDICTED: malate dehydrogenase, mitochondrial [Calypte anna]
Length=334

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  23   KVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIETRANVKGFMGPEQ  82

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+ A AK+CP A++ +ISNPVN
Sbjct  83   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTTACAKHCPKAMICIISNPVN  142

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PI +EVFKK G YD  R+FGVTTLD+VRA TF A    ++ A+V+VPVIGGHAG TI
Sbjct  143  STIPITSEVFKKQGVYDPNRIFGVTTLDIVRANTFVAELKGLDPAKVSVPVIGGHAGKTI  202

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+     D +  LT R Q+ GT
Sbjct  203  IPLISQCTPKVEFPQDQLEKLTARIQEAGT  232



>ref|XP_008787758.1| PREDICTED: malate dehydrogenase, glyoxysomal isoform X4 [Phoenix 
dactylifera]
Length=303

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  24   KVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  83

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  84   LESALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGIAKCCPNAIVNLISNPVN  143

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AGTYD KRL GVTTLDVVRA TF A    ++  EVNVPV+GGHAG+TI
Sbjct  144  STVPIAAEVFKQAGTYDPKRLLGVTTLDVVRANTFVAEVLGIDPREVNVPVVGGHAGVTI  203

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  204  LPLLSQVNPPCSFTTEEIRYLTDRIQNGGT  233



>ref|XP_004986217.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Setaria italica]
Length=361

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLSLLMK+NPLVS L L+D+  TPGV ADVSH++T + V GF G + 
Sbjct  45   KVAILGAAGGIGQPLSLLMKMNPLVSVLHLYDVVNTPGVTADVSHMDTSAVVRGFLGAQQ  104

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFN NAGIV++L   +A+ CP A+VN+ISNPVN
Sbjct  105  LDAALTGMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRTLCEGVARCCPDAIVNLISNPVN  164

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTY+ KRL GVTTLDVVRA TF A    V+  +V+VPV+GGHAG+TI
Sbjct  165  STVPIAAEVFKKAGTYNPKRLLGVTTLDVVRANTFVAEVLGVDPRDVSVPVVGGHAGVTI  224

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++   + I  LT R Q+GGT
Sbjct  225  LPLLSQVNPPSSFTQEEIKYLTNRIQNGGT  254



>emb|CDX89514.1| BnaC04g35330D [Brassica napus]
Length=353

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  43   KVAILGAAGGIGQPLAMLMKMNPLVSLLHLYDVANAPGVTADISHMDTSAIVRGFLGQSQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  103  LEEALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLSEAIAKCCPKAIVNIISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  163  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  223  LPLLSQVKPPCSFTQKEIEYLTDRIQNGGT  252



>gb|EYU44539.1| hypothetical protein MIMGU_mgv1a008933mg [Erythranthe guttata]
Length=358

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPLS+LMK+NPLVS L L+D+  TPGV +D+SH++T + V GF G   
Sbjct  48   KVAILGAAGGIGQPLSMLMKMNPLVSVLHLYDVVNTPGVTSDISHMDTGAVVRGFVGQTQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+LS  IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLSEGIAKCCPKAIVNVISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD +RL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKAGTYDPRRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   +    LT R Q+GGT
Sbjct  228  LPLLSQIKPACSFTQEETKYLTTRIQNGGT  257



>ref|XP_001770159.1| predicted protein [Physcomitrella patens]
 gb|EDQ64993.1| predicted protein [Physcomitrella patens]
Length=336

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            R VA+LG AGGIGQPLSLL+KLNPLVS L L+D+AGTPGVA D+SH+NT++ V G++GD 
Sbjct  24   RTVAVLGGAGGIGQPLSLLLKLNPLVSDLRLYDVAGTPGVACDLSHVNTQATVEGYAGDA  83

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
             L K L+G D++IIPAGVPRKPGMTRDDLFNINAGIVKSL   IAK+ P ALVN+ISNPV
Sbjct  84   ELEKTLKGCDLIIIPAGVPRKPGMTRDDLFNINAGIVKSLMIGIAKHAPKALVNIISNPV  143

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPIAAEV KKAG +D +RLFGVTTLDV+RA+TFYA +    V +V++PVIGGHAGIT
Sbjct  144  NSTVPIAAEVLKKAGVFDPRRLFGVTTLDVMRARTFYAARMKTPVKDVDLPVIGGHAGIT  203

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPL SQ  P+ N+    I  LT R QDGGT
Sbjct  204  ILPLLSQVKPKKNMTEKDIDALTKRIQDGGT  234



