BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN011G06

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN71209.1|  hypothetical protein VITISV_030057                     144   1e-40   Vitis vinifera
emb|CDP07966.1|  unnamed protein product                                151   1e-39   Coffea canephora [robusta coffee]
ref|XP_009801460.1|  PREDICTED: pentatricopeptide repeat-containi...    148   2e-38   Nicotiana sylvestris
ref|XP_009601923.1|  PREDICTED: pentatricopeptide repeat-containi...    145   1e-37   Nicotiana tomentosiformis
dbj|BAD95045.1|  putative protein                                       136   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004237182.2|  PREDICTED: pentatricopeptide repeat-containi...    145   3e-37   Solanum lycopersicum
emb|CBI24106.3|  unnamed protein product                                144   4e-37   Vitis vinifera
emb|CBI27495.3|  unnamed protein product                                143   5e-37   Vitis vinifera
ref|XP_002269531.1|  PREDICTED: pentatricopeptide repeat-containi...    144   6e-37   Vitis vinifera
ref|XP_002273494.2|  PREDICTED: pentatricopeptide repeat-containi...    144   7e-37   Vitis vinifera
gb|ABK95746.1|  unknown                                                 136   7e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002521865.1|  pentatricopeptide repeat-containing protein,...    142   8e-37   
ref|XP_006420692.1|  hypothetical protein CICLE_v10004581mg             140   7e-36   Citrus clementina [clementine]
gb|KDP38220.1|  hypothetical protein JCGZ_04863                         138   2e-35   Jatropha curcas
gb|KDO57832.1|  hypothetical protein CISIN_1g007461mg                   139   3e-35   Citrus sinensis [apfelsine]
ref|XP_006470889.1|  PREDICTED: pentatricopeptide repeat-containi...    139   3e-35   Citrus sinensis [apfelsine]
ref|XP_011021682.1|  PREDICTED: pentatricopeptide repeat-containi...    137   5e-35   Populus euphratica
ref|XP_002871585.1|  pentatricopeptide repeat-containing protein        137   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_011090005.1|  PREDICTED: pentatricopeptide repeat-containi...    137   1e-34   Sesamum indicum [beniseed]
ref|XP_010270795.1|  PREDICTED: pentatricopeptide repeat-containi...    137   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_007015128.1|  Pentatricopeptide repeat superfamily protein...    137   1e-34   
ref|XP_011021681.1|  PREDICTED: pentatricopeptide repeat-containi...    137   1e-34   Populus euphratica
ref|XP_002314741.2|  hypothetical protein POPTR_0010s10900g             137   2e-34   
emb|CDX91096.1|  BnaC02g05010D                                          136   2e-34   
ref|XP_009125945.1|  PREDICTED: pentatricopeptide repeat-containi...    136   3e-34   Brassica rapa
gb|KFK25604.1|  hypothetical protein AALP_AA8G136200                    136   3e-34   Arabis alpina [alpine rockcress]
ref|XP_003555735.1|  PREDICTED: pentatricopeptide repeat-containi...    136   3e-34   Glycine max [soybeans]
ref|NP_196881.2|  pentatricopeptide repeat-containing protein           135   5e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10598.1|  unnamed protein product                                135   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492155.1|  PREDICTED: pentatricopeptide repeat-containi...    135   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008778816.1|  PREDICTED: pentatricopeptide repeat-containi...    135   7e-34   Phoenix dactylifera
gb|KHN38588.1|  Pentatricopeptide repeat-containing protein, chlo...    135   7e-34   Glycine soja [wild soybean]
ref|XP_003529243.2|  PREDICTED: pentatricopeptide repeat-containi...    135   8e-34   Glycine max [soybeans]
gb|KJB35742.1|  hypothetical protein B456_006G126500                    134   1e-33   Gossypium raimondii
ref|XP_006289562.1|  hypothetical protein CARUB_v10003108mg             135   1e-33   Capsella rubella
gb|KJB35743.1|  hypothetical protein B456_006G126500                    134   1e-33   Gossypium raimondii
