BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN013D21

Length=190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...  44.7    4e-07   Populus euphratica
ref|XP_002311107.1|  ADR12-2 family protein                           44.3    5e-07   Populus trichocarpa [western balsam poplar]
gb|KHG20498.1|  Elongation factor 1-alpha                             44.3    5e-07   Gossypium arboreum [tree cotton]
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...  44.3    5e-07   Populus euphratica
ref|XP_002312029.1|  ADR12-2 family protein                           44.3    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g           44.3    5e-07   
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2  44.3    5e-07   Populus euphratica
dbj|BAK08819.1|  elongation factor 1-alpha                            44.3    5e-07   Chara braunii
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha             44.3    5e-07   Fragaria vesca subsp. vesca
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like        44.3    5e-07   Populus euphratica
ref|XP_002311106.1|  ADR12-2 family protein                           44.3    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g           44.3    5e-07   Populus trichocarpa [western balsam poplar]
ref|NP_001105565.1|  elongation factor alpha5                         44.3    5e-07   
dbj|BAK08744.1|  elongation factor 1-alpha                            44.3    5e-07   Chara braunii
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like        44.3    5e-07   Populus euphratica
gb|AAF99703.1|  elongation factor                                     43.9    5e-07   Saccharum officinarum [noble cane]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...  43.9    6e-07   Setaria italica
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like        43.9    6e-07   
gb|ACR38047.1|  unknown                                               43.9    6e-07   Zea mays [maize]
ref|NP_001104939.1|  elongation factor alpha6                         44.3    6e-07   Zea mays [maize]
dbj|BAK08818.1|  elongation factor 1-alpha                            43.9    6e-07   Chara braunii
gb|AGT16893.1|  elongation factor 1-alpha                             43.9    6e-07   Saccharum hybrid cultivar R570
gb|ACG34498.1|  elongation factor 1-alpha                             43.9    6e-07   Zea mays [maize]
ref|NP_001288465.1|  elongation factor 1-alpha-like                   43.9    6e-07   Zea mays [maize]
ref|NP_001288407.1|  elongation factor 1-alpha-like                   43.9    6e-07   Zea mays [maize]
ref|NP_001105617.1|  elongation factor alpha3                         43.9    7e-07   Zea mays [maize]
ref|NP_001105933.1|  elongation factor alpha2                         43.9    7e-07   
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like        43.9    7e-07   Setaria italica
gb|AFW77593.1|  putative translation elongation factor Tu family ...  43.9    7e-07   
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...  43.9    7e-07   Zea mays [maize]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like        43.9    7e-07   Zea mays [maize]
gb|ACG31866.1|  elongation factor 1-alpha                             43.5    7e-07   Zea mays [maize]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                       43.5    8e-07   Jatropha curcas
ref|NP_001105935.1|  elongation factor alpha8                         43.9    8e-07   
gb|KJB76560.1|  hypothetical protein B456_012G094600                  43.1    8e-07   Gossypium raimondii
gb|AIZ68131.1|  translation elongation factor 1-alpha                 43.5    8e-07   Ornithogalum longebracteatum [sea-onion]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg           43.5    8e-07   Citrus clementina [clementine]
ref|NP_001105934.1|  elongation factor alpha7                         43.5    8e-07   
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg           43.5    9e-07   Citrus clementina [clementine]
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like        43.5    9e-07   Populus euphratica
gb|EEE58429.1|  hypothetical protein OsJ_09630                        43.5    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like        43.5    9e-07   Cucumis melo [Oriental melon]
gb|AGH32502.1|  translation elongation factor-1 alpha                 43.5    9e-07   Stylosanthes guianensis [stylo]
gb|ABR17675.1|  unknown                                               43.5    9e-07   Picea sitchensis
gb|AAC15413.1|  translation elongation factor-1 alpha                 43.5    9e-07   Oryza sativa Japonica Group [Japonica rice]
gb|ABA12218.1|  translation elongation factor 1A-2                    43.5    9e-07   Gossypium hirsutum [American cotton]
gb|ACN40740.1|  unknown                                               43.1    1e-06   Picea sitchensis
gb|KJB09231.1|  hypothetical protein B456_001G130700                  43.1    1e-06   Gossypium raimondii
gb|ABF94275.1|  Elongation factor 1-alpha, putative, expressed        43.1    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like      41.2    1e-06   Brassica rapa
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like        43.1    1e-06   Cucumis sativus [cucumbers]
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g           43.1    1e-06   
gb|ACN41180.1|  unknown                                               43.1    1e-06   Picea sitchensis
gb|AFQ37422.1|  translation elongation factor-1 alpha 1               43.1    1e-06   Larix kaempferi [karamatsu]
gb|ABK25072.1|  unknown                                               43.1    1e-06   Picea sitchensis
gb|EMT09703.1|  Elongation factor 1-alpha                             43.5    1e-06   
gb|KJB76528.1|  hypothetical protein B456_012G093800                  43.1    1e-06   Gossypium raimondii
gb|ABK24265.1|  unknown                                               43.1    1e-06   Picea sitchensis
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1  43.1    1e-06   Populus euphratica
gb|KHG27341.1|  Elongation factor 1-alpha                             43.1    1e-06   Gossypium arboreum [tree cotton]
gb|AIZ74328.1|  translation elongation factor 1-alpha                 43.1    1e-06   Pinus massoniana [Chinese red pine]
gb|AER42621.1|  elongation factor 1 alpha                             43.1    1e-06   Hordeum brevisubulatum
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha             43.1    1e-06   Cucumis melo [Oriental melon]
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like        43.1    1e-06   Cucumis sativus [cucumbers]
dbj|BAC66180.1|  elongation factor 1A                                 43.1    1e-06   Avicennia marina
gb|KHN14872.1|  Elongation factor 1-alpha                             43.1    1e-06   Glycine soja [wild soybean]
dbj|BAO57272.1|  elongation factor 1-alpha                            43.1    1e-06   Ipomoea nil [qian niu]
dbj|BAA23658.1|  EF-1 alpha                                           43.1    1e-06   Oryza sativa [red rice]
ref|NP_001049145.1|  Os03g0177400                                     43.1    1e-06   
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1   43.1    1e-06   Glycine max [soybeans]
emb|CAC27139.1|  translation elongation factor-1 alpha                43.1    1e-06   Picea abies
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like        43.1    1e-06   Oryza brachyantha
gb|ABK24843.1|  unknown                                               43.1    1e-06   Picea sitchensis
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha             42.7    1e-06   Cucumis melo [Oriental melon]