>ref|XP_009399077.1| PREDICTED: malate dehydrogenase, glyoxysomal [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+   PGV AD+SH+NT + V GF G   
Sbjct  46   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNAPGVTADISHMNTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   I K CP A+VN+ISNPVN
Sbjct  106  LEDALAGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIVKCCPKAIVNVISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVT LDVVRA TF A    ++  +VNVPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDSKRLLGVTMLDVVRANTFVAEVLGIDPRDVNVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVNPPCSFTPEEISYLTNRIQNGGT  255



>emb|CDY25631.1| BnaA04g13230D [Brassica napus]
Length=353

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A  PGV AD+SH++T + V GF G   
Sbjct  43   KVAILGAAGGIGQPLAMLMKMNPLVSLLHLYDVANAPGVTADISHMDTSAIVRGFLGQSQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++LS AIAK CP A+VN+ISNPVN
Sbjct  103  LEEALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLSEAIAKCCPKAIVNIISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A   +++  EV+VPV+GGHAG+TI
Sbjct  163  STVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVDVPVVGGHAGVTI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  223  LPLLSQVKPPCSFTQKEIEYLTDRIQNGGT  252



>emb|CBI29427.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV +D+SH++T + V GF G + 
Sbjct  46   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNTPGVTSDISHMDTGAVVRGFLGQQQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   IAK CP+A+VN+ISNPVN
Sbjct  106  LEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPNAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTFDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  226  LPLLSQVKPPCSFTPEEIDYLTARIQNGGT  255



>gb|KFP45870.1| hypothetical protein N324_07336, partial [Chlamydotis macqueenii]
Length=322

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  10   KVAVLGASGGIGQPLSLLLKNSPLVSRLSLYDIAHTPGVAADLSHIETRASVKGFLGPEQ  69

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L++A AK+CP A++ +ISNPVN
Sbjct  70   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTSACAKHCPEAMICIISNPVN  129

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PI +EVFKK G Y+ KR+FGVTTLD+VRA TF A    ++ A V+VPVIGGHAG TI
Sbjct  130  STIPITSEVFKKHGVYNPKRIFGVTTLDIVRANTFVAELKGLDPARVSVPVIGGHAGKTI  189

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+ +   D +  LT R Q+ GT
Sbjct  190  IPLISQCTPKVDFPQDQLEQLTGRIQEAGT  219



>ref|XP_005648549.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE24005.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=329

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 167/211 (79%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  181
            RKVA+LGAAGGIGQPL+LL+K+ PL++ LSL+DIA T GVAAD+SH NT  +V G +G E
Sbjct  18   RKVALLGAAGGIGQPLALLLKMQPLIAELSLYDIANTVGVAADLSHCNTTVKVTGHTGQE  77

Query  182  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV  361
            +L  ALEGAD+V+IPAGVPRKPGMTRDDLFNINAGIVK+L+ AIAK+ P A++ +ISNPV
Sbjct  78   SLAAALEGADLVVIPAGVPRKPGMTRDDLFNINAGIVKTLAEAIAKHSPTAVIAIISNPV  137

Query  362  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGIT  541
            NSTVPI AEV KKAG YD +++ GVTTLDVVRA TF A    + V +V+VPV+GGHAGIT
Sbjct  138  NSTVPITAEVLKKAGVYDPRKVLGVTTLDVVRANTFVAEAKGLAVQDVDVPVVGGHAGIT  197

Query  542  ILPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            ILPL SQ  P  +   D    LT R Q+ GT
Sbjct  198  ILPLLSQTNPAVSFTEDEAAKLTDRIQNAGT  228



>gb|KDO67932.1| hypothetical protein CISIN_1g016424mg [Citrus sinensis]
Length=279

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  43   KVAILGAAGGIGQPLAMLMKINPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A VN+ISNPVN
Sbjct  103  LENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNATVNLISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD K+L GVT LDVVRA TF A    ++  +V+VPV+GGHAG+TI
Sbjct  163  STVPIAAEVFKKAGTYDPKKLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   +    LT R Q+GGT
Sbjct  223  LPLLSQVKPPCSFTQEETEYLTNRIQNGGT  252



>gb|KCW59622.1| hypothetical protein EUGRSUZ_H02358 [Eucalyptus grandis]
Length=332

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  22   KVAILGAAGGIGQPLALLMKINPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  81

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  82   LEEALVGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGIAKSCPKAIVNLISNPVN  141

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  142  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  201

