BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN013E18

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004237382.1|  PREDICTED: uncharacterized protein LOC101256581    180   2e-54   Solanum lycopersicum
ref|XP_002278674.1|  PREDICTED: uncharacterized protein LOC100253...    180   2e-54   Vitis vinifera
ref|XP_003631886.1|  PREDICTED: uncharacterized protein LOC100253...    180   3e-54   Vitis vinifera
gb|EYU39434.1|  hypothetical protein MIMGU_mgv1a016854mg                178   9e-54   Erythranthe guttata [common monkey flower]
ref|XP_008805737.1|  PREDICTED: uncharacterized protein LOC103718608    178   1e-53   Phoenix dactylifera
gb|EPS57511.1|  hypothetical protein M569_17305                         177   4e-53   Genlisea aurea
ref|XP_011084657.1|  PREDICTED: uncharacterized protein LOC105166859    175   1e-52   
ref|NP_001274991.1|  uncharacterized protein LOC102577744               175   2e-52   Solanum tuberosum [potatoes]
ref|XP_009395452.1|  PREDICTED: uncharacterized protein LOC103980708    175   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395329.1|  PREDICTED: uncharacterized protein LOC103980607    174   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF95862.1|  hypothetical protein                                   174   7e-52   Vitis hybrid cultivar
emb|CDP04206.1|  unnamed protein product                                174   7e-52   Coffea canephora [robusta coffee]
ref|XP_006878610.1|  hypothetical protein AMTR_s00011p00257240          173   9e-52   
ref|XP_010673939.1|  PREDICTED: uncharacterized protein LOC104890230    173   1e-51   
ref|XP_007139726.1|  hypothetical protein PHAVU_008G054200g             172   2e-51   Phaseolus vulgaris [French bean]
ref|XP_006428585.1|  hypothetical protein CICLE_v10013411mg             172   3e-51   Citrus clementina [clementine]
ref|XP_003552444.1|  PREDICTED: uncharacterized protein LOC100788257    171   4e-51   Glycine max [soybeans]
gb|KDO47614.1|  hypothetical protein CISIN_1g031832mg                   171   6e-51   Citrus sinensis [apfelsine]
ref|XP_009605183.1|  PREDICTED: uncharacterized protein LOC104099781    171   7e-51   Nicotiana tomentosiformis
ref|XP_009794072.1|  PREDICTED: uncharacterized protein LOC104240871    171   7e-51   Nicotiana sylvestris
gb|KDO47615.1|  hypothetical protein CISIN_1g031832mg                   172   9e-51   Citrus sinensis [apfelsine]
ref|XP_010943386.1|  PREDICTED: uncharacterized protein LOC105061124    171   9e-51   Elaeis guineensis
ref|XP_009392762.1|  PREDICTED: uncharacterized protein LOC103978636    169   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54210.1|  hypothetical protein                                    169   3e-50   Phaseolus vulgaris [French bean]
ref|XP_003563539.1|  PREDICTED: uncharacterized protein LOC100828468    169   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_003534513.1|  PREDICTED: uncharacterized protein LOC100784149    168   1e-49   Glycine max [soybeans]
gb|KJB78441.1|  hypothetical protein B456_013G179600                    167   1e-49   Gossypium raimondii
ref|XP_008443699.1|  PREDICTED: uncharacterized protein LOC103487230    167   2e-49   Cucumis melo [Oriental melon]
ref|XP_010275117.1|  PREDICTED: uncharacterized protein LOC104610274    166   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002325468.1|  zinc finger family protein                         166   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010558583.1|  PREDICTED: uncharacterized protein LOC104827174    166   9e-49   Tarenaya hassleriana [spider flower]
gb|AGG23548.1|  C2H2-type zinc finger protein                           166   1e-48   Malus hupehensis
ref|XP_011006975.1|  PREDICTED: uncharacterized protein LOC105112815    166   1e-48   Populus euphratica
ref|XP_006371268.1|  hypothetical protein POPTR_0019s08070g             166   1e-48   Populus trichocarpa [western balsam poplar]
gb|KDP26866.1|  hypothetical protein JCGZ_18024                         165   1e-48   Jatropha curcas
gb|KJB74766.1|  hypothetical protein B456_012G028300                    165   2e-48   Gossypium raimondii
ref|XP_010251502.1|  PREDICTED: uncharacterized protein LOC104593396    165   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_008218445.1|  PREDICTED: uncharacterized protein LOC103318791    165   2e-48   Prunus mume [ume]
ref|XP_010525089.1|  PREDICTED: uncharacterized protein LOC104802953    165   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_008388806.1|  PREDICTED: uncharacterized protein LOC103451147    165   2e-48   Malus domestica [apple tree]
ref|XP_004139104.1|  PREDICTED: uncharacterized protein LOC101210666    164   4e-48   
ref|XP_008370822.1|  PREDICTED: uncharacterized protein LOC103434266    164   4e-48   Malus domestica [apple tree]
ref|XP_004492837.1|  PREDICTED: uncharacterized protein LOC101508199    164   5e-48   Cicer arietinum [garbanzo]
ref|XP_011014934.1|  PREDICTED: uncharacterized protein LOC105118647    164   5e-48   Populus euphratica
ref|XP_004302161.1|  PREDICTED: uncharacterized protein LOC101313424    163   8e-48   Fragaria vesca subsp. vesca
gb|EAZ02314.1|  hypothetical protein OsI_24415                          163   8e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_007207358.1|  hypothetical protein PRUPE_ppa013572mg             163   1e-47   Prunus persica
ref|NP_001058536.1|  Os06g0708600                                       163   1e-47   
ref|XP_004966390.1|  PREDICTED: uncharacterized protein LOC101767594    163   1e-47   Setaria italica
gb|KJB26830.1|  hypothetical protein B456_004G261900                    164   2e-47   Gossypium raimondii
ref|NP_001131254.1|  uncharacterized protein LOC100192567               162   2e-47   Zea mays [maize]
gb|ABU95041.1|  C2H2 Zn finger protein                                  162   2e-47   Triticum aestivum [Canadian hard winter wheat]
gb|EEE66335.1|  hypothetical protein OsJ_22615                          161   6e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010070152.1|  PREDICTED: uncharacterized protein LOC104456939    161   6e-47   Eucalyptus grandis [rose gum]
ref|XP_002514854.1|  transcription factor, putative                     160   7e-47   Ricinus communis
emb|CDY28708.1|  BnaCnng05940D                                          160   7e-47   Brassica napus [oilseed rape]
ref|XP_003624171.1|  hypothetical protein MTR_7g079990                  162   2e-46   
dbj|BAJ34455.1|  unnamed protein product                                159   2e-46   Eutrema halophilum
gb|ACJ86042.1|  unknown                                                 159   4e-46   Medicago truncatula
dbj|BAK04318.1|  predicted protein                                      159   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK42214.1|  unknown                                                 159   5e-46   Medicago truncatula
dbj|BAJ86969.1|  predicted protein                                      159   5e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006300194.1|  hypothetical protein CARUB_v10016430mg             157   2e-45   Capsella rubella
ref|XP_007029378.1|  Zinc finger (C2H2 type) family protein             157   3e-45   Theobroma cacao [chocolate]
ref|XP_001772389.1|  predicted protein                                  157   3e-45   
ref|XP_001767162.1|  predicted protein                                  156   4e-45   
ref|XP_009147322.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    156   5e-45   Brassica rapa
ref|XP_002437568.1|  hypothetical protein SORBIDRAFT_10g029490          156   6e-45   Sorghum bicolor [broomcorn]
ref|XP_002882251.1|  zinc finger family protein                         154   3e-44   
gb|ACG38013.1|  hypothetical protein                                    154   3e-44   Zea mays [maize]
ref|XP_002963136.1|  hypothetical protein SELMODRAFT_165749             154   4e-44   
ref|XP_002980184.1|  hypothetical protein SELMODRAFT_112530             154   4e-44   Selaginella moellendorffii
gb|ABK21472.1|  unknown                                                 153   5e-44   Picea sitchensis
ref|XP_002319276.2|  zinc finger family protein                         152   1e-43   Populus trichocarpa [western balsam poplar]
ref|NP_001142577.1|  uncharacterized protein LOC100274838               153   1e-43   
gb|ACG41191.1|  hypothetical protein                                    152   2e-43   Zea mays [maize]
ref|XP_001776841.1|  predicted protein                                  151   3e-43   
ref|XP_009126116.1|  PREDICTED: uncharacterized protein LOC103851...    151   3e-43   Brassica rapa
ref|NP_566182.1|  uncharacterized protein                               151   4e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25865.1|  hypothetical protein AALP_AA8G172200                    151   5e-43   Arabis alpina [alpine rockcress]
ref|XP_009131543.1|  PREDICTED: uncharacterized protein LOC103856199    150   7e-43   Brassica rapa
emb|CDY55576.1|  BnaC09g41470D                                          150   7e-43   Brassica napus [oilseed rape]
emb|CDX85506.1|  BnaA02g03070D                                          150   8e-43   
ref|XP_006400185.1|  hypothetical protein EUTSA_v10015095mg             150   1e-42   Eutrema salsugineum [saltwater cress]
emb|CDX70696.1|  BnaC03g07800D                                          150   1e-42   
ref|XP_009121489.1|  PREDICTED: uncharacterized protein LOC103846331    150   1e-42   Brassica rapa
ref|XP_010420340.1|  PREDICTED: uncharacterized protein LOC104705...    147   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010485607.1|  PREDICTED: uncharacterized protein LOC104763897    147   1e-41   Camelina sativa [gold-of-pleasure]
ref|NP_197151.1|  C2H2 type zinc finger protein                         146   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111074.1|  hypothetical protein L484_015129                   146   4e-41   Morus notabilis
ref|XP_010501491.1|  PREDICTED: uncharacterized protein LOC104778713    146   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010463704.1|  PREDICTED: uncharacterized protein LOC104744359    146   4e-41   Camelina sativa [gold-of-pleasure]
gb|AAX92680.1|  C2H2 type zinc finger family protein                    139   1e-38   Picea abies
ref|NP_001144301.1|  uncharacterized protein LOC100277189               122   6e-32   
emb|CDY51535.1|  BnaA05g33350D                                          118   1e-30   Brassica napus [oilseed rape]
ref|XP_002501198.1|  predicted protein                                  108   2e-26   Micromonas commoda
ref|XP_001696835.1|  hypothetical protein CHLREDRAFT_138304             106   7e-26   Chlamydomonas reinhardtii
ref|XP_002956123.1|  hypothetical protein VOLCADRAFT_66623              106   7e-26   Volvox carteri f. nagariensis
ref|XP_007508426.1|  predicted protein                                  107   1e-25   Bathycoccus prasinos
ref|XP_003062503.1|  predicted protein                                99.8    7e-23   Micromonas pusilla CCMP1545
ref|XP_003080110.1|  unnamed protein product                          95.1    4e-21   Ostreococcus tauri
ref|XP_003862617.1|  hypothetical protein, conserved                  92.0    3e-20   Leishmania donovani
ref|XP_001466714.1|  conserved hypothetical protein                   92.0    3e-20   Leishmania infantum JPCM5
ref|XP_003722269.1|  conserved hypothetical protein                   90.9    1e-19   Leishmania major strain Friedlin
ref|XP_003872371.1|  conserved hypothetical protein                   90.5    1e-19   Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_001566528.1|  conserved hypothetical protein                   90.1    2e-19   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_010700793.1|  hypothetical protein LPMP_291880                 89.7    2e-19   Leishmania panamensis
ref|XP_005834143.1|  hypothetical protein GUITHDRAFT_45817            89.4    2e-19   Guillardia theta CCMP2712
ref|XP_001418807.1|  predicted protein                                89.4    5e-19   Ostreococcus lucimarinus CCE9901
gb|EPY28967.1|  transcription factor                                  86.3    5e-18   Angomonas deanei
emb|CCW59692.1|  unnamed protein product                              85.9    7e-18   Phytomonas sp. isolate EM1
gb|EPY31587.1|  transcription factor                                  85.5    8e-18   Angomonas deanei
gb|EPY31931.1|  transcription factor                                  85.1    1e-17   Strigomonas culicis
ref|XP_005845144.1|  hypothetical protein CHLNCDRAFT_137279           83.6    4e-17   Chlorella variabilis
emb|CCW67329.1|  unnamed protein product                              81.3    4e-16   Phytomonas sp. isolate Hart1
emb|CAC33094.1|  hypothetical protein                                 76.6    2e-14   Rhodomonas sp. CS24
ref|XP_010099458.1|  UDP-glycosyltransferase 87A2                     73.9    9e-13   Morus notabilis
ref|XP_010091528.1|  hypothetical protein L484_015955                 67.0    2e-11   
ref|XP_005835691.1|  hypothetical protein GUITHDRAFT_93533            65.5    9e-11   Guillardia theta CCMP2712
ref|XP_010113045.1|  hypothetical protein L484_022771                 67.8    1e-10   
ref|XP_008915126.1|  hypothetical protein PPTG_18703                  58.2    5e-08   Phytophthora parasitica INRA-310
emb|CCA27042.1|  conserved hypothetical protein                       53.9    2e-06   Albugo laibachii Nc14
gb|EMT19799.1|  hypothetical protein F775_42434                       53.9    1e-05   
gb|ABN05675.1|  hypothetical protein MtrDRAFT_AC147963g31v2           50.4    2e-05   Medicago truncatula
ref|XP_008871741.1|  hypothetical protein H310_07979                  51.2    3e-05   Aphanomyces invadans
ref|XP_009537352.1|  hypothetical protein PHYSODRAFT_527958           50.1    4e-05   Phytophthora sojae
ref|XP_002904016.1|  conserved hypothetical protein                   49.3    1e-04   Phytophthora infestans T30-4
ref|XP_003591173.1|  hypothetical protein MTR_1g083560                47.4    2e-04   
ref|XP_006408383.1|  hypothetical protein EUTSA_v10020933mg           49.7    5e-04   
emb|CCI41130.1|  unnamed protein product                              47.0    6e-04   Albugo candida