ref|XP_010043883.1|  PREDICTED: pentatricopeptide repeat-containi...    134   2e-33   Eucalyptus grandis [rose gum]
ref|XP_004151188.1|  PREDICTED: pentatricopeptide repeat-containi...    133   3e-33   Cucumis sativus [cucumbers]
ref|XP_008465506.1|  PREDICTED: pentatricopeptide repeat-containi...    133   3e-33   Cucumis melo [Oriental melon]
ref|XP_004172063.1|  PREDICTED: pentatricopeptide repeat-containi...    133   3e-33   
ref|XP_010547300.1|  PREDICTED: pentatricopeptide repeat-containi...    133   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_010453475.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    131   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006399876.1|  hypothetical protein EUTSA_v10016019mg             131   2e-32   Eutrema salsugineum [saltwater cress]
gb|KHN48767.1|  Pentatricopeptide repeat-containing protein, chlo...    125   6e-32   Glycine soja [wild soybean]
ref|XP_010668078.1|  PREDICTED: pentatricopeptide repeat-containi...    129   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006576030.1|  PREDICTED: pentatricopeptide repeat-containi...    124   2e-31   Glycine max [soybeans]
ref|XP_007222296.1|  hypothetical protein PRUPE_ppa003348mg             127   7e-31   
ref|XP_007153172.1|  hypothetical protein PHAVU_003G013000g             127   8e-31   Phaseolus vulgaris [French bean]
ref|XP_008220989.1|  PREDICTED: pentatricopeptide repeat-containi...    126   1e-30   Prunus mume [ume]
ref|XP_006853735.1|  hypothetical protein AMTR_s00056p00173630          125   3e-30   Amborella trichopoda
ref|XP_009351650.1|  PREDICTED: pentatricopeptide repeat-containi...    124   5e-30   Pyrus x bretschneideri [bai li]
ref|XP_006420695.1|  hypothetical protein CICLE_v10006779mg             121   2e-29   
gb|EYU36097.1|  hypothetical protein MIMGU_mgv1a020159mg                121   7e-29   Erythranthe guttata [common monkey flower]
ref|XP_009400607.1|  PREDICTED: pentatricopeptide repeat-containi...    120   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004298632.1|  PREDICTED: pentatricopeptide repeat-containi...    120   2e-28   Fragaria vesca subsp. vesca
gb|KEH40726.1|  PPR containing plant-like protein                       119   4e-28   Medicago truncatula
ref|XP_008340510.1|  PREDICTED: pentatricopeptide repeat-containi...    119   7e-28   Malus domestica [apple tree]
ref|XP_004498165.1|  PREDICTED: pentatricopeptide repeat-containi...    117   4e-27   Cicer arietinum [garbanzo]
emb|CCI55317.1|  PH01B001I13.13                                         111   4e-25   Phyllostachys edulis [kikko-chiku]
ref|XP_003580383.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-23   Brachypodium distachyon [annual false brome]
gb|EMT31983.1|  hypothetical protein F775_29312                         105   7e-23   
ref|NP_001174064.1|  Os04g0583150                                       103   2e-22   
gb|EAY95290.1|  hypothetical protein OsI_17116                          103   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002312498.2|  hypothetical protein POPTR_0008s14240g             101   1e-21   
ref|XP_004976594.1|  PREDICTED: pentatricopeptide repeat-containi...    101   2e-21   Setaria italica
ref|XP_011025175.1|  PREDICTED: pentatricopeptide repeat-containi...    101   2e-21   Populus euphratica
ref|NP_001142291.1|  uncharacterized protein LOC100274460             99.4    2e-21   Zea mays [maize]
gb|ACG27989.1|  hypothetical protein                                  99.8    5e-21   Zea mays [maize]
tpg|DAA36322.1|  TPA: hypothetical protein ZEAMMB73_184989            99.8    6e-21   
ref|XP_006652694.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    4e-20   Oryza brachyantha
ref|XP_008350824.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    5e-20   
gb|KDO42183.1|  hypothetical protein CISIN_1g044084mg                 73.6    2e-12   Citrus sinensis [apfelsine]
ref|XP_008778815.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    3e-10   
ref|XP_001783392.1|  predicted protein                                53.5    2e-05   