gb|ACN40081.1|  unknown                                               42.7    1e-06   Picea sitchensis
gb|AFQ37423.1|  translation elongation factor-1 alpha 2               42.7    1e-06   Larix kaempferi [karamatsu]
gb|KHG15275.1|  Elongation factor 1-alpha                             42.7    1e-06   Gossypium arboreum [tree cotton]
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  42.7    1e-06   
gb|EMS52529.1|  Elongation factor 1-alpha                             42.7    1e-06   Triticum urartu
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...  42.7    1e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517  42.7    1e-06   
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha             42.7    1e-06   Brachypodium distachyon [annual false brome]
gb|EMS59091.1|  Elongation factor 1-alpha                             42.7    1e-06   Triticum urartu
gb|ADI24333.1|  elongation factor 1-alpha                             42.7    1e-06   Miscanthus sinensis
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                   42.7    1e-06   Saccharum hybrid cultivar CP65-357
gb|AFW87115.1|  putative translation elongation factor Tu family ...  42.7    1e-06   
gb|ABU63160.1|  elongation factor                                     42.7    1e-06   Saccharum officinarum [noble cane]
ref|NP_001105587.1|  elongation factor 1-alpha                        42.7    1e-06   Zea mays [maize]
gb|AFC88830.1|  putative elongation factor 1-alpha                    42.7    1e-06   Miscanthus sinensis
ref|NP_001152668.1|  LOC100286309                                     42.7    1e-06   Zea mays [maize]
emb|CDY58828.1|  BnaAnng15460D                                        42.4    2e-06   Brassica napus [oilseed rape]
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein  42.4    2e-06   
gb|KDP29085.1|  hypothetical protein JCGZ_16474                       42.4    2e-06   Jatropha curcas
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...  42.4    2e-06   Zea mays [maize]
emb|CDP07148.1|  unnamed protein product                              42.4    2e-06   Coffea canephora [robusta coffee]
gb|AFJ04514.1|  elongation factor 1-alpha                             42.4    2e-06   Vernicia fordii [tung oil tree]
emb|CAA68246.1|  factor 1-alpha                                       42.4    2e-06   Forsythia x intermedia [cultivated forsythia]
gb|ABC74971.1|  elongation factor 1 alpha                             42.4    2e-06   Malus domestica [apple tree]
gb|ABX82323.1|  elongation factor 1 subunit alpha                     42.4    2e-06   Cenchrus americanus [bulrush millet]
gb|ACG70967.1|  translation elongation factor 1                       42.4    2e-06   Ziziphus jujuba [Chinese jujube]
gb|AAQ15281.1|  elongation factor 1 alpha                             42.4    2e-06   Pyrus pyrifolia [sha li]
gb|AAR89627.1|  elongation factor 1 alpha                             42.4    2e-06   Citrus sinensis [apfelsine]
emb|CDY06287.1|  BnaA09g49160D                                        42.4    2e-06   
gb|AAV71174.1|  elongation factor 1-alpha                             42.0    2e-06   Lotus corniculatus
ref|XP_003591959.1|  Elongation factor 1-alpha                        42.0    2e-06   
emb|CDP08919.1|  unnamed protein product                              42.0    2e-06   Coffea canephora [robusta coffee]
gb|EMS65134.1|  Elongation factor 1-alpha                             42.0    2e-06   Triticum urartu
gb|AAQ15280.1|  elongation factor 1 alpha                             42.0    2e-06   Pyrus pyrifolia [sha li]
ref|XP_002488910.1|  hypothetical protein SORBIDRAFT_2002s002020      42.7    2e-06   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110        42.0    2e-06   Amborella trichopoda
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190        42.0    2e-06   Amborella trichopoda
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2   42.0    3e-06   Glycine max [soybeans]
ref|XP_003618775.1|  Elongation factor 1-alpha                        41.6    3e-06   
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...  41.6    3e-06   Glycine max [soybeans]
gb|KDP29083.1|  hypothetical protein JCGZ_16472                       41.6    3e-06   Jatropha curcas
gb|AHA84124.1|  elongation factor 1-alpha                             41.6    3e-06   Phaseolus vulgaris [French bean]
gb|AGV54713.1|  elongation factor 1-alpha                             41.6    3e-06   Phaseolus vulgaris [French bean]
ref|NP_001237425.1|  elongation factor-1A                             41.6    3e-06   
ref|XP_001753167.1|  predicted protein                                41.6    3e-06   
ref|XP_001763194.1|  predicted protein                                41.6    3e-06   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g           41.6    3e-06   Phaseolus vulgaris [French bean]
gb|KHN18669.1|  Elongation factor 1-alpha                             41.6    3e-06   Glycine soja [wild soybean]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3  41.6    3e-06   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Malus domestica [apple tree]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1       41.6    3e-06   
ref|XP_001753181.1|  predicted protein                                41.6    3e-06   
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g           41.6    3e-06   Populus trichocarpa [western balsam poplar]
gb|AAY56337.1|  elongation factor-1 alpha                             41.6    3e-06   Musa acuminata [banana]
gb|AEQ94148.1|  elongation factor 1                                   41.6    3e-06   Elaeis guineensis
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Eucalyptus grandis [rose gum]
gb|AAF79822.1|AC026875_2  T6D22.2                                     41.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AEK98799.1|  translation elongation factor 1 alfa                  41.6    3e-06   Carthamus tinctorius
gb|AGF25313.1|  elongation factor 1-alpha                             41.6    3e-06   x Doritaenopsis hybrid cultivar
gb|AAR82894.1|  elongation factor 1-alpha                             41.6    3e-06   Cichorium intybus [radicchio]
gb|KHG01531.1|  Elongation factor 1-alpha                             41.6    3e-06   Gossypium arboreum [tree cotton]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Prunus mume [ume]
gb|ABA12217.1|  translation elongation factor 1A-1                    41.6    3e-06   Gossypium hirsutum [American cotton]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g           41.6    3e-06   Phaseolus vulgaris [French bean]
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg           41.6    3e-06   Prunus persica
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...  41.6    3e-06   Glycine max [soybeans]
ref|XP_001763201.1|  predicted protein                                41.6    3e-06   
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2  41.6    3e-06   
gb|AEG78681.1|  elongation factor 1 alpha                             41.6    3e-06   Erythroxylum coca [coca]
ref|XP_002892424.1|  T6D22.2                                          41.6    3e-06   
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g           41.6    3e-06   Phaseolus vulgaris [French bean]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2  41.6    3e-06   Eucalyptus grandis [rose gum]
gb|AHZ58493.1|  translation elongation factor alpha                   41.6    3e-06   Syntrichia caninervis
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   