>ref|XP_004237382.1| PREDICTED: uncharacterized protein LOC101256581 [Solanum lycopersicum]
Length=105

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAK+DAATTNRGGGKAGLADRSG +KGGHAKLECPLCKVTAPDIK
Sbjct  1    MTGKAKPKKHTAKELAAKIDAATTNRGGGKAGLADRSGIEKGGHAKLECPLCKVTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SM+IHHDA+HPK+ FDETKLNNLHAT    S   SNKPKPGIRG
Sbjct  61   SMKIHHDAKHPKVAFDETKLNNLHATVVAES---SNKPKPGIRG  101



>ref|XP_002278674.1| PREDICTED: uncharacterized protein LOC100253066 isoform X2 [Vitis 
vinifera]
 emb|CAN67065.1| hypothetical protein VITISV_036295 [Vitis vinifera]
 emb|CBI17640.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG ADRSG DKGGHAKLECPLCK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGQADRSGLDKGGHAKLECPLCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PFDE KL+NLHA++ P    ES+KP+PG+RG
Sbjct  61   SMQIHHEARHPKVPFDEAKLSNLHASSVP----ESSKPRPGVRG  100



>ref|XP_003631886.1| PREDICTED: uncharacterized protein LOC100253066 isoform X1 [Vitis 
vinifera]
Length=118

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG ADRSG DKGGHAKLECPLCK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGQADRSGLDKGGHAKLECPLCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PFDE KL+NLHA++ P    ES+KP+PG+RG
Sbjct  61   SMQIHHEARHPKVPFDEAKLSNLHASSVP----ESSKPRPGVRG  100



>gb|EYU39434.1| hypothetical protein MIMGU_mgv1a016854mg [Erythranthe guttata]
Length=104

 Score =   178 bits (452),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAK+DAATTNRGGGKAGLADR+G++KGGHAKLECPLCKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKELAAKLDAATTNRGGGKAGLADRTGKEKGGHAKLECPLCKVTAPDMK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPKIPFD++KLNNLH+T       ES+KPKPGIRG
Sbjct  61   SMQIHHEARHPKIPFDDSKLNNLHSTVE----AESSKPKPGIRG  100



>ref|XP_008805737.1| PREDICTED: uncharacterized protein LOC103718608 [Phoenix dactylifera]
Length=104

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG+ADR+G +KGGHAKLECP CK+TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGMADRTGLEKGGHAKLECPYCKITAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PFDE+KLNNLH+T     G ES+KP+PG+RG
Sbjct  61   SMQIHHEARHPKLPFDESKLNNLHST----HGAESSKPRPGVRG  100



>gb|EPS57511.1| hypothetical protein M569_17305 [Genlisea aurea]
Length=104

 Score =   177 bits (448),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIA+KVDAATTNRGGGKAGLADRSG +KGGHAKLECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIASKVDAATTNRGGGKAGLADRSGIEKGGHAKLECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIPFDE+KL++LHAT  P    E++KPKPG+RG
Sbjct  61   SMQIHHDARHPKIPFDESKLSDLHATCVP----ETSKPKPGVRG  100



>ref|XP_011084657.1| PREDICTED: uncharacterized protein LOC105166859 [Sesamum indicum]
Length=104

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSG +KGGHAKLECP CKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGVEKGGHAKLECPHCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKI FDE+KLNNLHA       G+S+KPKPG+RG
Sbjct  61   SMQIHHDARHPKILFDESKLNNLHAGFV----GDSSKPKPGVRG  100



>ref|NP_001274991.1| uncharacterized protein LOC102577744 [Solanum tuberosum]
 gb|ABA46781.1| unknown [Solanum tuberosum]
 gb|ABB29930.1| unknown [Solanum tuberosum]
Length=105

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 93/104 (89%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAKVDAATTNRGGGKAGLADRSG +KGGHAKLECPLCKVTAPDIK
Sbjct  1    MTGKAKPKKHTAKELAAKVDAATTNRGGGKAGLADRSGIEKGGHAKLECPLCKVTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SM+IHHDA+HPK+ FDE KLNNLH+T    S   S KPKPGIRG
Sbjct  61   SMKIHHDAKHPKLAFDEAKLNNLHSTGVAES---STKPKPGIRG  101



>ref|XP_009395452.1| PREDICTED: uncharacterized protein LOC103980708 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score =   175 bits (443),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAK IA K+DAATTNRGGGKAG +DRSGQDKGGHAKLECPLCK+TAPDIK
Sbjct  1    MTGKAKPKKHTAKAIAGKIDAATTNRGGGKAGQSDRSGQDKGGHAKLECPLCKITAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHD+RHPK+PFDE+KL NLH T  P    E++KP+PG+RG
Sbjct  61   SMQIHHDSRHPKVPFDESKLVNLHTTCVP----ETSKPRPGVRG  100



>ref|XP_009395329.1| PREDICTED: uncharacterized protein LOC103980607 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIA+KVDAATTNRGGGKAGLADRSG DKGGHAKLECPLCK TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIASKVDAATTNRGGGKAGLADRSGHDKGGHAKLECPLCKTTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPK+PFDE+KL NLH +  P    E++K +PG+RG
Sbjct  61   SMQIHHDARHPKVPFDESKLINLHVSCAP----ETSKGRPGVRG  100



>dbj|BAF95862.1| hypothetical protein [Vitis hybrid cultivar]
Length=110

 Score =   174 bits (440),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 4/101 (4%)
 Frame = +3

Query  48   KAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIKSMQ  227
            KAKPKKHTAKEIAAKVDAATTNRGGGKAG ADRSG DKGGHAKLECPLCK+TAPD+KSMQ
Sbjct  2    KAKPKKHTAKEIAAKVDAATTNRGGGKAGQADRSGLDKGGHAKLECPLCKITAPDLKSMQ  61

Query  228  IHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            IHH+ARHPK+PFDE KL+NLHA++ P    ES+KP+PG+RG
Sbjct  62   IHHEARHPKVPFDEAKLSNLHASSVP----ESSKPRPGVRG  98



>emb|CDP04206.1| unnamed protein product [Coffea canephora]
Length=110

 Score =   174 bits (440),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADRSG +KGGHAKLECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRSGVEKGGHAKLECPHCKTTAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATAT--PSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIPFDE+KLNNLHA+ +   ++  E NKPKPG+RG
Sbjct  61   SMQIHHDARHPKIPFDESKLNNLHASNSGAAAAAAEPNKPKPGVRG  106



>ref|XP_006878610.1| hypothetical protein AMTR_s00011p00257240 [Amborella trichopoda]
 gb|ERM94755.1| hypothetical protein AMTR_s00011p00257240 [Amborella trichopoda]
Length=106

 Score =   173 bits (439),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 92/104 (88%), Gaps = 2/104 (2%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG ADRSGQ+KGGHAK ECPLCK TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGQADRSGQEKGGHAKYECPLCKTTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPFDE+KL N HA A   S  E +KPKPGIRG
Sbjct  61   SMQIHHDAKHPKIPFDESKLVNRHAHAGQVS--ECSKPKPGIRG  102