>emb|CAN71209.1| hypothetical protein VITISV_030057 [Vitis vinifera]
Length=109

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVISAYSKA + E+C+++Y +F++NG   DR +AGIMVG+FSK  +VDELVKLLQD+KT
Sbjct  14   TSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVDELVKLLQDMKT  73

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  74   EGTGLDERLYRSALNALRDAGLQMQARWLQESF  106



>emb|CDP07966.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVISAYS+A+E E+C++YYQ F+LNG   DRAMA IMV VFSK+N+ DELVKLLQD+KT
Sbjct  520  TSVISAYSRAREFETCMRYYQKFRLNGGAIDRAMAAIMVAVFSKLNRADELVKLLQDMKT  579

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + TKLD RLYRSALNALRDAGL ++AKWLQESF 
Sbjct  580  EGTKLDVRLYRSALNALRDAGLHVQAKWLQESFG  613



>ref|XP_009801460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana sylvestris]
Length=641

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAYS+A+E + C+ YYQ+F LNG K DRAMAGIMVGVFSKMN+VDEL+ LLQ++K 
Sbjct  546  TSIISAYSRAREFDKCLTYYQEFTLNGGKIDRAMAGIMVGVFSKMNRVDELIGLLQNMKR  605

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  606  EGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  639



>ref|XP_009601923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana tomentosiformis]
Length=619

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I+AYS+A+E + C+ YYQ+F LNG + DRAMAGIMVGVFSKMN+VDEL+ LLQ++K 
Sbjct  524  TSIITAYSRAREFDKCLTYYQEFTLNGGRIDRAMAGIMVGVFSKMNRVDELIGLLQNMKR  583

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  584  EGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  617



>dbj|BAD95045.1| putative protein [Arabidopsis thaliana]
Length=126

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY+++KELE CV+ YQ+F++N  K DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  14   TSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMKV  73

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  74   EGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  109



>ref|XP_004237182.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Solanum lycopersicum]
Length=642

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAYSKA+E + C+ YYQ+F LNG + DRAMAGIMVGVFSKMN+VDEL+ LLQ++K 
Sbjct  547  TSIISAYSKAREFDKCLIYYQEFTLNGGRLDRAMAGIMVGVFSKMNRVDELISLLQNMKR  606

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + TKLD RL +SALN+LRDAGL+I+AKWLQESF 
Sbjct  607  EGTKLDGRLQKSALNSLRDAGLQIQAKWLQESFG  640



>emb|CBI24106.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVISAYSKA + E+C+++Y +F++NG   DR +AGIMVG+FSK  +VDELVKLLQD+KT
Sbjct  432  TSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVDELVKLLQDMKT  491

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  492  EGTGLDERLYRSALNALRDAGLQMQARWLQESF  524



>emb|CBI27495.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVISAYSKA + E+C+++Y +F++NG   DR +AGIMVG+FSK  +VDELVKLLQD+KT
Sbjct  446  TSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVDELVKLLQDMKT  505

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  506  EGTGLDERLYRSALNALRDAGLQMQARWLQESF  538



>ref|XP_002269531.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=603

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVISAYSKA + E+C+++Y +F++NG   DR +AGIMVG+FSK  +VDELVKLLQD+KT
Sbjct  508  TSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVDELVKLLQDMKT  567

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  568  EGTGLDERLYRSALNALRDAGLQMQARWLQESF  600



>ref|XP_002273494.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=609

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVISAYSKA + E+C+++Y +F++NG   DR +AGIMVG+FSK  +VDELVKLLQD+KT
Sbjct  509  TSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVDELVKLLQDMKT  568

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  569  EGTGLDERLYRSALNALRDAGLQMQARWLQESF  601



>gb|ABK95746.1| unknown [Populus trichocarpa]
Length=184

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            +SVISAY+K+KE E CV+YY ++++NG   D AMAGIM GVFSK++++DELVKLL+D+K+
Sbjct  89   SSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRIDELVKLLRDMKS  148

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  149  EGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  181



>ref|XP_002521865.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40501.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=449

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVI+AY+KAKE E+CV+YY +++ NG   D+A+AG+MVGVFSK+ ++DEL+KLLQD+KT
Sbjct  354  TSVIAAYNKAKEFETCVRYYHEYRFNGGVIDKAVAGVMVGVFSKIGRIDELLKLLQDIKT  413

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T+LD RLYRSA NALRDAGL+++AKW+QESF
Sbjct  414  EGTQLDGRLYRSAFNALRDAGLQMQAKWMQESF  446



>ref|XP_006420692.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
 gb|ESR33932.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
Length=603

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VISAY++A+E + CVK+Y +F++NG   DRAMAGIMVGVFSK+++++ELVKLLQD+K+
Sbjct  508  TTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAMAGIMVGVFSKLSQIEELVKLLQDMKS  567