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  202  LPLLSQVKPPCSFTPPEIDYLTSRIQNGGT  231



>ref|XP_003539223.1| PREDICTED: malate dehydrogenase, glyoxysomal isoform X1 [Glycine 
max]
 gb|KHN13034.1| Malate dehydrogenase, glyoxysomal [Glycine soja]
Length=353

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV +D+SH++T + V GF G + 
Sbjct  43   KVAILGAAGGIGQPLAMLMKMNPLVSLLHLYDVVNTPGVTSDISHMDTGAVVRGFLGQQQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK CP A+VN+ISNPVN
Sbjct  103  LEDALIGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAIAKCCPKAIVNVISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AGTYD KRL GVT LDVVRA TF A    V+  +V+VPV+GGHAGITI
Sbjct  163  STVPIAAEVFKRAGTYDPKRLLGVTMLDVVRANTFVAEVLGVDPRDVDVPVVGGHAGITI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     I  LT R Q+GGT
Sbjct  223  LPLLSQIKPPCSFTPKEIEYLTGRIQNGGT  252



>pdb|1SMK|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
 pdb|1SMK|B Chain B, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
 pdb|1SMK|C Chain C, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
 pdb|1SMK|D Chain D, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
 pdb|1SMK|E Chain E, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
 pdb|1SMK|F Chain F, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
 pdb|1SMK|G Chain G, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
 pdb|1SMK|H Chain H, Mature And Translocatable Forms Of Glyoxysomal Malate 
Dehydrogenase Have Different Activities And Stabilities But 
Similar Crystal Structures
Length=326

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   PGV AD+SH++T + V GF G + 
Sbjct  10   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQQQ  69

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D++I+PAGVPRKPGMTRDDLF INAGIVK+L   IAK CP A+VN+ISNPVN
Sbjct  70   LEAALTGMDLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVN  129

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVT LDVVRA TF A    ++  +V+VPV+GGHAG+TI
Sbjct  130  STVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTI  189

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++   + I  LT R Q+GGT
Sbjct  190  LPLLSQVKPPSSFTQEEISYLTDRIQNGGT  219



>gb|KDP35916.1| hypothetical protein JCGZ_09888 [Jatropha curcas]
Length=356

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS L L+D+   PGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLALLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IA  CP A+VN+ISNPVN
Sbjct  106  LANALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIANCCPKAVVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++   + I  LT R QDGGT
Sbjct  226  LPLLSQVKPPSSFTPEEIEYLTKRIQDGGT  255



>ref|XP_005056570.1| PREDICTED: malate dehydrogenase, mitochondrial [Ficedula albicollis]
Length=341

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  29   KVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIETRASVKGFMGPEQ  88

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL++A AK+CP A++ +ISNPVN
Sbjct  89   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTSACAKHCPEAMICIISNPVN  148

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PIA+EVFKK G Y+  ++FGVTTLD+VRA TF A    ++ A V VPVIGGHAG TI
Sbjct  149  STIPIASEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVTVPVIGGHAGKTI  208

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+     D +  LT R Q+ GT
Sbjct  209  IPLISQCTPKVEFPQDQLEKLTARIQEAGT  238



>ref|XP_009558458.1| PREDICTED: malate dehydrogenase, mitochondrial [Cuculus canorus]
Length=339

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  26   KVAVLGASGGIGQPLSLLLKNSPLVSRLSLYDIAHTPGVAADLSHIETRANVKGFLGPEQ  85

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L++A AK+CP A++ +ISNPVN
Sbjct  86   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTSACAKHCPEAMICIISNPVN  145

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PI +EVFKK G Y+ KR+FGVTTLD+VRA TF A    ++ A V+VPVIGGHAG TI
Sbjct  146  STIPITSEVFKKHGVYNPKRIFGVTTLDIVRANTFVAELKGLDPARVSVPVIGGHAGKTI  205

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+ +   D +  LT R Q+ GT
Sbjct  206  IPLISQCTPKVDFPQDQLEKLTGRIQEAGT  235



>ref|XP_003228877.1| PREDICTED: malate dehydrogenase, mitochondrial [Anolis carolinensis]
Length=339

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPGVAAD+SHI TR+EV GF G E 
Sbjct  27   KVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPGVAADLSHIETRAEVKGFLGPEQ  86

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L ++L+G +VV+IPAGVPRKPGMTRDDLFN NA IV +L+ A AK+CP A++ +I+NPVN
Sbjct  87   LPESLKGCEVVVIPAGVPRKPGMTRDDLFNTNATIVANLATACAKHCPEAMICVIANPVN  146