>ref|XP_010673939.1| PREDICTED: uncharacterized protein LOC104890230 [Beta vulgaris 
subsp. vulgaris]
Length=104

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAK DAATTNRGGGKAG+ADR+G  KGGHAK+ECPLCKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKELAAKADAATTNRGGGKAGVADRTGAVKGGHAKMECPLCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPFDE K+NNLHA+ T     + NKPKPGIRG
Sbjct  61   SMQIHHDAKHPKIPFDENKINNLHASGT----SDPNKPKPGIRG  100



>ref|XP_007139726.1| hypothetical protein PHAVU_008G054200g [Phaseolus vulgaris]
 gb|ESW11720.1| hypothetical protein PHAVU_008G054200g [Phaseolus vulgaris]
Length=108

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADRSG +KGGHAK ECP CKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRSGVEKGGHAKYECPHCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPKIPF+E K+ NLHAT T ++  ES+K +PGIRG
Sbjct  61   SMQIHHEARHPKIPFEEEKVANLHATTTSAAAPESSKGRPGIRG  104



>ref|XP_006428585.1| hypothetical protein CICLE_v10013411mg [Citrus clementina]
 ref|XP_006480424.1| PREDICTED: uncharacterized protein LOC102622160 [Citrus sinensis]
 gb|ESR41825.1| hypothetical protein CICLE_v10013411mg [Citrus clementina]
Length=105

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIA KVDAATTNRGGGKAG+ADR+G++KGGHAK ECPLCKVTAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAMKVDAATTNRGGGKAGMADRTGREKGGHAKYECPLCKVTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPK+PFDE  L NLHA    +   ES+KPKPGIRG
Sbjct  61   SMQIHHDARHPKLPFDEASLVNLHAARVDA---ESSKPKPGIRG  101



>ref|XP_003552444.1| PREDICTED: uncharacterized protein LOC100788257 [Glycine max]
Length=104

 Score =   171 bits (434),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGL DRSG +KGGHAK ECP CKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLKDRSGLEKGGHAKYECPHCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIPF+E K+ NLHAT  P    ES+KP+PG+RG
Sbjct  61   SMQIHHDARHPKIPFEEDKVVNLHATHVP----ESSKPRPGVRG  100



>gb|KDO47614.1| hypothetical protein CISIN_1g031832mg [Citrus sinensis]
Length=110

 Score =   171 bits (434),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIA KVDAATTNRGGGKAG+ADR+G++KGGHAK ECPLCKVTAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAMKVDAATTNRGGGKAGMADRTGREKGGHAKYECPLCKVTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPK+PFDE  L NLHA    +   ES+KPKPGIRG
Sbjct  61   SMQIHHDARHPKLPFDEASLVNLHAARVDA---ESSKPKPGIRG  101



>ref|XP_009605183.1| PREDICTED: uncharacterized protein LOC104099781 [Nicotiana tomentosiformis]
Length=106

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 93/106 (88%), Gaps = 6/106 (6%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAK DAA TNRGGGKAGLADRSG +KGGHAKLECPLCKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKELAAKADAALTNRGGGKAGLADRSGIEKGGHAKLECPLCKVTAPDMK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHAT--ATPSSGGESNKPKPGIRG  350
            SM+IHHDARHPKIPFDE KL NLHAT  A PS    + KPKPGIRG
Sbjct  61   SMKIHHDARHPKIPFDEAKLTNLHATVVAEPS----NTKPKPGIRG  102



>ref|XP_009794072.1| PREDICTED: uncharacterized protein LOC104240871 [Nicotiana sylvestris]
Length=106

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 93/106 (88%), Gaps = 6/106 (6%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAK DAA TNRGGGKAGLADR+G +KGGHAKLECPLCKVTAPDIK
Sbjct  1    MTGKAKPKKHTAKELAAKADAALTNRGGGKAGLADRTGIEKGGHAKLECPLCKVTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHAT--ATPSSGGESNKPKPGIRG  350
            SM+IHHDARHPKIPFDE KL NLHAT  A PS    + KPKPGIRG
Sbjct  61   SMKIHHDARHPKIPFDEAKLTNLHATVVAEPS----NTKPKPGIRG  102



>gb|KDO47615.1| hypothetical protein CISIN_1g031832mg [Citrus sinensis]
Length=152

 Score =   172 bits (437),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 91/103 (88%), Gaps = 3/103 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIA KVDAATTNRGGGKAG+ADR+G++KGGHAK ECPLCKVTAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAMKVDAATTNRGGGKAGMADRTGREKGGHAKYECPLCKVTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIR  347
            SMQIHHDARHPK+PFDE  L NLHA    +   ES+KPKPGIR
Sbjct  61   SMQIHHDARHPKLPFDEASLVNLHAARVDA---ESSKPKPGIR  100



>ref|XP_010943386.1| PREDICTED: uncharacterized protein LOC105061124 [Elaeis guineensis]
Length=104

 Score =   171 bits (432),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG+ADR+GQ+KGGHAKLECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGMADRTGQEKGGHAKLECPFCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK PFDE+KL NLHA        E++KP+PG+RG
Sbjct  61   SMQIHHEARHPKQPFDESKLINLHAGHV----AETSKPRPGVRG  100



>ref|XP_009392762.1| PREDICTED: uncharacterized protein LOC103978636 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGG+AG+ADRSGQ+KGGHAKLECP CK T PD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGRAGVADRSGQEKGGHAKLECPHCKTTVPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIPFDE+KL NLH +  P    E++K +PG+RG
Sbjct  61   SMQIHHDARHPKIPFDESKLVNLHTSHAP----ETSKARPGVRG  100



>gb|AGV54210.1| hypothetical protein [Phaseolus vulgaris]
Length=107

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADRSG +KGGHAK ECP CKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRSGVEKGGHAKYECPHCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPKIPF+E K+ NLHAT T S+  ES+K +PGIRG
Sbjct  61   SMQIHHEARHPKIPFEEEKVANLHATTT-SAAPESSKGRPGIRG  103



>ref|XP_003563539.1| PREDICTED: uncharacterized protein LOC100828468 [Brachypodium 
distachyon]
Length=115

 Score =   169 bits (428),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 95/107 (89%), Gaps = 5/107 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG  DR GQ+KGGHAKLECPLCKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQKDRLGQEKGGHAKLECPLCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGE---SNKPKPGIRG  350
            SMQIHH+ARHPK+PFD  K+NNLH  ++P++  E   S+KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFDPEKINNLH--SSPAAAPEVASSSKPKPGVRG  105



>ref|XP_003534513.1| PREDICTED: uncharacterized protein LOC100784149 [Glycine max]
 gb|KHN29270.1| hypothetical protein glysoja_004994 [Glycine soja]
Length=105

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG+ DR+G +KGGHAK ECP CKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGMKDRTGLEKGGHAKYECPHCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIPF+E K+ NLHAT   +S  ES+KP+PG+RG
Sbjct  61   SMQIHHDARHPKIPFEEDKVVNLHAT---TSVPESSKPRPGVRG  101



>gb|KJB78441.1| hypothetical protein B456_013G179600 [Gossypium raimondii]
Length=104

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAGLADRSG +KGGHAK ECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGLADRSGVEKGGHAKFECPHCKTTAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHHDA+HPK+PF+E+KL NLH+T     G +S+KP+PG+RG
Sbjct  61   TMQIHHDAKHPKLPFEESKLVNLHST----HGADSSKPRPGVRG  100



>ref|XP_008443699.1| PREDICTED: uncharacterized protein LOC103487230 [Cucumis melo]
 ref|XP_008443700.1| PREDICTED: uncharacterized protein LOC103487230 [Cucumis melo]
Length=105

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAGLADRSG +KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGLADRSGHEKGGHAKFECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+++HPKIPF+E K+ NLHA    +   E++KPKPG+RG
Sbjct  61   SMQIHHESKHPKIPFEEDKVTNLHAVRVTA---EASKPKPGVRG  101



>ref|XP_010275117.1| PREDICTED: uncharacterized protein LOC104610274 [Nelumbo nucifera]
Length=104

 Score =   166 bits (421),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSG DKGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGLDKGGHAKFECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPFDE K+ NLHA    S   +  KP+PG+RG
Sbjct  61   SMQIHHDAKHPKIPFDEAKVVNLHA----SHSVDPAKPRPGVRG  100



>ref|XP_002325468.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE99849.1| zinc finger family protein [Populus trichocarpa]
Length=114

 Score =   166 bits (420),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG ADR+GQ+KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGQADRTGQEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHHDARHPK+PF+E KL+NLHA        +S+KP+PG++G
Sbjct  61   TMQIHHDARHPKLPFEEDKLSNLHAVHV----ADSSKPRPGVKG  100



>ref|XP_010558583.1| PREDICTED: uncharacterized protein LOC104827174 [Tarenaya hassleriana]
Length=104

 Score =   166 bits (419),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAGLADRSGQ+KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKLDAATTNRGGGKAGLADRSGQEKGGHAKYECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH++RHPKIPF+E K+ NLHA    S   +  KPKPGIRG
Sbjct  61   TMQIHHESRHPKIPFEEAKVTNLHA----SRPADLAKPKPGIRG  100



>gb|AGG23548.1| C2H2-type zinc finger protein [Malus hupehensis]
Length=110

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG+ADR+GQ+KGGHAK+ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGIADRTGQEKGGHAKMECPQCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATAT--PSSGGESNKPKPGIRG  350
            S++IHH+ARHPKIPF+E K+ N HA+ +  P    ++NKP+PG+RG
Sbjct  61   SIKIHHEARHPKIPFEEEKVVNRHASTSTQPEPVKDANKPRPGVRG  106



>ref|XP_011006975.1| PREDICTED: uncharacterized protein LOC105112815 [Populus euphratica]
Length=114

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG ADR+GQ+KGGHAK ECP CK+TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGQADRTGQEKGGHAKYECPHCKITAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHHDARHPK+PF+E KL NLHA        +S+KP+PG++G
Sbjct  61   TMQIHHDARHPKLPFEEDKLANLHAVHV----ADSSKPRPGVKG  100



>ref|XP_006371268.1| hypothetical protein POPTR_0019s08070g [Populus trichocarpa]
 gb|ABK94760.1| unknown [Populus trichocarpa]
 gb|ABK95662.1| unknown [Populus trichocarpa]
 gb|ABK96583.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP49065.1| hypothetical protein POPTR_0019s08070g [Populus trichocarpa]
Length=104