gb|ABA12220.1|  translation elongation factor 1A-4                    41.6    3e-06   Gossypium hirsutum [American cotton]
ref|NP_001290506.1|  elongation factor 1-alpha                        41.6    3e-06   Elaeis guineensis
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Fragaria vesca subsp. vesca
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...  41.6    3e-06   Hordeum vulgare [barley]
ref|XP_001753059.1|  predicted protein                                41.6    3e-06   
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Vitis vinifera
gb|EYU18869.1|  hypothetical protein MIMGU_mgv1a010191mg              41.6    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Tarenaya hassleriana [spider flower]
gb|ABA12221.1|  translation elongation factor 1A-5                    41.6    3e-06   Gossypium hirsutum [American cotton]
gb|ABA12219.1|  translation elongation factor 1A-3                    41.6    3e-06   Gossypium hirsutum [American cotton]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...  41.6    3e-06   Theobroma cacao [chocolate]
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Nicotiana sylvestris
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310        41.6    3e-06   Amborella trichopoda
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512           43.1    3e-06   Selaginella moellendorffii
emb|CAA65798.1|  EF1-alpha                                            41.6    3e-06   Forsythia x intermedia [cultivated forsythia]
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717           43.1    3e-06   Selaginella moellendorffii
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...  41.6    3e-06   Theobroma cacao [chocolate]
gb|KHG26926.1|  Elongation factor 1-alpha                             41.6    3e-06   Gossypium arboreum [tree cotton]
gb|ABA12223.1|  translation elongation factor 1A-7                    41.6    3e-06   Gossypium hirsutum [American cotton]
gb|KHG28979.1|  Elongation factor 1-alpha                             41.6    3e-06   Gossypium arboreum [tree cotton]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Eucalyptus grandis [rose gum]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1  41.6    3e-06   
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                 41.6    3e-06   Lilium longiflorum [Easter lily]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Fragaria vesca subsp. vesca
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg           41.6    3e-06   Prunus persica
dbj|BAM13874.1|  elongation factor 1 alpha                            41.6    3e-06   Symplocarpus renifolius
ref|XP_001766482.1|  predicted protein                                41.6    3e-06   
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Sesamum indicum [beniseed]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852           43.1    3e-06   Selaginella moellendorffii
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Elaeis guineensis
gb|AGC94754.1|  elongation factor 1 alpha                             41.6    3e-06   Euphorbia lathyris
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Phoenix dactylifera
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Malus domestica [apple tree]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Cicer arietinum [garbanzo]
gb|AFP44110.1|  elongation factor 1-alpha                             41.6    3e-06   Lycoris longituba
ref|XP_003604587.1|  Elongation factor 1-alpha                        41.6    3e-06   Medicago truncatula
gb|EPS66340.1|  elongation factor 1-alpha                             41.6    3e-06   Genlisea aurea
gb|ABA12225.1|  translation elongation factor 1A-9                    41.6    3e-06   Gossypium hirsutum [American cotton]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Nicotiana sylvestris
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                41.6    3e-06   Citrus sinensis [apfelsine]
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Solanum lycopersicum
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Nicotiana sylvestris
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Vitis vinifera
gb|ABD66517.1|  EF-1 alpha                                            41.6    3e-06   Gymnadenia conopsea
ref|XP_002528028.1|  elongation factor 1-alpha, putative              41.6    3e-06   
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg           41.6    3e-06   Prunus persica
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...  41.6    3e-06   Daucus carota [carrots]
gb|AEQ75495.1|  elongation factor 1-alpha                             41.6    3e-06   Rosa multiflora [Japanese rose]
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693           43.1    3e-06   Selaginella moellendorffii
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Tarenaya hassleriana [spider flower]
gb|KHG23927.1|  Elongation factor 1-alpha                             41.6    3e-06   Gossypium arboreum [tree cotton]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha             41.6    3e-06   Prunus mume [ume]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                 41.6    3e-06   Lilium longiflorum [Easter lily]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Solanum tuberosum [potatoes]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg           41.6    3e-06   Citrus clementina [clementine]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...  41.6    3e-06   Nicotiana tabacum [American tobacco]
gb|AEN79476.1|  elongation factor 1-alpha                             41.6    3e-06   Ziziphus jujuba [Chinese jujube]
ref|NP_001280807.1|  elongation factor 1-alpha-like                   41.6    3e-06   Malus domestica [apple tree]
gb|EPS66069.1|  elongation factor 1-alpha                             41.6    3e-06   Genlisea aurea
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1  41.6    3e-06   Eucalyptus grandis [rose gum]
dbj|BAA34348.1|  elongation factor-1 alpha                            41.6    3e-06   Nicotiana paniculata
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...  41.6    3e-06   Theobroma cacao [chocolate]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like        41.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGY80449.1|  elongation factor 1-alpha                             41.6    3e-06   Dendrocalamus latiflorus [sweet bamboo]
gb|ACS68200.1|  elongation factor 1 alpha                             41.2    3e-06   Brassica napus [oilseed rape]
gb|AES62210.2|  GTP-binding elongation factor Tu family protein       41.2    3e-06   Medicago truncatula
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA12224.1|  translation elongation factor 1A-8                    41.2    3e-06   Gossypium hirsutum [American cotton]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...  41.2    3e-06   Manihot esculenta [manioc]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein  41.2    3e-06   
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1           41.2    3e-06   Brassica rapa
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...  41.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...  41.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein           41.2    3e-06   Solanum tuberosum [potatoes]
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Cicer arietinum [garbanzo]
gb|KHN42761.1|  Elongation factor 1-alpha                             41.2    3e-06   Glycine soja [wild soybean]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Phoenix dactylifera