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  568  EGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>gb|KDP38220.1| hypothetical protein JCGZ_04863 [Jatropha curcas]
Length=415

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVISAY+K KE ++CV YY ++++NG   D+AMAGIMVGVFSK+ ++DEL++LL D+K 
Sbjct  317  TSVISAYNKVKEFDTCVSYYHEYRINGGAIDKAMAGIMVGVFSKIGRIDELLRLLHDMKI  376

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T LD RLYRSA NALRDAGL+++AKWLQESF
Sbjct  377  EGTPLDGRLYRSAFNALRDAGLQMQAKWLQESF  409



>gb|KDO57832.1| hypothetical protein CISIN_1g007461mg [Citrus sinensis]
Length=603

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VISAY++A+E + CVK+Y +F++NG   DRA+AGIMVGVFSK+++++ELVKLLQD+K+
Sbjct  508  TTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVGVFSKLSQIEELVKLLQDMKS  567

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  568  EGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>ref|XP_006470889.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Citrus sinensis]
Length=603

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VISAY++A+E + CVK+Y +F++NG   DRA+AGIMVGVFSK+++++ELVKLLQD+K+
Sbjct  508  TTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVGVFSKLSQIEELVKLLQDMKS  567

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  568  EGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>ref|XP_011021682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X2 [Populus euphratica]
Length=413

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            +SVISAY+K+KE E CV+YY ++++NG   D AMAGIM GVFSK++++DELVKLL+D+K+
Sbjct  318  SSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRIDELVKLLRDMKS  377

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  378  EGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  410



>ref|XP_002871585.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47844.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=609

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 6/116 (5%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY++AKELE CV+ YQ+F++N  K DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  497  TSMISAYNRAKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMKV  556

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKPKNIVNTR  348
            + T+LD RLY SALNALRDAGL  + +WLQESF  A       ++  +  N  NTR
Sbjct  557  EGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA------QTSASRYSNTKNTR  606



>ref|XP_011090005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Sesamum indicum]
Length=621

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VISAY++A+E E+CVKYY++FKL G K DRAMAG MV VFSKMN+V+E+++LL+D+K 
Sbjct  526  TTVISAYNRAREFETCVKYYEEFKLTGGKMDRAMAGTMVAVFSKMNRVEEVIELLRDMKL  585

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
              T+LD R YRSA+NALRDAGL+ +A+WLQE+F
Sbjct  586  QGTELDARFYRSAMNALRDAGLQSQARWLQETF  618



>ref|XP_010270795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nelumbo nucifera]
Length=636

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I+AYSKA E E+C+K YQ+F+ NG K DRA+AGIMVGVFSK ++++EL+KLLQD+K 
Sbjct  513  TSLITAYSKAGEFEACIKLYQEFRFNGGKLDRALAGIMVGVFSKSSRINELMKLLQDMKL  572

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + T LD +LYRSALNALRDAGL+++ KW +ESFA
Sbjct  573  EGTGLDVKLYRSALNALRDAGLQVQVKWFEESFA  606



>ref|XP_007015128.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY32747.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=608

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++ISAYS+A+E E C+K YQ+F+LNG   D+AMAGIMVG+FSK +++DELVKLLQD+K 
Sbjct  513  TTIISAYSRAREYEMCLKCYQEFRLNGGLIDKAMAGIMVGIFSKTSRIDELVKLLQDMKA  572

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T+LD RLY SA+NALRDAGLE +AKWLQ++F
Sbjct  573  EGTQLDGRLYHSAMNALRDAGLETQAKWLQKNF  605



>ref|XP_011021681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X1 [Populus euphratica]
Length=613

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            +SVISAY+K+KE E CV+YY ++++NG   D AMAGIM GVFSK++++DELVKLL+D+K+
Sbjct  518  SSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRIDELVKLLRDMKS  577

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  578  EGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  610



>ref|XP_002314741.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
 gb|EEF00912.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
Length=582

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            +SVISAY+K+KE E CV+YY ++++NG   D AMAGIM GVFSK++++DELVKLL+D+K+
Sbjct  487  SSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRIDELVKLLRDMKS  546

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  547  EGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  579