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG ADR+GQ+KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGQADRTGQEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHHDARHPK+PF+E KL+NLHA        +S+KP+PG++G
Sbjct  61   TMQIHHDARHPKLPFEEDKLSNLHAVHV----ADSSKPRPGVKG  100



>gb|KDP26866.1| hypothetical protein JCGZ_18024 [Jatropha curcas]
Length=105

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG  DR+GQDKGGHAK ECP CKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGQKDRTGQDKGGHAKYECPHCKVTAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+P++E KL NLHA     S   S+KP+PG+RG
Sbjct  61   SMQIHHEARHPKLPYEEDKLVNLHAVHVADS---SSKPRPGVRG  101



>gb|KJB74766.1| hypothetical protein B456_012G028300 [Gossypium raimondii]
 gb|KJB74767.1| hypothetical protein B456_012G028300 [Gossypium raimondii]
 gb|KJB74768.1| hypothetical protein B456_012G028300 [Gossypium raimondii]
Length=104

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADRSG +KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGFADRSGVEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPK+PF+E+KL NLHA        E++KP+PG+RG
Sbjct  61   SMQIHHDAKHPKVPFEESKLVNLHAVHVV----ETSKPRPGVRG  100



>ref|XP_010251502.1| PREDICTED: uncharacterized protein LOC104593396 [Nelumbo nucifera]
 ref|XP_010251503.1| PREDICTED: uncharacterized protein LOC104593396 [Nelumbo nucifera]
Length=104

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSG  KGGHAK ECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGVGKGGHAKYECPHCKTTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPK PFDE KL NLHA    +   ES+KP+PG+RG
Sbjct  61   SMQIHHDAKHPKTPFDEAKLINLHA----NHAVESSKPRPGVRG  100



>ref|XP_008218445.1| PREDICTED: uncharacterized protein LOC103318791 [Prunus mume]
Length=115

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 11/113 (10%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG+ADR+GQ+KGGHAK+ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGIADRTGQEKGGHAKMECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHA---------TATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPKIPF+E K+ N HA          A PS   ++NKP+PG+RG
Sbjct  61   SMQIHHEARHPKIPFEEEKIVNRHASTSTSTSTQVAEPSK--DANKPRPGVRG  111



>ref|XP_010525089.1| PREDICTED: uncharacterized protein LOC104802953 [Tarenaya hassleriana]
Length=104

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG+ADRSGQ+KGGHAK ECP CKVTAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKLDAATTNRGGGKAGIADRSGQEKGGHAKYECPHCKVTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPKIPF+E K+ NLH+    S   ES KPKPG+RG
Sbjct  61   TMQIHHESKHPKIPFEEAKVVNLHS----SRPVESAKPKPGVRG  100



>ref|XP_008388806.1| PREDICTED: uncharacterized protein LOC103451147 [Malus domestica]
Length=110

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG+ADR+GQ+KGGHAK+ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGIADRTGQEKGGHAKMECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATAT--PSSGGESNKPKPGIRG  350
            S++IHH+ARHPKIPF+E K+ N HA+ +  P    ++NKP+PG+RG
Sbjct  61   SIKIHHEARHPKIPFEEEKVVNRHASTSTQPEPVKDANKPRPGVRG  106



>ref|XP_004139104.1| PREDICTED: uncharacterized protein LOC101210666 [Cucumis sativus]
 ref|XP_004157141.1| PREDICTED: uncharacterized protein LOC101231373 [Cucumis sativus]
 gb|KGN66675.1| hypothetical protein Csa_1G657510 [Cucumis sativus]
Length=105

 Score =   164 bits (415),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAGLADRSG +KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGLADRSGHEKGGHAKFECPYCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+++HPK+PF+E K+ NLHA    +   E++K KPG+RG
Sbjct  61   SMQIHHESKHPKVPFEEEKVINLHAVRVAA---EASKTKPGVRG  101



>ref|XP_008370822.1| PREDICTED: uncharacterized protein LOC103434266 [Malus domestica]
 ref|XP_009338013.1| PREDICTED: uncharacterized protein LOC103930400 [Pyrus x bretschneideri]
Length=111

 Score =   164 bits (415),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 3/107 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG+ADR+GQDKGGHAK+ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGIADRTGQDKGGHAKMECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSG---GESNKPKPGIRG  350
            S++IHH+ARHPKIPF+E K+ N HA+ +        ++NKP+PG+RG
Sbjct  61   SIKIHHEARHPKIPFEEEKIVNRHASTSTQVAEPVKDANKPRPGVRG  107



>ref|XP_004492837.1| PREDICTED: uncharacterized protein LOC101508199 [Cicer arietinum]
Length=104

 Score =   164 bits (414),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AKVDAATTNRGGGKAGL DR+G +KGGHAK ECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKVDAATTNRGGGKAGLLDRTGLEKGGHAKWECPHCKTTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIPF+E KL N HA+  P    ES+KP+PG+RG
Sbjct  61   SMQIHHDARHPKIPFEEEKLVNRHASLVP----ESSKPRPGVRG  100



>ref|XP_011014934.1| PREDICTED: uncharacterized protein LOC105118647 [Populus euphratica]
Length=104

 Score =   164 bits (414),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG+ADR+GQ+KGGHAK ECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGVADRTGQEKGGHAKYECPHCKTTAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHHDARHPKIPF+E KL N HA     S  +S+K +PG+RG
Sbjct  61   TMQIHHDARHPKIPFEEDKLVNRHAI----SAADSSKSRPGVRG  100



>ref|XP_004302161.1| PREDICTED: uncharacterized protein LOC101313424 [Fragaria vesca 
subsp. vesca]
Length=107

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAATTNRGGGKAG+ADR+GQDKGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAATTNRGGGKAGIADRTGQDKGGHAKYECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHD++HPKI FDE  + N HA+ T +S   + KPKPG+RG
Sbjct  61   SMQIHHDSKHPKIAFDEAAIVNRHAS-TSTSQAPAEKPKPGVRG  103



>gb|EAZ02314.1| hypothetical protein OsI_24415 [Oryza sativa Indica Group]
Length=113

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 91/109 (83%), Gaps = 5/109 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG  DR GQDKGGHAKLECPLCK TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQKDRLGQDKGGHAKLECPLCKTTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-----ATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KLNNLH     A A   +   S+KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFEPDKLNNLHGGGAGAAAGGEAAASSSKPKPGVRG  109



>ref|XP_007207358.1| hypothetical protein PRUPE_ppa013572mg [Prunus persica]
 gb|EMJ08557.1| hypothetical protein PRUPE_ppa013572mg [Prunus persica]
Length=115

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 11/113 (10%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG+ADR+G++KGGHAK+ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGIADRTGKEKGGHAKMECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHA---------TATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPKIPF+E K+ N HA          A PS   ++NKP+PG+RG
Sbjct  61   SMQIHHEARHPKIPFEEEKIVNRHASTSTSTSTQVAEPSK--DANKPRPGVRG  111



>ref|NP_001058536.1| Os06g0708600 [Oryza sativa Japonica Group]
 dbj|BAD53623.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD53630.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF20450.1| Os06g0708600 [Oryza sativa Japonica Group]
 dbj|BAG94827.1| unnamed protein product [Oryza sativa Japonica Group]
Length=114

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 91/110 (83%), Gaps = 6/110 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG  DR GQDKGGHAKLECPLCK TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQKDRLGQDKGGHAKLECPLCKTTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH------ATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KLNNLH      A A   +   S+KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFEPDKLNNLHGGGAGAAAAAGEAAASSSKPKPGVRG  110



>ref|XP_004966390.1| PREDICTED: uncharacterized protein LOC101767594 [Setaria italica]
Length=110

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 2/106 (2%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADR GQDKGGHAKL CPLC+ +APDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRLGQDKGGHAKLACPLCRTSAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGES--NKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KL NLH++   +S   S  +KPKPGIRG
Sbjct  61   SMQIHHEARHPKLPFEPEKLLNLHSSTPVASEATSSNSKPKPGIRG  106



>gb|KJB26830.1| hypothetical protein B456_004G261900, partial [Gossypium raimondii]
Length=137

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAKVDAATTNRGGGKAGLADRSG +KGGHAK ECP CK TAPD+K
Sbjct  34   MTGKAKPKKHTAKELAAKVDAATTNRGGGKAGLADRSGVEKGGHAKYECPHCKTTAPDVK  93

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPF+E+KL N HA        E +KP+PG+RG
Sbjct  94   SMQIHHDAKHPKIPFEESKLINRHAVHV----AEPSKPRPGVRG  133



>ref|NP_001131254.1| uncharacterized protein LOC100192567 [Zea mays]
 gb|ACF79585.1| unknown [Zea mays]
 gb|ACG24705.1| hypothetical protein [Zea mays]
 gb|ACG38866.1| hypothetical protein [Zea mays]
 gb|ACG49114.1| hypothetical protein [Zea mays]
 gb|AFW75823.1| hypothetical protein ZEAMMB73_608816 [Zea mays]
 gb|AFW75824.1| hypothetical protein ZEAMMB73_608816 [Zea mays]
Length=108

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGK G ADR GQDKGGHAKL CPLC+  APDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKVGQADRLGQDKGGHAKLACPLCRTPAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KL NLH++   ++   ++KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFEPEKLVNLHSSTPAAAEATTSKPKPGVRG  104



>gb|ABU95041.1| C2H2 Zn finger protein [Triticum aestivum]
Length=119

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 92/109 (84%), Gaps = 5/109 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG  DR GQ+KGGHAK+ECPLC+VTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQKDRLGQEKGGHAKMECPLCRVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATA-----TPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PFD  K+NNLH +        ++   ++KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFDPEKINNLHGSTAAAPAAAAAVASTSKPKPGVRG  109



>gb|EEE66335.1| hypothetical protein OsJ_22615 [Oryza sativa Japonica Group]
Length=114

 Score =   161 bits (408),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 91/110 (83%), Gaps = 6/110 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG  DR GQDKGGHAKLECPLCK TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQKDRLGQDKGGHAKLECPLCKTTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHAT------ATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KLNNLH +      A   +   S+KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFEPDKLNNLHGSLAGVRAAAGEAAASSSKPKPGVRG  110



>ref|XP_010070152.1| PREDICTED: uncharacterized protein LOC104456939 [Eucalyptus grandis]
 gb|KCW58751.1| hypothetical protein EUGRSUZ_H01388 [Eucalyptus grandis]
Length=107