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Malus domestica [apple tree]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Prunus mume [ume]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                 41.2    3e-06   Lilium longiflorum [Easter lily]
gb|EMT12343.1|  Elongation factor 1-alpha                             41.2    3e-06   
gb|EMS49772.1|  Elongation factor 1-alpha                             41.2    3e-06   Triticum urartu
dbj|BAM13877.1|  elongation factor 1 alpha                            41.2    3e-06   Arum maculatum [cuckoo-pint]
gb|AEE98364.1|  elongation factor 1-alpha                             41.2    3e-06   Deschampsia antarctica
gb|AAL69396.1|  elongation factor 1-alpha                             41.2    3e-06   Elaeis oleifera
gb|ABF00115.1|  elongation factor 1-alpha                             41.2    3e-06   Litchi chinensis [litchi]
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                   41.2    3e-06   Eucalyptus grandis [rose gum]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Sesamum indicum [beniseed]
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2  41.2    3e-06   
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1  41.2    3e-06   Sesamum indicum [beniseed]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_002518073.1|  elongation factor 1-alpha, putative              41.2    3e-06   Ricinus communis
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg              41.2    3e-06   Erythranthe guttata [common monkey flower]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                      41.2    3e-06   Bruguiera sexangula
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha      41.2    3e-06   Hevea brasiliensis [jebe]
gb|AAL32631.1|  putative elongation factor 1-a                        41.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Eucalyptus grandis [rose gum]
ref|XP_003604823.1|  Elongation factor 1-alpha                        41.2    3e-06   
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Elaeis guineensis
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Elaeis guineensis
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Nicotiana tomentosiformis
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Nicotiana tomentosiformis
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Nicotiana tomentosiformis
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Phoenix dactylifera
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   
ref|NP_001151074.1|  elongation factor 1-alpha                        41.2    3e-06   
gb|AAX54511.1|  elongation factor 1 alpha                             41.2    3e-06   Actinidia deliciosa [Chinese gooseberry]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg           41.2    3e-06   Prunus persica
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha             41.2    3e-06   Vitis vinifera
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like        41.2    3e-06   Phoenix dactylifera
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg           41.2    4e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha             41.2    4e-06   Pyrus x bretschneideri [bai li]
gb|AIM48895.1|  elongation factor 1-alpha                             41.2    4e-06   Cinnamomum camphora
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like      41.2    4e-06   Brassica rapa
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like      41.2    4e-06   Brassica rapa
ref|NP_200847.1|  elongation factor 1-alpha 4                         41.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha      41.2    4e-06   Hevea brasiliensis [jebe]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg           41.2    4e-06   Capsella rubella
gb|AGI15328.1|  elongation factor 1                                   41.2    4e-06   Aegiceras corniculatum
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein       41.2    4e-06   
gb|ACI96243.1|  elongation factor 1-alpha                             41.2    4e-06   
gb|ABB86283.1|  elongation factor-1 alpha-like                        41.2    4e-06   
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...  41.2    4e-06   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg              41.2    4e-06   
emb|CAA34456.1|  elongation factor 1-alpha                            41.2    4e-06   
gb|AAL57653.1|  At1g07930/T6D22_3                                     41.2    4e-06   
gb|ABB72813.1|  elongation factor 1-alpha-like protein                41.2    4e-06   
dbj|BAC23049.1|  Elongation factor 1-alpha                            41.2    4e-06   
gb|AAL79775.1|  elongation factor 1 alpha                             41.2    4e-06   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein       41.2    4e-06   
gb|AIX10769.1|  elongation factor 1 alpha                             41.2    4e-06   
dbj|BAH19898.1|  AT1G07930                                            41.2    4e-06   
ref|NP_001234035.1|  elongation factor 1-alpha                        41.2    4e-06   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein       41.2    4e-06   
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420        41.2    4e-06   
emb|CDY22710.1|  BnaC08g43440D                                        41.2    4e-06   
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like        41.2    4e-06   
ref|XP_003588821.1|  Elongation factor 1-alpha                        41.2    4e-06   
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like        41.2    4e-06   
emb|CDO98621.1|  unnamed protein product                              40.8    5e-06   
ref|NP_001275481.1|  elongation factor 1-alpha-like                   40.8    5e-06   
emb|CDY61938.1|  BnaCnng38780D                                        41.2    5e-06   
gb|ABA12222.1|  translation elongation factor 1A-6                    40.8    5e-06   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                      40.4    6e-06   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like        40.4    6e-06   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha             40.4    6e-06   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                      40.4    6e-06   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like        40.4    6e-06   
gb|AFW77598.1|  putative translation elongation factor Tu family ...  41.6    7e-06   
ref|XP_001763198.1|  predicted protein                                40.4    7e-06   
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                           41.2    9e-06   
ref|XP_009793886.1|  PREDICTED: elongation factor 1-alpha-like        43.5    1e-05   
gb|AFW76433.1|  putative translation elongation factor Tu family ...  40.8    1e-05   
gb|EAY88762.1|  hypothetical protein OsI_10238                        40.8    1e-05   
ref|XP_005650451.1|  translation elongation factor                    40.8    1e-05   
ref|XP_004172806.1|  PREDICTED: elongation factor 1-alpha-like        40.4    1e-05   
dbj|BAJ91931.1|  predicted protein                                    40.0    1e-05   
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like        39.3    1e-05   
gb|KCW51623.1|  hypothetical protein EUGRSUZ_J01112                   39.3    1e-05   
gb|KJB63203.1|  hypothetical protein B456_009G4199002                 40.4    2e-05   
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha             39.3    2e-05   
dbj|BAL14665.1|  elongation factor 1-alpha                            39.3    2e-05   
gb|AID52924.1|  elongation factor 1-alpha                             39.3    2e-05   