>emb|CDX91096.1| BnaC02g05010D [Brassica napus]
Length=613

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY++AKE E+CV+ Y +F++N  K DRAMAGIMVGVFSK +++DEL++LLQD++ 
Sbjct  497  TSMISAYNRAKEFETCVELYHEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMRV  556

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  557  ERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592



>ref|XP_009125945.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brassica rapa]
 emb|CDX85626.1| BnaA02g01870D [Brassica napus]
Length=613

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY++AKE E+CV+ Y +F++N  K DRAMAGIMVGVFSK +++DEL++LLQD++ 
Sbjct  497  TSMISAYNRAKEFEACVELYHEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMRV  556

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  557  ERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592



>gb|KFK25604.1| hypothetical protein AALP_AA8G136200 [Arabis alpina]
Length=606

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY++AKE E CV+ YQ+F++N  K DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  492  TSMISAYNRAKEFEQCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMKA  551

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  552  ERTKLDVRLYTSALNALRDAGLNSQIRWLQESFDSA  587



>ref|XP_003555735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
 gb|KHM98995.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=609

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I AYSKA E E+CVK++ ++++NG   DRAMAGIMVGVFSK+  VDELVKLLQD+K 
Sbjct  514  TSIIGAYSKAGEFETCVKFFNEYRMNGGLIDRAMAGIMVGVFSKVGLVDELVKLLQDMKA  573

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD+RLY+SA NA +DAGL+I+A+W++ESF V 
Sbjct  574  EGTRLDQRLYQSAWNAFKDAGLQIQARWMKESFLVT  609



>ref|NP_196881.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q66GP4.1|PP379_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU05481.1| At5g13770 [Arabidopsis thaliana]
 gb|AAU95422.1| At5g13770 [Arabidopsis thaliana]
 gb|AED91939.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=609

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY+++KELE CV+ YQ+F++N  K DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  497  TSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMKV  556

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  557  EGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  592



>dbj|BAB10598.1| unnamed protein product [Arabidopsis thaliana]
Length=563

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY+++KELE CV+ YQ+F++N  K DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  451  TSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMKV  510

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  511  EGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  546



>ref|XP_010492155.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Camelina sativa]
Length=614

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY++AKELE C++ YQ+F++N  K DRAM GIMVGVFSK +++DEL++LLQD+K 
Sbjct  494  TSMISAYNRAKELERCMELYQEFRMNRGKIDRAMGGIMVGVFSKTSRIDELMRLLQDMKV  553

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKPKNI  336
            + T+LD RLY SALNALRDAGL  + +WLQESF  A    S  S  K  KN+
Sbjct  554  EGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAAQTSASRYSNMKNTKNL  605



>ref|XP_008778816.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=614

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY+KA++L+ C+++Y++FK+N  K DRA+AGIMVGVFSK ++ DELVKLLQD+K+
Sbjct  512  TSIISAYNKARKLDECIRFYEEFKMNRGKVDRALAGIMVGVFSKGSRFDELVKLLQDMKS  571

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  285
            + T LDERLY SALNALRDAGL++  KW ++SF +
Sbjct  572  EGTGLDERLYESALNALRDAGLQVHMKWFEKSFGL  606



>gb|KHN38588.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=601

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I AYSKA E E+CVK + ++++NG   DRA+AGIMVGVFSK+ +VDELVKLLQD+KT
Sbjct  506  TSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVGVFSKVGQVDELVKLLQDMKT  565

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  566  EGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  601



>ref|XP_003529243.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=631

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I AYSKA E E+CVK + ++++NG   DRA+AGIMVGVFSK+ +VDELVKLLQD+KT
Sbjct  536  TSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVGVFSKVGQVDELVKLLQDMKT  595

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  596  EGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  631



>gb|KJB35742.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=441

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VISAY++ +E E CVK+YQ+F+LNG   D+AMAG MVGVFSK +++DELV+LLQD+K 
Sbjct  340  TTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVGVFSKTSRIDELVRLLQDMKA  399

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  400  EGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  432



>ref|XP_006289562.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
 gb|EOA22460.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
Length=612

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY++AKEL+ CV+ YQ+F++N  K DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  498  TSMISAYNRAKELDRCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMKV  557

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  558  EGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  593



>gb|KJB35743.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=585

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VISAY++ +E E CVK+YQ+F+LNG   D+AMAG MVGVFSK +++DELV+LLQD+K 
Sbjct  484  TTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVGVFSKTSRIDELVRLLQDMKA  543