 Score =   161 bits (407),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 90/107 (84%), Gaps = 7/107 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAG ADRSG +KGGHAK ECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGKADRSGIEKGGHAKYECPNCKTTAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHAT---ATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIP+DE+KL NLHA    A PSS G     +PG+RG
Sbjct  61   SMQIHHDARHPKIPYDESKLINLHAVLEPAEPSSKGG----RPGVRG  103



>ref|XP_002514854.1| transcription factor, putative [Ricinus communis]
 gb|EEF47408.1| transcription factor, putative [Ricinus communis]
Length=104

 Score =   160 bits (406),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGL DR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLKDRTGEEKGGHAKYECPHCKITAPDMK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+ARHPK+PF+E K  NLHA      G +S+K +PG+RG
Sbjct  61   TMQIHHEARHPKLPFEEDKFVNLHAV----HGADSSKTRPGVRG  100



>emb|CDY28708.1| BnaCnng05940D [Brassica napus]
Length=105

 Score =   160 bits (406),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 91/104 (88%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGGKAG+ADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRNGKEKGGHAKFECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHHD++HPKIP++E+KL NLHA   P +    +KPKPGIRG
Sbjct  61   TMQIHHDSKHPKIPYEESKLVNLHAVLAPVA---ESKPKPGIRG  101



>ref|XP_003624171.1| hypothetical protein MTR_7g079990 [Medicago truncatula]
Length=191

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 4/105 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AKVDAA TNRGGGKAGL DR G +KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKVDAALTNRGGGKAGLLDRIGVEKGGHAKWECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHA-TATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPF+E KL N HA TA P+   ES+KP+PG+RG
Sbjct  61   SMQIHHDAKHPKIPFEEEKLVNKHASTAAPA---ESSKPRPGVRG  102



>dbj|BAJ34455.1| unnamed protein product [Thellungiella halophila]
Length=105

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGGKAG+ADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPKIP+DE+KL NLHA   P +     KPKPGIRG
Sbjct  61   TMQIHHESKHPKIPYDESKLVNLHAVLAPVA---EAKPKPGIRG  101



>gb|ACJ86042.1| unknown [Medicago truncatula]
 gb|AFK49151.1| unknown [Medicago truncatula]
Length=106

 Score =   159 bits (402),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AKVDAA TNRGGGKAGL DR G +KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKVDAALTNRGGGKAGLLDRIGVEKGGHAKWECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPF+E KL N HA+ T  +  ES+KP+PG+RG
Sbjct  61   SMQIHHDAKHPKIPFEEEKLVNKHASTTAPA--ESSKPRPGVRG  102



>dbj|BAK04318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 6/110 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG  DR GQ+KGGHAK+ECPLCKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQKDRLGQEKGGHAKMECPLCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHA------TATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PFD  K+NNLH        A  ++   S+KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFDPDKINNLHGSTAAAAPAAAAAVASSSKPKPGVRG  110



>gb|AFK42214.1| unknown [Medicago truncatula]
 gb|AES80389.2| C2H2 type zinc finger protein [Medicago truncatula]
Length=106

 Score =   159 bits (401),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 4/105 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AKVDAA TNRGGGKAGL DR G +KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKVDAALTNRGGGKAGLLDRIGVEKGGHAKWECPHCKITAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHA-TATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPF+E KL N HA TA P+   ES+KP+PG+RG
Sbjct  61   SMQIHHDAKHPKIPFEEEKLVNKHASTAAPA---ESSKPRPGVRG  102



>dbj|BAJ86969.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87425.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=116

 Score =   159 bits (402),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 6/110 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG  DR GQ+KGGHAK+ECPLCKVTAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQKDRLGQEKGGHAKMECPLCKVTAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHA------TATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PFD  K+NNLH        A  ++   S+KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFDPDKINNLHGSTAAAAPAAAAAVASSSKPKPGVRG  110



>ref|XP_006300194.1| hypothetical protein CARUB_v10016430mg [Capsella rubella]
 gb|EOA33092.1| hypothetical protein CARUB_v10016430mg [Capsella rubella]
Length=105

 Score =   157 bits (397),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGGKAG+ADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+ +DE+KL NLHA   P +    +KPKPGIRG
Sbjct  61   TMQIHHESKHPKLTYDESKLVNLHAVLAPVA---ESKPKPGIRG  101



>ref|XP_007029378.1| Zinc finger (C2H2 type) family protein [Theobroma cacao]
 gb|EOY09880.1| Zinc finger (C2H2 type) family protein [Theobroma cacao]
Length=104

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIA KVDAATTNRGGGKAGLADRSG +KGGHAK ECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIATKVDAATTNRGGGKAGLADRSGVEKGGHAKYECPHCKTTAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPKIPF+E+KL N HA        + +K +PG+RG
Sbjct  61   SMQIHHDAKHPKIPFEESKLVNRHAGHV----ADCSKSRPGVRG  100



>ref|XP_001772389.1| predicted protein [Physcomitrella patens]
 gb|EDQ62860.1| predicted protein [Physcomitrella patens]
Length=105

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAATTNRGGGKAG+ DR G DKGGHAKL CP+CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAATTNRGGGKAGVVDRKGLDKGGHAKLACPVCKATAPDMK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA+HPK+P++E KL NLHA+   +S     KPKPG+RG
Sbjct  61   SMQIHHDAKHPKLPWEEDKLINLHAS---TSVAAEEKPKPGVRG  101



>ref|XP_001767162.1| predicted protein [Physcomitrella patens]
 gb|EDQ68083.1| predicted protein [Physcomitrella patens]
Length=104

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG+ DR   DKGGHAKL CP+CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGVVDRKALDKGGHAKLACPICKATAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SM IHH+A+HPK+P++E KL NLHATA+ +     +KPKPG+RG
Sbjct  61   SMSIHHEAKHPKLPWEEDKLINLHATASTA----EDKPKPGVRG  100



>ref|XP_009147322.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103870893 
[Brassica rapa]
Length=105

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGGKAG+ADR+G+ KG HAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKKKGDHAKFECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPKIP++E+KL NLHA   P +    +KPKPGIRG
Sbjct  61   TMQIHHESKHPKIPYEESKLVNLHAVLAPVA---ESKPKPGIRG  101



>ref|XP_002437568.1| hypothetical protein SORBIDRAFT_10g029490 [Sorghum bicolor]
 gb|EER88935.1| hypothetical protein SORBIDRAFT_10g029490 [Sorghum bicolor]
Length=114

 Score =   156 bits (394),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 6/110 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADR GQDKGGHAKL CPLC+  APDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRLGQDKGGHAKLACPLCRTPAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGE------SNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KL NLH++A  ++         ++KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFEPEKLLNLHSSAPAAAAAAAAAEATTSKPKPGVRG  110



>ref|XP_002882251.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58510.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=105

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGGKAG+ADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPKI ++E+KL NLHA   P +     KPKPGIRG
Sbjct  61   TMQIHHESKHPKIIYEESKLVNLHAVLAPVA---ELKPKPGIRG  101



>gb|ACG38013.1| hypothetical protein [Zea mays]
 gb|AFW69422.1| hypothetical protein ZEAMMB73_476428 [Zea mays]
Length=118

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 10/114 (9%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADR GQDKGGHAKL CPLC+  APDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRLGQDKGGHAKLACPLCRTPAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGE----------SNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KL NLH++A  ++             ++KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFEPEKLLNLHSSAPAAAAAAAAAAAAAEATTSKPKPGVRG  114



>ref|XP_002963136.1| hypothetical protein SELMODRAFT_165749 [Selaginella moellendorffii]
 gb|EFJ36599.1| hypothetical protein SELMODRAFT_165749 [Selaginella moellendorffii]
Length=105

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGL DR G DKGGHAK  CP+CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLEDRLGADKGGHAKFVCPICKATAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SM+IHHDARH K+PF+E K+ N HA    S+     K KPG+RG
Sbjct  61   SMKIHHDARHSKLPFEEEKIANQHAGVESSA---KEKEKPGVRG  101



>ref|XP_002980184.1| hypothetical protein SELMODRAFT_112530 [Selaginella moellendorffii]
 gb|EFJ18444.1| hypothetical protein SELMODRAFT_112530 [Selaginella moellendorffii]
Length=105

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGL DR G DKGGHAK  CP+CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLEDRLGADKGGHAKFVCPICKATAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SM+IHHDARH K+PF+E K+ N HA    S+     K KPG+RG
Sbjct  61   SMKIHHDARHAKLPFEEEKIANQHAGVESSA---KEKEKPGVRG  101



>gb|ABK21472.1| unknown [Picea sitchensis]
 gb|ABK22477.1| unknown [Picea sitchensis]
 gb|ABK25380.1| unknown [Picea sitchensis]
 gb|ABR16146.1| unknown [Picea sitchensis]
 gb|ABR18171.1| unknown [Picea sitchensis]
 gb|ACN39789.1| unknown [Picea sitchensis]
Length=104

 Score =   153 bits (387),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATT+RGGGKAGL DR G +KGGHAK ECP CK TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTSRGGGKAGLHDRLGGEKGGHAKYECPHCKTTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +M+IHH+A+HPKIP++E+K+ N HAT       + NKP+PGIRG
Sbjct  61   TMEIHHEAKHPKIPYEESKIINKHATVQ----ADPNKPRPGIRG  100



>ref|XP_002319276.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE95199.2| zinc finger family protein [Populus trichocarpa]
Length=104

 Score =   152 bits (385),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+AAK+DAATTNRGGGKAG+ADR+GQ+KGGHAK ECP CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKELAAKLDAATTNRGGGKAGVADRTGQEKGGHAKYECPHCKTTAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDARHPKIPF+E KL N HA++       S+K +PG+RG
Sbjct  61   SMQIHHDARHPKIPFEEDKLVNRHASSAAD----SSKSRPGVRG  100



>ref|NP_001142577.1| uncharacterized protein LOC100274838 [Zea mays]
 gb|ACG25208.1| hypothetical protein [Zea mays]
Length=118

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 91/114 (80%), Gaps = 10/114 (9%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADR GQDKGGHAKL CPLC+  APDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRLGQDKGGHAKLACPLCRTPAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGE----------SNKPKPGIRG  350
            SMQIH++ARHPK+PF+  KL NLH++A  ++             ++KPKPG+RG
Sbjct  61   SMQIHYEARHPKLPFEPEKLLNLHSSAPAAAAAAAAAAAAAEATTSKPKPGVRG  114