gb|AHE76183.1|  elongation factor 1-alpha                             38.9    2e-05   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like      38.9    2e-05   
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha             38.9    2e-05   
gb|ABV26710.1|  elongation factor 1 alpha                             38.9    2e-05   
gb|AGI78242.1|  elongation factor 1 alpha                             40.8    2e-05   
ref|NP_001077483.1|  elongation factor 1-alpha 2                      38.9    2e-05   
gb|AAN77897.1|  elongation factor 1 alpha                             38.9    2e-05   
gb|AGJ50595.1|  EF1alpha                                              38.9    2e-05   
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like        38.9    2e-05   
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...  38.9    2e-05   
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like        38.9    2e-05   
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...  38.9    2e-05   
gb|AFO67216.1|  putative elongation factor 1-alpha                    38.9    2e-05   
dbj|BAG80668.1|  elongation factor 1 alpha                            38.9    2e-05   
emb|CDX95108.1|  BnaC05g05630D                                        38.9    2e-05   
gb|AHB86963.1|  elongation factor 1-alpha                             38.9    2e-05   
gb|ADD71925.1|  translation elongation factor 1 alpha                 38.9    2e-05   
ref|XP_006307728.1|  hypothetical protein CARUB_v100092940mg          40.4    2e-05   
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...  38.9    2e-05   
ref|NP_001032107.1|  elongation factor 1-alpha 4                      38.9    2e-05   
gb|ABB16977.1|  elongation factor 1-alpha-like protein                38.9    2e-05   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...  41.6    2e-05   
gb|AGV54654.1|  elongation factor 1-alpha                             38.9    2e-05   
ref|XP_003591963.1|  Elongation factor 1-alpha                        40.0    2e-05   
gb|AFW90638.1|  elongation factor 1-alpha-like protein                38.9    2e-05   
gb|KJB73625.1|  hypothetical protein B456_011G2412001                 40.0    2e-05   
ref|XP_002538495.1|  elongation factor 1-alpha, putative              40.0    2e-05   
gb|AGH32904.1|  translation elongation factor 1-alpha                 40.0    2e-05   
gb|ABR13297.1|  putative elongation factor 1-alpha                    40.0    2e-05   
gb|KJB73629.1|  hypothetical protein B456_011G2414002                 40.0    2e-05   
ref|XP_006307727.1|  hypothetical protein CARUB_v100096371mg          40.0    2e-05   
emb|CBI31496.3|  unnamed protein product                              39.7    2e-05   
emb|CDX93604.1|  BnaA06g04440D                                        38.9    2e-05   
ref|XP_002488881.1|  hypothetical protein SORBIDRAFT_2635s002010      39.7    2e-05   
emb|CDX88757.1|  BnaA03g08920D                                        38.9    2e-05   
emb|CDY09214.1|  BnaA02g06400D                                        39.7    2e-05   
emb|CDY67375.1|  BnaC03g71520D                                        38.9    2e-05   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha     41.2    2e-05   
emb|CDY06289.1|  BnaA09g49140D                                        38.9    2e-05   
gb|ACN59918.1|  translation elongation factor-1 alpha                 40.8    3e-05   
gb|AFK35720.1|  unknown                                               39.3    3e-05   
gb|AAI30145.1|  LOC100037028 protein                                  45.4    3e-05   
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed        38.1    3e-05   
gb|AGD99674.1|  eukaryotic elongation factor 1A                       40.4    4e-05   
gb|AAK82537.1|  At1g07930/T6D22_3                                     38.9    4e-05   
gb|AAU95355.1|  translation elongation factor 1 alpha                 46.2    4e-05   
ref|WP_041515120.1|  elongation factor 1-alpha                        40.8    5e-05   
ref|NP_001104938.1|  elongation factor 1 alpha                        38.5    6e-05   
gb|AEI52547.1|  elongation factor 1-alpha                             37.0    1e-04   
ref|XP_009760439.1|  PREDICTED: elongation factor 1-alpha-like        42.0    2e-04   
ref|XP_009792731.1|  PREDICTED: elongation factor 1-alpha-like        42.0    2e-04   
ref|XP_004425774.1|  PREDICTED: elongation factor 1-alpha, somati...  40.4    2e-04   
dbj|BAF02151.1|  elongation factor 1-alpha                            35.8    2e-04   
ref|XP_002676926.1|  predicted protein                                40.4    2e-04   
ref|XP_003785427.1|  PREDICTED: elongation factor 1-alpha 1-like      40.0    2e-04   
ref|XP_002670662.1|  predicted protein                                40.0    2e-04   
gb|KEH40223.1|  GTP-binding elongation factor Tu family protein       37.7    2e-04   
gb|AHL28542.1|  elongation factor 1-alpha                             35.8    2e-04   
ref|XP_005965574.1|  PREDICTED: elongation factor 1-alpha 1-like      42.4    2e-04   
ref|XP_006762761.1|  PREDICTED: elongation factor 1-alpha 1-like      39.7    2e-04   
ref|XP_008704500.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  40.8    3e-04   
ref|XP_007083758.1|  PREDICTED: elongation factor 1-alpha, somati...  40.4    3e-04   
gb|ABE01138.1|  elongation factor 1-alpha                             35.8    3e-04   
gb|KFO37506.1|  Potassium voltage-gated channel subfamily KQT mem...  41.6    4e-04   
gb|ELV11338.1|  Potassium voltage-gated channel subfamily KQT mem...  41.6    4e-04   
gb|ABR13300.1|  putative elongation factor eEF1-alpha chain A4        40.0    4e-04   
gb|ABO69553.1|  elongation factor 1-alpha                             41.2    4e-04   
gb|AAH71727.1|  Eukaryotic translation elongation factor 1 alpha 1    41.2    4e-04   
ref|XP_008072939.1|  PREDICTED: elongation factor 1-alpha 2           41.2    4e-04   
ref|XP_004716094.1|  PREDICTED: elongation factor 1-alpha 2 isofo...  41.2    5e-04   
ref|XP_011279138.1|  PREDICTED: elongation factor 1-alpha 2           41.2    5e-04   
ref|XP_010952642.1|  PREDICTED: elongation factor 1-alpha 2           41.2    5e-04   
ref|XP_003482639.1|  PREDICTED: elongation factor 1-alpha, oocyte...  41.2    5e-04   
sp|Q2HJN6.1|EF1A3_OSCTI  RecName: Full=Elongation factor 1-alpha ...  43.1    5e-04   
tpg|DAA16277.1|  TPA: EF1a-like protein-like                          41.6    5e-04   
gb|AAY17225.1|  eukaryotic translation elongation factor 1A           43.1    5e-04   
ref|XP_006899298.1|  PREDICTED: elongation factor 1-alpha 1-like      40.8    5e-04   
ref|XP_004908223.1|  PREDICTED: elongation factor 1-alpha 2           40.8    5e-04   
ref|XP_010636591.1|  PREDICTED: elongation factor 1-alpha 2           40.8    5e-04   
ref|XP_003384809.1|  PREDICTED: elongation factor 1-alpha             40.8    5e-04   
ref|XP_005978307.1|  PREDICTED: elongation factor 1-alpha 1-like      40.8    5e-04   
ref|XP_001489466.1|  PREDICTED: elongation factor 1-alpha 1-like ...  40.8    5e-04   
ref|XP_004062574.1|  PREDICTED: elongation factor 1-alpha 2           40.8    5e-04   
ref|XP_007185479.1|  PREDICTED: elongation factor 1-alpha 2           40.8    5e-04   
ref|XP_005656114.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  40.8    5e-04   
ref|XP_010995318.1|  PREDICTED: elongation factor 1-alpha 2           40.8    5e-04   
ref|XP_007952892.1|  PREDICTED: elongation factor 1-alpha 2           40.8    5e-04   
ref|XP_004876767.1|  PREDICTED: elongation factor 1-alpha 1           40.8    5e-04   