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  544  EGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  576



>ref|XP_010043883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85901.1| hypothetical protein EUGRSUZ_B02618 [Eucalyptus grandis]
Length=615

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I+AY++A+E E+C+K+Y++F+ NG   DRAM GIMVGVFSK ++++EL++ LQD+K+
Sbjct  513  TSLIAAYNRAREFETCIKFYEEFRANGGSIDRAMGGIMVGVFSKSSRIEELIRFLQDMKS  572

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRD+GL ++A+W QESF++A
Sbjct  573  EGTELDGRLYGSALNALRDSGLLVQARWFQESFSMA  608



>ref|XP_004151188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
 gb|KGN49761.1| hypothetical protein Csa_5G114580 [Cucumis sativus]
Length=608

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY KA E E C +YY++F++NG   D+A  GIMVGVFSK ++VDELVKLL+D+K 
Sbjct  509  TSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVGVFSKTSRVDELVKLLRDMKL  568

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  569  EGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602



>ref|XP_008465506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Cucumis melo]
Length=608

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I+AY KA E E C +YY++F++NG   D+A+ GIMVGVFSK ++VDELVKLL+D+K 
Sbjct  509  TSIINAYVKASEFEKCEQYYREFRMNGGTIDKAIGGIMVGVFSKTSRVDELVKLLRDMKL  568

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + T+LDERLYRSALNAL DAGL+++AKWLQ+ +A
Sbjct  569  EGTRLDERLYRSALNALMDAGLQVQAKWLQDHYA  602



>ref|XP_004172063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
Length=608

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY KA E E C +YY++F++NG   D+A  GIMVGVFSK ++VDELVKLL+D+K 
Sbjct  509  TSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVGVFSKTSRVDELVKLLRDMKL  568

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  569  EGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602



>ref|XP_010547300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Tarenaya hassleriana]
Length=632

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY+K KE E CV+ Y +F++N  + DRAMAGIMVGVFSK+++ DEL++LLQD+K 
Sbjct  518  TSMISAYNKTKEFERCVELYHEFRMNRGEIDRAMAGIMVGVFSKISRFDELMRLLQDMKV  577

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  291
              T+LD RLY SALNALRDAGL+++ +WLQE+F   T
Sbjct  578  QGTRLDGRLYSSALNALRDAGLQVQIRWLQENFEATT  614



>ref|XP_010453475.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g13770, chloroplastic-like [Camelina sativa]
Length=602

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY++AKELE C++ YQ+F+++  + DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  494  TSMISAYNRAKELERCMELYQEFRMSRGEIDRAMAGIMVGVFSKTSRIDELMRLLQDMKV  553

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  554  EGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  589



>ref|XP_006399876.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
 gb|ESQ41329.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
Length=611

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I A ++AKELE CV+ Y +F++N  K DRAMAGIMVGVFSK +++DEL++LLQD+K 
Sbjct  497  TSMIGACNRAKELERCVELYNEFRMNRGKIDRAMAGIMVGVFSKTSRIDELMRLLQDMKV  556

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  557  ERTKLDARLYSSALNALRDAGLNSQIRWLQESFDTA  592



>gb|KHN48767.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=221

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I AYSKA E E+CVK + ++++NG   DRAMAGIMVGVFSK+  VDEL+KLLQD+K 
Sbjct  126  TTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVGVFSKVGLVDELLKLLQDMKA  185

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  186  EGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  221



>ref|XP_010668078.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I AYS+A+E E+C  +Y +++ +G   D A+AGIMVGVFSK+N++DE++KLLQDLK 
Sbjct  515  TSIIGAYSRAREYETCTIFYDEYRKSGGVIDLALAGIMVGVFSKINRIDEIIKLLQDLKA  574

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TK+D RLYRSALNALRDAGL+++ +WL+E+F
Sbjct  575  EGTKMDTRLYRSALNALRDAGLQMQVRWLEENF  607



>ref|XP_006576030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=258

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I AYSKA E E+CVK + ++++NG   DRAMAGIMVGVFSK+  VDEL+KLLQD+K 
Sbjct  163  TTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVGVFSKVGLVDELLKLLQDMKA  222

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  223  EGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  258



>ref|XP_007222296.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
 gb|EMJ23495.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
Length=583