>gb|ACG41191.1| hypothetical protein [Zea mays]
Length=115

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 90/111 (81%), Gaps = 7/111 (6%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADR GQDKGGHAKL CPLC+  APDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRLGQDKGGHAKLACPLCRTPAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-------ATATPSSGGESNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KL NLH       A A  ++   ++KPKPG+RG
Sbjct  61   SMQIHHEARHPKLPFEPEKLLNLHSSAPAAAAAAAATAEATTSKPKPGVRG  111



>ref|XP_001776841.1| predicted protein [Physcomitrella patens]
 gb|EDQ58391.1| predicted protein [Physcomitrella patens]
Length=104

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIA K+D ATTNRGGGKAG+ DR   DKGGHAKL CP+CK TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIAMKIDMATTNRGGGKAGVIDRKALDKGGHAKLACPICKATAPDVK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SM IHH+A+HPK+P++E KL NLHATA+ +     +KPKPG+RG
Sbjct  61   SMSIHHEAKHPKLPWEEDKLINLHATASTA----EDKPKPGVRG  100



>ref|XP_009126116.1| PREDICTED: uncharacterized protein LOC103851046 isoform X1 [Brassica 
rapa]
 ref|XP_009126117.1| PREDICTED: uncharacterized protein LOC103851046 isoform X2 [Brassica 
rapa]
Length=103

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 7/105 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-ATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E K  NLH A A P    ES+KPKPGIRG
Sbjct  61   TMQIHHESKHPKLPYEEPK--NLHEALAAP----ESSKPKPGIRG  99



>ref|NP_566182.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF26981.1|AC018363_26 unknown protein [Arabidopsis thaliana]
 gb|AAK32767.1|AF361599_1 AT3g02790/F13E7_27 [Arabidopsis thaliana]
 gb|AAL15403.1| AT3g02790/F13E7_27 [Arabidopsis thaliana]
 gb|AEE73860.1| uncharacterized protein AT3G02790 [Arabidopsis thaliana]
Length=105

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 88/104 (85%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGGKAG+ADR+G++KGGHAK ECP CK+TAP +K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKYECPHCKITAPGLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HP I ++E+KL NLHA   P +    +KPKPGIRG
Sbjct  61   TMQIHHESKHPNIIYEESKLVNLHAVLAPVA---ESKPKPGIRG  101



>gb|KFK25865.1| hypothetical protein AALP_AA8G172200 [Arabis alpina]
Length=104

 Score =   151 bits (381),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 6/105 (6%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-ATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E +  NLH A A P+   ES+KPKPGIRG
Sbjct  61   TMQIHHESKHPKMPYEEPR--NLHEALAAPA---ESSKPKPGIRG  100



>ref|XP_009131543.1| PREDICTED: uncharacterized protein LOC103856199 [Brassica rapa]
 emb|CDX78693.1| BnaA03g06050D [Brassica napus]
Length=106

 Score =   150 bits (380),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 88/104 (85%), Gaps = 2/104 (2%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E K  NLH     ++   S+KPKPGIRG
Sbjct  61   TMQIHHESKHPKLPYEEPK--NLHEALGAAAPESSSKPKPGIRG  102



>emb|CDY55576.1| BnaC09g41470D [Brassica napus]
Length=103

 Score =   150 bits (380),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 90/105 (86%), Gaps = 7/105 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGG+AGLADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGRAGLADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-ATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E K  NLH A A P    ES+KPKPGIRG
Sbjct  61   TMQIHHESKHPKLPYEEPK--NLHEALAAP----ESSKPKPGIRG  99



>emb|CDX85506.1| BnaA02g03070D [Brassica napus]
Length=103

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 89/105 (85%), Gaps = 7/105 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G +KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGTEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-ATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E K  NLH A A P    ES+KPKPGIRG
Sbjct  61   TMQIHHESKHPKLPYEEPK--NLHEALAAP----ESSKPKPGIRG  99



>ref|XP_006400185.1| hypothetical protein EUTSA_v10015095mg [Eutrema salsugineum]
 gb|ESQ41638.1| hypothetical protein EUTSA_v10015095mg [Eutrema salsugineum]
Length=103

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 90/105 (86%), Gaps = 7/105 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-ATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E +  NLH A A P    ES+KPKPGIRG
Sbjct  61   TMQIHHESKHPKMPYEEPR--NLHEALAAP----ESSKPKPGIRG  99



>emb|CDX70696.1| BnaC03g07800D [Brassica napus]
Length=105

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 7/106 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHA--TATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E K  NLH    A P S   S+KPKPGIRG
Sbjct  61   TMQIHHESKHPKLPYEEPK--NLHEALAAAPES---SSKPKPGIRG  101



>ref|XP_009121489.1| PREDICTED: uncharacterized protein LOC103846331 [Brassica rapa]
 emb|CDX69450.1| BnaA10g17990D [Brassica napus]
Length=103

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 89/105 (85%), Gaps = 7/105 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHAT-ATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+P++E K  NLH   A P    ES+KPKPGIRG
Sbjct  61   TMQIHHESKHPKLPYEEPK--NLHEVLAAP----ESSKPKPGIRG  99



>ref|XP_010420340.1| PREDICTED: uncharacterized protein LOC104705936 isoform X1 [Camelina 
sativa]
 ref|XP_010420341.1| PREDICTED: uncharacterized protein LOC104705936 isoform X2 [Camelina 
sativa]
 ref|XP_010453806.1| PREDICTED: uncharacterized protein LOC104735677 [Camelina sativa]
 ref|XP_010492554.1| PREDICTED: uncharacterized protein LOC104769927 [Camelina sativa]
Length=104

 Score =   147 bits (372),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 89/105 (85%), Gaps = 6/105 (6%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+T PD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITVPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-ATATPSSGGESNKPKPGIRG  350
            +MQIHH++RHPK+ ++E +  NLH A A P+   ES+KPKPGIRG
Sbjct  61   TMQIHHESRHPKLTYEEPR--NLHEALAAPA---ESSKPKPGIRG  100



>ref|XP_010485607.1| PREDICTED: uncharacterized protein LOC104763897 [Camelina sativa]
Length=105

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGG+AG+ADR+G++KGGHAK ECP CK+T P +K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGQAGIADRTGKEKGGHAKYECPHCKITVPGLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+ +DE+ + NLHA   P +    +KPKPGIRG
Sbjct  61   TMQIHHESKHPKLTYDESLVVNLHAVLAPVA---ESKPKPGIRG  101



>ref|NP_197151.1| C2H2 type zinc finger protein [Arabidopsis thaliana]
 ref|XP_002871720.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006288951.1| hypothetical protein CARUB_v10002316mg [Capsella rubella]
 dbj|BAB09614.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO24598.1| At5g16470 [Arabidopsis thaliana]
 dbj|BAF00119.1| hypothetical protein [Arabidopsis thaliana]
 gb|EFH47979.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AED92297.1| C2H2 type zinc finger protein [Arabidopsis thaliana]
 gb|EOA21849.1| hypothetical protein CARUB_v10002316mg [Capsella rubella]
Length=104

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 6/105 (6%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKE+ AK DAA TNRGGGKAGLADR+G++KGGHAK ECP CK+T PD+K
Sbjct  1    MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITVPDLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLH-ATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+ ++E +  NLH A A P+   ES+KPKPGIRG
Sbjct  61   TMQIHHESKHPKLTYEEPR--NLHEALAAPA---ESSKPKPGIRG  100



>ref|XP_010111074.1| hypothetical protein L484_015129 [Morus notabilis]
 gb|EXC29936.1| hypothetical protein L484_015129 [Morus notabilis]
Length=97

 Score =   146 bits (368),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 85/104 (82%), Gaps = 11/104 (11%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADR G +KGGHAK ECP CK+TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRVGVEKGGHAKYECPHCKITAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            SMQIHHDA       +E+KL+NLHAT       E++K +PG+RG
Sbjct  61   SMQIHHDA-------EESKLSNLHAT----HAAETSKARPGVRG  93



>ref|XP_010501491.1| PREDICTED: uncharacterized protein LOC104778713 [Camelina sativa]
Length=105

 Score =   146 bits (368),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGG+AG+ADR+G++KGGHAK ECP CK+T P +K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGQAGIADRTGKEKGGHAKYECPHCKITVPGLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +M+IHH+++HPK+ +DE+ + NLHA   P +    +KPKPGIRG
Sbjct  61   TMEIHHESKHPKLTYDESLVVNLHAVLAPVA---ESKPKPGIRG  101



>ref|XP_010463704.1| PREDICTED: uncharacterized protein LOC104744359 [Camelina sativa]
Length=105

 Score =   146 bits (368),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 86/104 (83%), Gaps = 3/104 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGG AG+ADR+G++KGGHAK ECP CK+T P +K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGLAGIADRTGKEKGGHAKYECPHCKITVPGLK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +MQIHH+++HPK+ +DE+ + NLHA   P +    +KPKPGIRG
Sbjct  61   TMQIHHESKHPKLTYDESLVVNLHAVLAPVA---ESKPKPGIRG  101



>gb|AAX92680.1| C2H2 type zinc finger family protein [Picea abies]
Length=104

 Score =   139 bits (351),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 4/104 (4%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+      RGGGKAGL DR G +KGGHAK ECP CK TAPDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKLMRQRQVRGGGKAGLHDRLGGEKGGHAKYECPHCKTTAPDIK  60

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGESNKPKPGIRG  350
            +M+IHH+A+HPKIP++E+K+ N HAT       + NKP+PGIRG
Sbjct  61   TMEIHHEAKHPKIPYEESKIINKHATVQ----ADPNKPRPGIRG  100



>ref|NP_001144301.1| uncharacterized protein LOC100277189 [Zea mays]
 gb|ACG39394.1| hypothetical protein [Zea mays]
Length=107

 Score =   122 bits (307),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 80/115 (70%), Gaps = 23/115 (20%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEIAAK+DAATTNRGGGKAG ADR G            LC+  APDIK
Sbjct  1    MTGKAKPKKHTAKEIAAKIDAATTNRGGGKAGQADRLG------------LCRTPAPDIK  48

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGGE-----------SNKPKPGIRG  350
            SMQIHH+ARHPK+PF+  KL NLH++A  ++              ++KPKPG+RG
Sbjct  49   SMQIHHEARHPKLPFEPEKLLNLHSSAPAAAAAAAAAAAAAAEATTSKPKPGVRG  103



>emb|CDY51535.1| BnaA05g33350D [Brassica napus]
Length=81

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 2/79 (3%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MTGKAKPKKHTAKEI AK+DAA TNRGGGKAG+ADR+G+ KG HAK ECP CK+TAPD+K
Sbjct  1    MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKKKGDHAKFECPHCKITAPDLK  60