gb|KFP28483.1|  Elongation factor 1-alpha 2                           40.8    5e-04   
ref|XP_007524537.1|  PREDICTED: elongation factor 1-alpha 2-like      41.2    6e-04   
dbj|BAN33726.1|  elongation factor 1alpha                             40.0    6e-04   
ref|XP_006013677.1|  PREDICTED: elongation factor 1-alpha 1           40.8    6e-04   
ref|XP_004360206.1|  elongation factor 1 alpha                        39.3    6e-04   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...  36.6    6e-04   
ref|XP_010786582.1|  PREDICTED: elongation factor 1-alpha 1           40.8    6e-04   
ref|XP_004089101.1|  PREDICTED: elongation factor 1-alpha 1-like      40.8    6e-04   
ref|XP_003129826.1|  PREDICTED: elongation factor 1-alpha, oocyte...  40.8    6e-04   
ref|XP_010208031.1|  PREDICTED: elongation factor 1-alpha 2           40.8    6e-04   
ref|XP_009860721.1|  PREDICTED: elongation factor 1-alpha             40.8    6e-04   
gb|EFB29092.1|  hypothetical protein PANDA_004708                     40.8    6e-04   
ref|XP_005363170.1|  PREDICTED: elongation factor 1-alpha 2           40.8    6e-04   
ref|XP_006769626.1|  PREDICTED: elongation factor 1-alpha 2           40.8    6e-04   
ref|XP_005941029.1|  PREDICTED: elongation factor 1-alpha-like        40.8    6e-04   
ref|XP_007104009.1|  PREDICTED: elongation factor 1-alpha 2           40.8    6e-04   
ref|XP_006737647.1|  PREDICTED: elongation factor 1-alpha-like        40.8    6e-04   
ref|XP_003284439.1|  elongation factor 1 alpha                        39.3    6e-04   
ref|XP_005965035.1|  PREDICTED: putative elongation factor 1-alph...  40.8    6e-04   
sp|Q8LPC4.1|EF1A_PYRYE  RecName: Full=Elongation factor 1-alpha; ...  40.8    6e-04   
gb|AAH71619.1|  EEF1A1 protein                                        40.8    6e-04   
ref|XP_008960001.1|  PREDICTED: elongation factor 1-alpha 1 isofo...  40.8    6e-04   
ref|XP_005993540.1|  PREDICTED: elongation factor 1-alpha 2           40.8    6e-04   
ref|XP_006729120.1|  PREDICTED: elongation factor 1-alpha 1-like      40.8    6e-04   
ref|XP_006638682.1|  PREDICTED: elongation factor 1-alpha 1-like      40.8    6e-04   
ref|XP_003926376.1|  PREDICTED: elongation factor 1-alpha 1           40.8    6e-04   
dbj|BAD96243.1|  eukaryotic translation elongation factor 1 alpha...  40.8    6e-04   
ref|XP_003794755.1|  PREDICTED: elongation factor 1-alpha 1-like      40.0    6e-04   
dbj|BAG60202.1|  unnamed protein product                              40.8    6e-04   
ref|XP_007608762.1|  PREDICTED: elongation factor 1-alpha 2 isofo...  40.8    6e-04   
ref|XP_010990993.1|  PREDICTED: elongation factor 1-alpha 1           40.8    6e-04   
ref|XP_010849567.1|  PREDICTED: elongation factor 1-alpha 1           40.8    6e-04   
ref|XP_008535541.1|  PREDICTED: elongation factor 1-alpha 1           40.8    6e-04   
ref|XP_006927119.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  40.8    6e-04   
ref|XP_004572773.1|  PREDICTED: elongation factor 1-alpha-like        40.8    6e-04   
gb|EPQ04746.1|  Elongation factor 1-alpha 1                           40.8    6e-04   
dbj|BAE91795.1|  unnamed protein product                              40.8    6e-04   
ref|XP_002799708.1|  PREDICTED: elongation factor 1-alpha 1-like      40.8    6e-04   
gb|AAH04005.1|  Eukaryotic translation elongation factor 1 alpha 1    40.8    6e-04   
tpg|DAA16240.1|  TPA: eukaryotic translation elongation factor 1 ...  40.8    6e-04   
emb|CAA31957.1|  unnamed protein product                              40.8    6e-04   
emb|CDP20796.1|  unnamed protein product                              37.4    6e-04   
ref|XP_003781883.1|  PREDICTED: elongation factor 1-alpha 1-like      38.1    7e-04   
gb|AAX09604.1|  elongation factor 1 alpha                             38.9    7e-04   
gb|AAX36933.1|  eukaryotic translation elongation factor 1 alpha 1    40.4    7e-04   
ref|XP_002913317.1|  PREDICTED: elongation factor 1-alpha, somati...  40.4    7e-04   
ref|XP_004004140.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
dbj|BAK63962.1|  elongation factor 1-alpha 1                          40.4    7e-04   
ref|XP_001365660.1|  PREDICTED: elongation factor 1-alpha 1 isofo...  40.4    7e-04   
ref|NP_001075250.1|  elongation factor 1-alpha 1                      40.4    7e-04   
dbj|BAD96702.1|  eukaryotic translation elongation factor 1 alpha...  40.4    7e-04   
dbj|BAD96766.1|  eukaryotic translation elongation factor 1 alpha...  40.4    7e-04   
dbj|BAD96750.1|  eukaryotic translation elongation factor 1 alpha...  40.4    7e-04   
dbj|BAD96235.1|  eukaryotic translation elongation factor 1 alpha...  40.4    7e-04   
dbj|BAD96271.1|  eukaryotic translation elongation factor 1 alpha...  40.4    7e-04   
emb|CAI29710.1|  hypothetical protein                                 40.4    7e-04   
gb|EFB27137.1|  hypothetical protein PANDA_001097                     40.4    7e-04   
ref|XP_007515839.1|  PREDICTED: elongation factor 1-alpha 1 isofo...  40.4    7e-04   
ref|XP_010855612.1|  PREDICTED: elongation factor 1-alpha 1-like      40.4    7e-04   
ref|XP_006922187.1|  PREDICTED: elongation factor 1-alpha 2           40.4    7e-04   
gb|AAI05316.1|  EEF1A1 protein                                        40.4    7e-04   
emb|CAA34756.1|  unnamed protein product                              40.4    7e-04   
ref|NP_001393.1|  elongation factor 1-alpha 1                         40.4    7e-04   
ref|XP_006168380.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
ref|NP_001126911.1|  elongation factor 1-alpha 1                      40.4    7e-04   
ref|XP_003769255.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
ref|XP_009449807.1|  PREDICTED: elongation factor 1-alpha 1 isofo...  40.4    7e-04   
ref|XP_006021708.1|  PREDICTED: elongation factor 1-alpha 2 isofo...  40.4    7e-04   
gb|AAH71841.1|  Eukaryotic translation elongation factor 1 alpha 1    40.4    7e-04   
ref|XP_006089394.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
ref|XP_005739860.1|  PREDICTED: elongation factor 1-alpha-like        40.4    7e-04   
ref|XP_007061563.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
ref|XP_005905029.1|  PREDICTED: elongation factor 1-alpha 1-like      40.4    7e-04   
ref|NP_787032.1|  elongation factor 1-alpha 1                         40.4    7e-04   
ref|XP_010347515.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
ref|XP_001138897.2|  PREDICTED: putative elongation factor 1-alph...  40.4    7e-04   
sp|Q5VTE0.1|EF1A3_HUMAN  RecName: Full=Putative elongation factor...  40.4    7e-04   
ref|XP_001107326.1|  PREDICTED: elongation factor 1-alpha 1-like ...  40.4    7e-04   
ref|XP_003415685.1|  PREDICTED: elongation factor 1-alpha, oocyte...  40.4    7e-04   
ref|XP_001107195.1|  PREDICTED: elongation factor 1-alpha 1-like ...  40.4    7e-04   
gb|EDL77724.1|  rCG25445, isoform CRA_e                               40.4    7e-04   
ref|XP_006020539.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
ref|XP_005347640.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
ref|XP_005073762.1|  PREDICTED: elongation factor 1-alpha 1           40.4    7e-04   
dbj|BAE39863.1|  unnamed protein product                              40.4    7e-04   
gb|AAG44730.1|AF267861_1  EF1a-like protein                           40.4    7e-04   
gb|AAG28981.1|AF157231_1  translation elongation factor 1-alpha       42.0    7e-04   
ref|XP_005802895.1|  PREDICTED: elongation factor 1-alpha-like        40.4    7e-04   
ref|XP_007515831.1|  PREDICTED: elongation factor 1-alpha 1 isofo...  40.4    7e-04   