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PI +EVFKK G Y+  R+FGVTTLD+VRA TF A    ++ A VNVPVIGGHAG TI
Sbjct  147  STIPITSEVFKKHGVYNPNRIFGVTTLDIVRANTFVAQLKGLDPARVNVPVIGGHAGKTI  206

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+     D +  LT R Q+ GT
Sbjct  207  IPLISQCTPKVEFPQDQLTALTGRIQEAGT  236



>ref|NP_001234005.1| glyoxisomal malate dehydrogenase [Solanum lycopersicum]
 ref|XP_006367081.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Solanum tuberosum]
 gb|AAU29200.1| glyoxisomal malate dehydrogenase [Solanum lycopersicum]
Length=357

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   PGV AD+SH++T + V GF G   
Sbjct  47   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQSE  106

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLF INAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  107  LEGALTGMDLVIIPAGIPRKPGMTRDDLFKINAGIVRTLCEGIAKCCPNAIVNLISNPVN  166

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD K+L GVT+LDVVRA TF A    ++  EV VPV+GGHAG+TI
Sbjct  167  STVPIAAEVFKKAGTYDPKKLLGVTSLDVVRANTFVAEVLGLDPREVEVPVVGGHAGVTI  226

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +  H+    LT R QDGGT
Sbjct  227  LPLLSQVKPPCSFTHEETEYLTKRIQDGGT  256



>ref|XP_973533.1| PREDICTED: malate dehydrogenase, mitochondrial [Tribolium castaneum]
 gb|EFA04972.1| hypothetical protein TcasGA2_TC015050 [Tribolium castaneum]
Length=336

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+ GA+GGIGQPLSLL+K +PLV+ LSL+DI  TPGVAAD+SHI T ++V GF+G EN
Sbjct  25   KVAVAGASGGIGQPLSLLLKQSPLVTELSLYDIVHTPGVAADLSHIETPAKVKGFNGPEN  84

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L KA EGA+V+IIPAGVPRKPGMTRDDLFN NA IV++L+ A A+  P AL+ +ISNPVN
Sbjct  85   LKKAFEGAEVIIIPAGVPRKPGMTRDDLFNTNASIVQTLAEAAAESAPKALIGIISNPVN  144

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEV KKAG YD KRLFGV+TLDVVRA TF A    +N  EV VPVIGGH+G+TI
Sbjct  145  STVPIAAEVLKKAGKYDPKRLFGVSTLDVVRANTFVAELKGLNPLEVKVPVIGGHSGVTI  204

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQATP      D +  LT R Q+ GT
Sbjct  205  IPLISQATPSVTFPPDQLKALTERIQEAGT  234



>ref|XP_008787755.1| PREDICTED: malate dehydrogenase, glyoxysomal isoform X1 [Phoenix 
dactylifera]
 ref|XP_008787756.1| PREDICTED: malate dehydrogenase, glyoxysomal isoform X2 [Phoenix 
dactylifera]
 ref|XP_008787757.1| PREDICTED: malate dehydrogenase, glyoxysomal isoform X3 [Phoenix 
dactylifera]
Length=332

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  22   KVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQPQ  81

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   IAK CP+A+VN+ISNPVN
Sbjct  82   LESALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGIAKCCPNAIVNLISNPVN  141

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AGTYD KRL GVTTLDVVRA TF A    ++  EVNVPV+GGHAG+TI
Sbjct  142  STVPIAAEVFKQAGTYDPKRLLGVTTLDVVRANTFVAEVLGIDPREVNVPVVGGHAGVTI  201

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   + I  LT R Q+GGT
Sbjct  202  LPLLSQVNPPCSFTTEEIRYLTDRIQNGGT  231



>gb|KFW68513.1| hypothetical protein AS28_06434, partial [Pygoscelis adeliae]
Length=257

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR+ V GF G E 
Sbjct  5    KVAVLGASGGIGQPLSLLLKNSPLVSRLSLYDIAHTPGVAADLSHIETRANVKGFLGPEQ  64

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L++A AK+CP A++ +ISNPVN
Sbjct  65   LPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTSACAKHCPEAMICIISNPVN  124

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            ST+PI +EVFKK G Y+  R+FGVTTLD+VRA TF A    ++ A V+VPVIGGHAG TI
Sbjct  125  STIPITSEVFKKHGVYNPNRIFGVTTLDIVRANTFVAELKGLDPARVSVPVIGGHAGKTI  184