Query  219  SMQIHHDARHPKIPFDETK  275
            +MQIHH++R   IP   TK
Sbjct  61   TMQIHHESR--SIPRSLTK  77



>ref|XP_002501198.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62456.1| predicted protein [Micromonas sp. RCC299]
Length=131

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKPKKHTAKEIA KV AATTN+GGGKAGLADR G    GHAK +CP C + +P IK
Sbjct  1    MAGKAKPKKHTAKEIAGKVAAATTNKGGGKAGLADRLG-GAAGHAKFKCPSCGIQSPSIK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLHA  293
            S ++H D++HPK+PF     +++HA
Sbjct  60   SAEMHWDSKHPKLPFKPEDWSDMHA  84



>ref|XP_001696835.1| hypothetical protein CHLREDRAFT_138304 [Chlamydomonas reinhardtii]
 gb|EDP00943.1| predicted protein [Chlamydomonas reinhardtii]
Length=101

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +3

Query  45   GKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIKSM  224
            GKAKP KHTAKEIA KV AATTN+GGG+AGLADR G  K GHAK +C +CK  APD+KSM
Sbjct  2    GKAKPAKHTAKEIAQKVAAATTNKGGGQAGLADRLG-GKVGHAKFQCNICKQQAPDLKSM  60

Query  225  QIHHDARHPKIPFDETKLNNLHA  293
            Q+H +ARHPK  ++  K  +LHA
Sbjct  61   QMHFEARHPKDLWEPEKCTDLHA  83



>ref|XP_002956123.1| hypothetical protein VOLCADRAFT_66623 [Volvox carteri f. nagariensis]
 gb|EFJ42863.1| hypothetical protein VOLCADRAFT_66623 [Volvox carteri f. nagariensis]
Length=100

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +3

Query  45   GKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIKSM  224
            GKAKP KHTAKEIA KV AATTN GGGK G  DR G  K GHAK +C +CK TAPD+KSM
Sbjct  2    GKAKPAKHTAKEIATKVAAATTNMGGGKLGQEDRLG-GKAGHAKFQCHICKQTAPDLKSM  60

Query  225  QIHHDARHPKIPFDETKLNNLHA  293
            Q+HH+ARHPK  ++  K  +LHA
Sbjct  61   QMHHEARHPKEAWEPEKCTDLHA  83



>ref|XP_007508426.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20530.1| predicted protein [Bathycoccus prasinos]
Length=136

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKPKKHTAKE+  K DAA TN+GGGKAGLADR G    GHAK +CP+C + AP IK
Sbjct  1    MAGKAKPKKHTAKELKQKQDAALTNKGGGKAGLADRKG-GAAGHAKFKCPICGMAAPSIK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLHA  293
            S ++H D++HPK+PF   + ++LHA
Sbjct  60   SGELHWDSKHPKMPFKPEEWSDLHA  84



>ref|XP_003062503.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53322.1| predicted protein [Micromonas pusilla CCMP1545]
Length=130

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KH+AKEIA KV AATTN+GGGKAGLADR G    GHAK +CP C   AP IK
Sbjct  1    MGGKAKPTKHSAKEIAGKVAAATTNKGGGKAGLADRKG-GAAGHAKFKCPSCGQQAPSIK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLHA  293
            S ++H D++H K+PF     ++ HA
Sbjct  60   SAEMHWDSKHSKLPFVPGDWSDTHA  84



>ref|XP_003080110.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL54277.1| Zinc finger protein 706 [Ostreococcus tauri]
Length=129

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKPKKHTAKE+ AK  AA TN+GGG AGL DR G    GHAK +CP+C + AP  K
Sbjct  1    MAGKAKPKKHTAKELQAKAAAALTNKGGGAAGLVDRKG-GAAGHAKFKCPVCGMAAPSEK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLHA  293
            S   H D++HPK+ FD  +  + HA
Sbjct  60   SGIAHWDSKHPKLTFDFAQWTDQHA  84



>ref|XP_003862617.1| hypothetical protein, conserved [Leishmania donovani]
 emb|CBZ35924.1| hypothetical protein, conserved [Leishmania donovani]
Length=108

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E A K   ATTN GGG AGLADR G    GH+K  C +C   APD+K
Sbjct  1    MGGKAKPTKHTAGETARKNHLATTNMGGGSAGLADRKG-GVAGHSKFICKVCMAQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            SM+IH ++RHP   F+E    +LH
Sbjct  60   SMRIHFESRHPNETFNENDFEDLH  83



>ref|XP_001466714.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 emb|CAM69758.1| conserved hypothetical protein [Leishmania infantum JPCM5]
Length=108

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E A K   ATTN GGG AGLADR G    GH+K  C +C   APD+K
Sbjct  1    MGGKAKPTKHTAGETARKNHLATTNMGGGSAGLADRKG-GVAGHSKFICKVCMAQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            SM+IH ++RHP   F+E    +LH
Sbjct  60   SMRIHFESRHPNETFNENDFEDLH  83



>ref|XP_003722269.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 emb|CBZ12527.1| conserved hypothetical protein [Leishmania major strain Friedlin]
Length=108

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E A K   ATTN GGG AGLADR G    GH+K  C +C   APD+K
Sbjct  1    MGGKAKPTKHTAGETARKNHLATTNMGGGSAGLADRKG-GVAGHSKFICKVCMAQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            SM+IH ++RHP   F+E    +LH
Sbjct  60   SMRIHFESRHPNETFNEDDFEDLH  83



>ref|XP_003872371.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ23842.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=107

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E A K   ATTN GGG AGLADR G    GH+K  C +C   APD+K
Sbjct  1    MGGKAKPTKHTAGETARKNHLATTNMGGGSAGLADRKG-GVAGHSKFICRVCMAQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            SM+IH ++RHP   F+E    +LH
Sbjct  60   SMRIHFESRHPNQTFNEDDFEDLH  83



>ref|XP_001566528.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM40040.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=108

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KH+A E A K   ATTN GGG AGLADR G    GH+K  C +C   APD+K
Sbjct  1    MGGKAKPTKHSAAETARKNHLATTNMGGGSAGLADRKG-GAAGHSKFICKVCMAQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGG  317
            SM+IH ++RHP   F E    +LH     S+ G
Sbjct  60   SMRIHFESRHPHETFSEADFEDLHEKYGGSTKG  92



>ref|XP_010700793.1| hypothetical protein LPMP_291880 [Leishmania panamensis]
 gb|AIO00136.1| hypothetical protein LPMP_291880 [Leishmania panamensis]
Length=108

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KH+A E A K   ATTN GGG AGLADR G    GH+K  C +C   APD+K
Sbjct  1    MGGKAKPTKHSAAETARKNHLATTNMGGGSAGLADRKG-GAAGHSKFICKVCMAQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGG  317
            SM+IH ++RHP   F E    +LH     S+ G
Sbjct  60   SMRIHFESRHPHETFSEADFEDLHEKYGGSTKG  92



>ref|XP_005834143.1| hypothetical protein GUITHDRAFT_45817, partial [Guillardia theta 
CCMP2712]
 gb|EKX47163.1| hypothetical protein GUITHDRAFT_45817, partial [Guillardia theta 
CCMP2712]
Length=95

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   KHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIKSMQIHHDA  242
            KHTAKEI+ K   A  N GGGKAGL DR G  K GHAKL CPLC + AP +K+M++HH++
Sbjct  14   KHTAKEISEKNKLANKNMGGGKAGLEDRLG-GKAGHAKLICPLCMMQAPSLKNMEMHHES  72

Query  243  RHPKIPFDETKLNNLH  290
            +HPK+P+D     N H
Sbjct  73   KHPKVPWDPNIYQNTH  88



>ref|XP_001418807.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97100.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=132

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKPKKHTAKE+A+K  AA TN+GGGK+G ADR G    GHAK +CP+C   AP  K
Sbjct  1    MAGKAKPKKHTAKELASKAAAALTNKGGGKSGKADRLG-GAAGHAKFKCPVCAQGAPSEK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLHATATPSSGG  317
            +   H D++H K+PF      + HA    +SGG
Sbjct  60   TAVAHWDSKHAKLPFVFADWTDAHA----ASGG  88



>gb|EPY28967.1| transcription factor [Angomonas deanei]
Length=102

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E A K   ATTN GGGK GL DR G    GH+K  C +C    PD+K
Sbjct  1    MGGKAKPTKHTAAETARKEKLATTNMGGGKDGLKDRKGGSV-GHSKFICKVCMTQTPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            +M+ H++A+HP   F E+   +LH
Sbjct  60   TMRTHYEAKHPNAEFKESDFEDLH  83



>emb|CCW59692.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=109

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E   K   A TN GGG  GL DR G  + GH++  C +C + APD+K
Sbjct  1    MGGKAKPTKHTAAETRRKEQLANTNMGGGSVGLRDRMG-GQAGHSRFICKICMLQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            SM +H+++RHP + F E+   +LH
Sbjct  60   SMGLHYESRHPDVEFLESDFEDLH  83



>gb|EPY31587.1| transcription factor [Angomonas deanei]
Length=102

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E A K   ATTN GGGK GL DR G    GH+K  C +C    PD+K
Sbjct  1    MGGKAKPTKHTAAETARKEKLATTNMGGGKDGLKDRKGGAV-GHSKFICKICMTQTPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            +M+ H++A+HP   F E+   +LH
Sbjct  60   TMRTHYEAKHPNAEFKESDFEDLH  83



>gb|EPY31931.1| transcription factor [Strigomonas culicis]
Length=109

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E A K   A TN GGG AG+ DR G    GH++  C +C    PD+K
Sbjct  1    MGGKAKPTKHTASETARKDHLANTNMGGGAAGVRDRQG-GAAGHSRFICKVCMSQTPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            +M+ H++A+HP + F E+   NLH
Sbjct  60   TMKTHYEAKHPTVEFKESDFENLH  83



>ref|XP_005845144.1| hypothetical protein CHLNCDRAFT_137279 [Chlorella variabilis]
 gb|EFN53042.1| hypothetical protein CHLNCDRAFT_137279 [Chlorella variabilis]
Length=101

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  48   KAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIKSMQ  227
            KAK   HTAKE+AAK  AA  N GGGKAGLADR G  + GHAK +C +C   APD+K+MQ
Sbjct  3    KAKQAHHTAKELAAKAKAALQNAGGGKAGLADRKG-GQAGHAKYKCHICGQQAPDLKTMQ  61