>ref|XP_011031813.1| PREDICTED: LOW QUALITY PROTEIN: HBS1-like protein [Populus euphratica]
Length=1057

 Score = 44.7 bits (104),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  612  EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  642


 Score = 35.8 bits (81),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  644  KRVIERFEKEAAEMNKRSFKYAWV  667


 Score = 39.7 bits (91),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 22/31 (71%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGH D GK T TG LIY LGGI
Sbjct  137  EKSHINIVVIGHDDPGKSTTTGHLIYKLGGI  167


 Score = 35.8 bits (81),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  169  KRVIERFEKEAAEMNKRSFKYAWV  192



>ref|XP_002311107.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93463.1| unknown [Populus trichocarpa]
 gb|EEE88474.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002312029.1| ADR12-2 family protein [Populus trichocarpa]
 gb|EEE89396.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006378755.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
 gb|ERP56552.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAK08819.1| elongation factor 1-alpha [Chara braunii]
Length=448

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002311106.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93897.1| unknown [Populus trichocarpa]
 gb|EEE88473.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006387491.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 ref|XP_006387492.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ABK94386.1| unknown [Populus trichocarpa]
 gb|ERP46405.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ERP46406.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
Length=449

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAK08744.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08745.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08746.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08747.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08748.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08749.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08750.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08751.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08752.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08753.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08754.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08755.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08756.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08757.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08758.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08759.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08760.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08761.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08762.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08763.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08764.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08765.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08766.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08767.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08768.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08769.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08770.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08771.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08772.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08773.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08774.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08775.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08776.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08777.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08778.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08779.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08780.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08781.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08782.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08783.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08784.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08785.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08786.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08787.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08788.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08789.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08790.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08791.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08792.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08793.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08794.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08795.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08796.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08797.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08798.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08799.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08800.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08801.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08802.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08803.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08804.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08805.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08808.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08809.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08810.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08811.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08812.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08814.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08815.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08816.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08817.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08841.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08842.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08843.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08844.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08845.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08846.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08847.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08848.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08849.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08807.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08813.1| elongation factor 1-alpha [Chara braunii]
 dbj|BAK08806.1| elongation factor 1-alpha [Chara braunii]
Length=448

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score = 43.9 bits (102),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001104939.1| elongation factor alpha6 [Zea mays]
 gb|AAF42980.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score = 44.3 bits (103),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.4 bits (80),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHA  171
            KRVI+RFEKEAA MN + F++A
Sbjct  36   KRVIERFEKEAAEMNKRSFKYA  57



>dbj|BAK08818.1| elongation factor 1-alpha [Chara braunii]
Length=448

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 1/29 (3%)
 Frame = +2

Query  17   HSHIIVAIGHVDSGKPTYTGLLIYMLGGI  103
            H HI+V IGHVDSGK T TG LIY LGGI
Sbjct  7    HIHIVV-IGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001105935.1| elongation factor alpha8 [Zea mays]
 gb|AAF42982.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score = 43.9 bits (102),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.4 bits (80),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAADMNKRSFKYAWV  59



>gb|KJB76560.1| hypothetical protein B456_012G094600 [Gossypium raimondii]
Length=425

 Score = 43.1 bits (100),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 36.2 bits (82),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNNRSFKYAWV  59



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001105934.1| elongation factor alpha7 [Zea mays]
 gb|AAF42981.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABR17675.1| unknown [Picea sitchensis]
Length=448

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ACN40740.1| unknown [Picea sitchensis]
 gb|ACN41072.1| unknown [Picea sitchensis]
Length=448

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABF94275.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 37.7 bits (86),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVIDRFEKEAA MN + F++A V
Sbjct  36   KRVIDRFEKEAAEMNKRSFKYAWV  59



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002315287.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 ref|XP_002315285.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 ref|XP_002316351.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|ABK95341.1| unknown [Populus trichocarpa]
 gb|ABK95876.1| unknown [Populus trichocarpa]
 gb|EEF01458.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|EEF01456.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 gb|EEF02522.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
Length=449

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ACN41180.1| unknown [Picea sitchensis]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AFQ37422.1| translation elongation factor-1 alpha 1 [Larix kaempferi]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABK25072.1| unknown [Picea sitchensis]
 gb|ABR17295.1| unknown [Picea sitchensis]
 gb|ABR17358.1| unknown [Picea sitchensis]
 gb|ABR18377.1| unknown [Picea sitchensis]
 gb|ACN40111.1| unknown [Picea sitchensis]
 gb|ACN40613.1| unknown [Picea sitchensis]
 gb|ACN40633.1| unknown [Picea sitchensis]
 gb|ACN40825.1| unknown [Picea sitchensis]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EMT09703.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=740

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  297  EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  327


 Score = 35.4 bits (80),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  329  KRVIERFEKEAAEMNKRSFKYAWV  352



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABK24265.1| unknown [Picea sitchensis]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AIZ74328.1| translation elongation factor 1-alpha [Pinus massoniana]
Length=448

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AER42621.1| elongation factor 1 alpha [Hordeum brevisubulatum]
Length=448

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + SHI +V IGHVDSGK T TG LIY LGGI
Sbjct  4    EKSHINLVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>emb|CAC27139.1| translation elongation factor-1 alpha [Picea abies]
Length=444

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  1    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  31


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  33   KRVIERFEKEAAEMNKRSFKYAWV  56



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABK24843.1| unknown [Picea sitchensis]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKAHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ACN40081.1| unknown [Picea sitchensis]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AFQ37423.1| translation elongation factor-1 alpha 2 [Larix kaempferi]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004143833.1| PREDICTED: uncharacterized protein LOC101220517 [Cucumis sativus]
Length=933

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  488  EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  518


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  520  KRVIERFEKEAAEMNKRSFKYAWV  543


 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EMS59091.1| Elongation factor 1-alpha [Triticum urartu]
Length=496

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  53   EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  83


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  85   KRVIERFEKEAAEMNKRSFKYAWV  108



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AFW87115.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW87116.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW87117.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
 gb|AFW87118.1| putative translation elongation factor Tu family protein isoform 
4 [Zea mays]
 gb|AFW87119.1| putative translation elongation factor Tu family protein isoform 
5 [Zea mays]
Length=255

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score = 42.7 bits (99),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007027265.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY07767.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=566

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>emb|CDP07148.1| unnamed protein product [Coffea canephora]
Length=413

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>emb|CAA68246.1| factor 1-alpha [Forsythia x intermedia]
Length=236

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  1    IVVIGHVDSGKSTTTGHLIYKLGGI  25


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  27   KRVIERFEKEAAEMNKRSFKYAWV  50



>gb|ABC74971.1| elongation factor 1 alpha [Malus domestica]
Length=234

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  1    IVVIGHVDSGKSTTTGHLIYKLGGI  25


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  27   KRVIERFEKEAAEMNKRSFKYAWV  50



>gb|ABX82323.1| elongation factor 1 subunit alpha [Cenchrus americanus]
Length=219

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV +GHVDSGK T TG LIY LGGI
Sbjct  1    EKTHINIVVMGHVDSGKSTTTGHLIYKLGGI  31


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  33   KRVIERFEKEAAEMNKRSFKYAWV  56



>gb|ACG70967.1| translation elongation factor 1, partial [Ziziphus jujuba]
Length=227

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAQ15281.1| elongation factor 1 alpha [Pyrus pyrifolia]
Length=235

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  1    IVVIGHVDSGKSTTTGHLIYKLGGI  25


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  27   KRVIERFEKEAAEMNKRSFKYAWV  50



>gb|AAR89627.1| elongation factor 1 alpha [Citrus sinensis]
Length=236

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  1    IVVIGHVDSGKSTTTGHLIYKLGGI  25


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  27   KRVIERFEKEAAEMNKRSFKYAWV  50



>emb|CDY06287.1| BnaA09g49160D [Brassica napus]
Length=227

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.4 bits (80),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARVHQT  186
            KRVI+RFEKEAA MN + F++A    T
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWFETT  62