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            +PL SQ TP+ +   D +  LT R Q+ GT
Sbjct  185  IPLISQCTPKVDFPQDQLEKLTGRIQEAGT  214



>gb|KJB16076.1| hypothetical protein B456_002G211700 [Gossypium raimondii]
Length=337

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  +PGV AD+SH++T + V GF G   
Sbjct  43   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNSPGVTADLSHMDTGAVVRGFLGQPQ  102

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L   +AK CP+A+VN+ISNPVN
Sbjct  103  LESALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGVAKCCPNAIVNLISNPVN  162

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF A    ++  EVNVPV+GGH+G+TI
Sbjct  163  STVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPREVNVPVVGGHSGVTI  222

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++   +    LT R Q+GGT
Sbjct  223  LPLLSQVKPPSSFTPEETEYLTNRIQNGGT  252



>ref|XP_008342632.1| PREDICTED: malate dehydrogenase, glyoxysomal [Malus domestica]
Length=295

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL+LLMK+NPLVS + L+D+  TPGV +D+SH++T + V GF G + 
Sbjct  50   KVAILGAAGGIGQPLALLMKMNPLVSVIHLYDVVNTPGVTSDISHMDTGAVVRGFLGQQQ  109

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L +AL G ++VIIPAGVPRKPGMTRDDLFNINAGIVK++S AIAK CP+A+VN+ISNPVN
Sbjct  110  LEEALTGMELVIIPAGVPRKPGMTRDDLFNINAGIVKTISEAIAKCCPYAIVNVISNPVN  169

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGT+D K+L GVT LDVVRA TF A    ++  +++VPV+GGHAG+TI
Sbjct  170  STVPIAAEVFKKAGTFDPKKLLGVTMLDVVRANTFVAEXLGLDPRDIDVPVVGGHAGVTI  229

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +     +  LT R Q+GGT
Sbjct  230  LPLLSQVKPPCSFTPKEVDYLTDRIQNGGT  259



>ref|XP_004511797.1| PREDICTED: malate dehydrogenase, glyoxysomal-like isoform X1 
[Cicer arietinum]
Length=354

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILG++GGIGQPLS+LMK+NPLVS L L+D+  TPGV +D+SH++T + + GF G + 
Sbjct  44   KVAILGSSGGIGQPLSMLMKMNPLVSVLHLYDVVNTPGVTSDISHMDTSAVIRGFLGQKQ  103

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAG+PRKPGMTRDDLFNINAGIVK+L  AIAK CP A+VN+ISNPVN
Sbjct  104  LEDALTGMDLVIIPAGIPRKPGMTRDDLFNINAGIVKTLCEAIAKSCPKAIVNLISNPVN  163

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFK+AGTYD K+L GVT LDVVRA TF A    ++  +V+VPV+GGHAGITI
Sbjct  164  STVPIAAEVFKRAGTYDPKKLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGITI  223

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P ++     I  LT R Q+GGT
Sbjct  224  LPLLSQVKPPSSFTPKEIEYLTDRIQNGGT  253



>ref|XP_011099432.1| PREDICTED: malate dehydrogenase, glyoxysomal [Sesamum indicum]
Length=358

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV AD+SH++T + V GF G   
Sbjct  48   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNTPGVTADISHMDTGAVVRGFLGQNQ  107

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  108  LEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPKAIVNLISNPVN  167

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD +RL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  168  STVPIAAEVFKKAGTYDPRRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  227

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   +    LT R Q+GGT
Sbjct  228  LPLLSQVKPACSFTQEETEYLTSRIQNGGT  257



>ref|XP_002522037.1| malate dehydrogenase, putative [Ricinus communis]
 gb|EEF40237.1| malate dehydrogenase, putative [Ricinus communis]
Length=356

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = +2

Query  5    KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  184
            KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   PGV AD+SH++T + V GF G   
Sbjct  46   KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQPQ  105

Query  185  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN  364
            L  AL G D+V+IPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP A+VN+ISNPVN
Sbjct  106  LENALTGMDLVVIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPRAIVNLISNPVN  165

Query  365  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYagkanvnvaevnvpvIGGHAGITI  544
            STVPIAAEVFKKAGTYD KRL GVT LDVVRA TF A    ++  EV+VPV+GGHAG+TI
Sbjct  166  STVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTI  225

Query  545  LPLFSQATPQANLAHDVIVGLTXRTQDGGT  634
            LPL SQ  P  +   +    LT R QDGGT
Sbjct  226  LPLLSQVKPPCSFTSEETEYLTKRIQDGGT  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500