Query  228  IHHDARHPKIPFDETKLNNLH  290
            IHHDA+HPK+P++  K  N+H
Sbjct  62   IHHDAKHPKLPWEPEKCTNMH  82



>emb|CCW67329.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=109

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHTA E   K   A  N GGG +GL DR G  + GH+K  C +C + APD+K
Sbjct  1    MGGKAKPTKHTAAETRRKEQLANQNMGGGASGLKDRKG-GQAGHSKFICKICMLQAPDLK  59

Query  219  SMQIHHDARHPKIPFDETKLNNLH  290
            SM +H++++H  + F E    +LH
Sbjct  60   SMSLHYESKHTNVEFCEDDFQDLH  83



>emb|CAC33094.1| hypothetical protein [Rhodomonas sp. CS24]
Length=124

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +3

Query  63   KHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIKSMQIHHDA  242
            KHT+ E+A+K   AT N GGGKAGL DR G  K GHAK  CP CK+ A  +K+MQ H+D+
Sbjct  22   KHTSGEVASKTALATRNAGGGKAGLQDRKG-GKAGHAKFICPECKMQAASMKNMQDHYDS  80

Query  243  RHPKIPFDETKLNN---LHATAT  302
            +HPK   D     N   +H  +T
Sbjct  81   KHPKDVLDPAACQNAQEMHGGST  103



>ref|XP_010099458.1| UDP-glycosyltransferase 87A2 [Morus notabilis]
 gb|EXB78533.1| UDP-glycosyltransferase 87A2 [Morus notabilis]
Length=230

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  27   RAVAMTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTA  206
            +A    GKAK KKHT KEIAA V   TT RGGGKAG  D     K  HAK ECP  K TA
Sbjct  163  QARCFRGKAKLKKHTTKEIAATV---TTTRGGGKAGPTDSCNAKKDDHAKFECPHYKTTA  219

Query  207  PDIKSMQI  230
            PDIKS+ I
Sbjct  220  PDIKSIHI  227



>ref|XP_010091528.1| hypothetical protein L484_015955 [Morus notabilis]
 gb|EXB44698.1| hypothetical protein L484_015955 [Morus notabilis]
Length=69

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            MT KAKPKKHT K+IAAK++AA TN  G KAGL  R G +KGGH K E P CK  AP+IK
Sbjct  1    MTCKAKPKKHTVKKIAAKIEAAATNPEGRKAGLVGRGGVEKGGHVKFERPHCKTNAPNIK  60

Query  219  SMQI  230
            SMQI
Sbjct  61   SMQI  64



>ref|XP_005835691.1| hypothetical protein GUITHDRAFT_93533 [Guillardia theta CCMP2712]
 gb|EKX48711.1| hypothetical protein GUITHDRAFT_93533 [Guillardia theta CCMP2712]
Length=80

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIK  218
            M GKAKP KHT+KEIA KV  A  NRGGG AG A+R     G     +C +C    P  K
Sbjct  1    MGGKAKPTKHTSKEIAKKVFEANVNRGGGAAGKAERQNAACG----FKCYVCLCQQPSEK  56

Query  219  SMQIHHDARH  248
            S+QIH +A+H
Sbjct  57   SLQIHWEAKH  66



>ref|XP_010113045.1| hypothetical protein L484_022771 [Morus notabilis]
 gb|EXC35216.1| hypothetical protein L484_022771 [Morus notabilis]
Length=236

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  108  TNRGGGKAGLADRSGQDKGGHAKLECPLCKVTAPDIKSMQI  230
            TNRGG KAGLAD  G  KG HAK ECP CK TAPDIKSMQI
Sbjct  139  TNRGGRKAGLADCGGAKKGSHAKFECPYCKTTAPDIKSMQI  179



>ref|XP_008915126.1| hypothetical protein PPTG_18703 [Phytophthora parasitica INRA-310]
 gb|ETI31033.1| hypothetical protein F443_21951 [Phytophthora parasitica P1569]
 gb|ETK71415.1| hypothetical protein L915_21346 [Phytophthora parasitica]
 gb|ETL24854.1| hypothetical protein L916_21217 [Phytophthora parasitica]
 gb|ETL78071.1| hypothetical protein L917_21071 [Phytophthora parasitica]
 gb|ETM31335.1| hypothetical protein L914_21085 [Phytophthora parasitica]
 gb|ETM99630.1| hypothetical protein PPTG_18703 [Phytophthora parasitica INRA-310]
 gb|ETO59736.1| hypothetical protein F444_21970 [Phytophthora parasitica P1976]
 gb|ETP00829.1| hypothetical protein F441_21836 [Phytophthora parasitica CJ01A1]
 gb|ETP28975.1| hypothetical protein F442_21814 [Phytophthora parasitica P10297]
Length=98

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 10/78 (13%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLE--CPLCKVTAPD  212
            M GKAK KKHTA ++  +      N+GGGKAG A R      G AKL   C +C   +PD
Sbjct  1    MGGKAKFKKHTAADLERR--QKQVNKGGGKAGAATR------GVAKLNFTCDICMSASPD  52

Query  213  IKSMQIHHDARHPKIPFD  266
            IKS + H+ ++HPK  FD
Sbjct  53   IKSYEQHYTSKHPKAVFD  70



>emb|CCA27042.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=101

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 13/99 (13%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLE--CPLCKVTAPD  212
            M GKAK +KHTAKE+ AK  A+ +  GG    +  ++       AKL   C +CK ++PD
Sbjct  1    MGGKAKFQKHTAKELQAKAAASKSKGGGKSGAVTRKT-------AKLNFICEVCKTSSPD  53

Query  213  IKSMQIHHDARHPKIPFDETKL----NNLHATATPSSGG  317
            +KS+++H+ ++HPK PFD          L  T TP   G
Sbjct  54   VKSLELHYQSKHPKAPFDREACIKIAEELRETNTPKVTG  92



>gb|EMT19799.1| hypothetical protein F775_42434 [Aegilops tauschii]
Length=288

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  145  RSASPAFPPPRLVVAASTFAAISFAVCFFGFAFPVMA  35
            RS  PA PPPRLVVAAS FAAIS AVCFFGFA  V++
Sbjct  220  RSFCPALPPPRLVVAASIFAAISLAVCFFGFALRVLS  256



>gb|ABN05675.1| hypothetical protein MtrDRAFT_AC147963g31v2 [Medicago truncatula]
Length=67

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  63   KHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAK  176
            +H  +EI AKVDA  TNRGGGKAGL  R   +KGGHAK
Sbjct  12   RHGGQEIQAKVDATLTNRGGGKAGLLGRIVVEKGGHAK  49



>ref|XP_008871741.1| hypothetical protein H310_07979 [Aphanomyces invadans]
 gb|ETV99185.1| hypothetical protein H310_07979 [Aphanomyces invadans]
Length=139

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 7/94 (7%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGK---AGLADRSGQDKGGHAKLECPLCKVTAP  209
            M GKAK +KHTAKEI  K+ AA    G      +GL +R  Q  G    ++C +C     
Sbjct  1    MGGKAKTQKHTAKEINMKIKAAKERAGAAGGGASGLENRKCQKVG----VKCDICLHEFL  56

Query  210  DIKSMQIHHDARHPKIPFDETKLNNLHATATPSS  311
                M+IH+DARHP+  F E  +    A A   +
Sbjct  57   SFADMRIHYDARHPREAFPEETIKEAFAAAKSKT  90



>ref|XP_009537352.1| hypothetical protein PHYSODRAFT_527958 [Phytophthora sojae]
 gb|EGZ07786.1| hypothetical protein PHYSODRAFT_527958 [Phytophthora sojae]
Length=113

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 47/93 (51%), Gaps = 25/93 (27%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLE--CPLCKV----  200
            M GKAK KKHTA ++  +      N+GGGKAG + R      G AKL   C +C V    
Sbjct  1    MGGKAKFKKHTAADLERR--QKQVNKGGGKAGASTR------GVAKLNFTCDICMVRPIP  52

Query  201  -----------TAPDIKSMQIHHDARHPKIPFD  266
                        +PDIKS + H+ ++HPK  FD
Sbjct  53   TDLCLVAVQQSASPDIKSYEQHYTSKHPKASFD  85



>ref|XP_002904016.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY54194.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=113

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 46/93 (49%), Gaps = 25/93 (27%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLE--CPLCKV----  200
            M GKAK KKHTA E+  +      N+GGGK G + R      G AKL   C +C V    
Sbjct  1    MGGKAKFKKHTAAELERR--QKQVNKGGGKTGASTR------GVAKLNFTCDICMVCGGN  52

Query  201  -----------TAPDIKSMQIHHDARHPKIPFD  266
                        +PDIKS + H+ ++HPK  F+
Sbjct  53   IDRNISSYNMSASPDIKSYEQHYTSKHPKATFN  85



>ref|XP_003591173.1| hypothetical protein MTR_1g083560 [Medicago truncatula]
Length=54

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  78   EIAAKVDAATTNRGGGKAGLADRSGQDKGGHAK  176
            EI AKVDA  TNRGGGKAGL  R   +KGGHAK
Sbjct  4    EIQAKVDATLTNRGGGKAGLLGRIVVEKGGHAK  36



>ref|XP_006408383.1| hypothetical protein EUTSA_v10020933mg [Eutrema salsugineum]
 gb|ESQ49836.1| hypothetical protein EUTSA_v10020933mg [Eutrema salsugineum]
Length=378

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  266  IERDLRMAGVVVDLHRFDVRRGDFAERTLQLRMPALILTRPVRQPGFSSAPVG  108
            + RDLRM G V+DLHR ++R  +FA RTL   +   + + P+     SSA VG
Sbjct  9    VVRDLRMLGFVMDLHRLEIRSCNFAVRTLVFSVTTFLFSGPISDSRLSSASVG  61



>emb|CCI41130.1| unnamed protein product [Albugo candida]
Length=101

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 9/78 (12%)
 Frame = +3

Query  39   MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLADRSGQDKGGHAKLE--CPLCKVTAPD  212
            M GKAK +KHTAKE+ AK  A+ +  GG    +  ++       AKL   C +CK  +PD
Sbjct  1    MGGKAKFQKHTAKELQAKAAASKSKGGGKSGAVTRKT-------AKLNFICDVCKTPSPD  53

Query  213  IKSMQIHHDARHPKIPFD  266
              S+ +H+ ++HPK+PFD
Sbjct  54   ATSLGLHYASKHPKVPFD  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160