>gb|AAV71174.1| elongation factor 1-alpha [Lotus corniculatus]
Length=236

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  1    IVVIGHVDSGKSTTTGHLIYKLGGI  25


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  27   KRVIERFEKEAAEMNKRSFKYAWV  50



>ref|XP_003591959.1| Elongation factor 1-alpha [Medicago truncatula]
Length=566

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>emb|CDP08919.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EMS65134.1| Elongation factor 1-alpha [Triticum urartu]
Length=639

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  196  EKTHINIVVIGHVDSGKSTTTGHLIYKLGGI  226


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  228  KRVIERFEKEAAEMNKRSFKYAWV  251



>gb|AAQ15280.1| elongation factor 1 alpha [Pyrus pyrifolia]
Length=236

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  1    IVVIGHVDSGKSTTTGHLIYKLGGI  25


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  27   KRVIERFEKEAAEMNKRSFKYAWV  50



>ref|XP_002488910.1| hypothetical protein SORBIDRAFT_2002s002020 [Sorghum bicolor]
 gb|EES20394.1| hypothetical protein SORBIDRAFT_2002s002020 [Sorghum bicolor]
Length=202

 Score = 42.7 bits (99),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKTHISIVVIGHVDSGKLTTTGHLIYKLGGI  34


 Score = 35.0 bits (79),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score = 42.0 bits (97),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_003618775.1| Elongation factor 1-alpha [Medicago truncatula]
Length=987

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  547  HINIVVIGHVDSGKSTTTGHLIYKLGGI  574


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  576  KRVIERFEKEAAEMNKRSFKYAWV  599



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_001753167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82208.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_001763194.1| predicted protein [Physcomitrella patens]
 ref|XP_001763195.1| predicted protein [Physcomitrella patens]
 ref|XP_001763196.1| predicted protein [Physcomitrella patens]
 gb|EDQ72071.1| predicted protein [Physcomitrella patens]
 gb|EDQ72072.1| predicted protein [Physcomitrella patens]
 gb|EDQ72073.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_001753181.1| predicted protein [Physcomitrella patens]
 ref|XP_001753188.1| predicted protein [Physcomitrella patens]
 gb|EDQ82222.1| predicted protein [Physcomitrella patens]
 gb|EDQ82229.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AEQ94148.1| elongation factor 1 [Elaeis guineensis]
Length=221

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAF79822.1|AC026875_2 T6D22.2 [Arabidopsis thaliana]
Length=967

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  525  HINIVVIGHVDSGKSTTTGHLIYKLGGI  552


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  554  KRVIERFEKEAAEMNKRSFKYAWV  577



>gb|AEK98799.1| translation elongation factor 1 alfa [Carthamus tinctorius]
Length=248

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AGF25313.1| elongation factor 1-alpha, partial [x Doritaenopsis hybrid cultivar]
Length=206

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  3    IVVIGHVDSGKSTTTGHLIYKLGGI  27


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  29   KRVIERFEKEAAEMNKRSFKYAWV  52



>gb|AAR82894.1| elongation factor 1-alpha [Cichorium intybus]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_001763201.1| predicted protein [Physcomitrella patens]
 gb|EDQ72078.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008349743.1| PREDICTED: elongation factor 1-alpha isoform X2 [Malus domestica]
Length=397

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AEG78681.1| elongation factor 1 alpha [Erythroxylum coca]
Length=211

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002892424.1| T6D22.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68683.1| T6D22.2 [Arabidopsis lyrata subsp. lyrata]
Length=951

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  509  HINIVVIGHVDSGKSTTTGHLIYKLGGI  536


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  538  KRVIERFEKEAAEMNKRSFKYAWV  561



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>sp|P34824.1|EF1A1_HORVU RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Hordeum 
vulgare]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_001753059.1| predicted protein [Physcomitrella patens]
 gb|EDQ82100.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EYU18869.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
 gb|EYU18870.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
Length=319

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002970583.1| hypothetical protein SELMODRAFT_171512 [Selaginella moellendorffii]
 gb|EFJ28713.1| hypothetical protein SELMODRAFT_171512 [Selaginella moellendorffii]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKAHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 34.3 bits (77),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KR I+RFEKEAA MN + F++A V
Sbjct  36   KRTIERFEKEAAEMNKRSFKYAWV  59



>emb|CAA65798.1| EF1-alpha [Forsythia x intermedia]
Length=196

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  1    IVVIGHVDSGKSTTTGHLIYKLGGI  25


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  27   KRVIERFEKEAAEMNKRSFKYAWV  50



>ref|XP_002968422.1| hypothetical protein SELMODRAFT_169717 [Selaginella moellendorffii]
 gb|EFJ30676.1| hypothetical protein SELMODRAFT_169717 [Selaginella moellendorffii]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKAHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 34.3 bits (77),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KR I+RFEKEAA MN + F++A V
Sbjct  36   KRTIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_001766482.1| predicted protein [Physcomitrella patens]
 gb|EDQ68810.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002970579.1| hypothetical protein SELMODRAFT_270852 [Selaginella moellendorffii]
 gb|EFJ28709.1| hypothetical protein SELMODRAFT_270852 [Selaginella moellendorffii]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKAHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 34.3 bits (77),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KR I+RFEKEAA MN + F++A V
Sbjct  36   KRTIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  29   IVAIGHVDSGKPTYTGLLIYMLGGI  103
            IV IGHVDSGK T TG LIY LGGI
Sbjct  10   IVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_003604587.1| Elongation factor 1-alpha [Medicago truncatula]
 gb|AES86784.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABD66517.1| EF-1 alpha [Gymnadenia conopsea]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>sp|P34823.1|EF1A2_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 dbj|BAA02205.1| elongation factor 1-alpha [Daucus carota]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002968419.1| hypothetical protein SELMODRAFT_270693 [Selaginella moellendorffii]
 gb|EFJ30673.1| hypothetical protein SELMODRAFT_270693 [Selaginella moellendorffii]
Length=447

 Score = 43.1 bits (100),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Frame = +2

Query  14   QHSHI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            + +HI IV IGHVDSGK T TG LIY LGGI
Sbjct  4    EKAHINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 34.3 bits (77),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KR I+RFEKEAA MN + F++A V
Sbjct  36   KRTIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score = 41.6 bits (96),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EMT12343.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT14897.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EMS49772.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AEE98364.1| elongation factor 1-alpha [Deschampsia antarctica]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HISIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = +2

Query  23   HI-IVAIGHVDSGKPTYTGLLIYMLGGI  103
            HI IV IGHVDSGK T TG LIY LGGI
Sbjct  7    HINIVVIGHVDSGKSTTTGHLIYKLGGI  34


 Score = 35.8 bits (81),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  106  KRVIDRFEKEAALMNTKLFQHARV  177
            KRVI+RFEKEAA MN + F++A V
Sbjct  36   KRVIERFEKEAAEMNKRSFKYAWV  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570351139820