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VI AY+KA + E C++YY +F+++G   D+AMAG+MVGVFSK  +VDELVKLL+D+K+
Sbjct  488  TTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVGVFSKTGRVDELVKLLRDMKS  547

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  548  EGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  583



>ref|XP_007153172.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
 gb|ESW25166.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
Length=609

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAY+KA E ESC+K + ++++ G   DRAMAG MVGV++K+ +VD+LVKLLQD+KT
Sbjct  514  TSIISAYNKAGEFESCMKLFDEYRMKGGLIDRAMAGTMVGVYTKVGQVDDLVKLLQDMKT  573

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD+RLY+SA NA +DAGL+++AKW++E F VA
Sbjct  574  EGTRLDQRLYQSAWNAFKDAGLQLQAKWMKEIFLVA  609



>ref|XP_008220989.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
 ref|XP_008220990.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
Length=615

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VI AY+KA + E C++YY +F+++G   D+AMAG+MVGVFSK  +VDELVKLL+D+K+
Sbjct  520  TTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVGVFSKTGQVDELVKLLRDMKS  579

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  580  EGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  615



>ref|XP_006853735.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
 gb|ERN15202.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
Length=616

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVI AYSKA E E C++++++F++NG + D+ M GIMVGVFSK N++DELV LLQD+K 
Sbjct  514  TSVILAYSKAGECEECMRFFKEFRMNGGRIDKIMGGIMVGVFSKSNRIDELVTLLQDMKL  573

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            + T LDERL RSA NALRDAGL+ +  WL ESF 
Sbjct  574  EGTLLDERLKRSAANALRDAGLQAQVGWLNESFG  607



>ref|XP_009351650.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Pyrus x bretschneideri]
Length=608

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I AY+KA E E C+KYY +F+++G   D+A+AG+MVG+FSK  ++DELVKLL+D+K 
Sbjct  513  TTIIGAYNKAGEYEMCMKYYHEFRVHGGVLDKALAGMMVGIFSKTGRIDELVKLLRDMKA  572

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  573  EGTELDGRLYRSALKALSDSGLEMQVKWLQGSFKVT  608



>ref|XP_006420695.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
 gb|ESR33935.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
Length=382

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  7    VISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  186
            V   Y+ A+  +  VK+Y +FK+NG   DRAMAGIMVGVFSK+++++ELVKLL D+K++ 
Sbjct  289  VTPEYNMARGFDMFVKFYNEFKMNGGVIDRAMAGIMVGVFSKLSQIEELVKLLGDMKSEG  348

Query  187  TKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  349  TKLDERLYHSAMNALRDAGLQMQAQWLQQNF  379



>gb|EYU36097.1| hypothetical protein MIMGU_mgv1a020159mg [Erythranthe guttata]
Length=573

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TSVIS Y++ KE + C++YY++FK+ G K D+AMAG+MV V+SK N+V ELV+LLQD+K 
Sbjct  479  TSVISGYNRVKEFDKCIEYYEEFKMTGGKIDKAMAGVMVAVYSKTNRVAELVELLQDMKM  538

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            +   LD R Y SA++ALRDAGL+++ +WLQE F
Sbjct  539  EGAVLDARFYSSAMSALRDAGLQVQTRWLQEMF  571



>ref|XP_009400607.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=614

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAYSKA+ ++ C+ ++++FK NG K DRAMAGIMVGVFSK +++DEL+KLLQD++ 
Sbjct  514  TSIISAYSKARRIDECIDFFEEFKGNGGKVDRAMAGIMVGVFSKGSRLDELIKLLQDMEL  573

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
              T LD RL+ SALNALRDAGL++     ++SF
Sbjct  574  AGTGLDARLHESALNALRDAGLQVHMNGFRKSF  606



>ref|XP_004298632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=604

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VI AY+KA + E C+++Y +++++G   D+ MA +MVGVFSK  +VDELVKLL+D+K 
Sbjct  509  TTVIGAYNKAGDFEMCLRFYNEYRIHGGVLDKTMAAMMVGVFSKSGRVDELVKLLRDMKA  568

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T LD RLYRSALNAL D+GLE++ KWLQ SF V 
Sbjct  569  EGTGLDVRLYRSALNALADSGLEMQVKWLQSSFEVT  604



>gb|KEH40726.1| PPR containing plant-like protein [Medicago truncatula]
Length=605

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I AY KA+E + C+K Y +++LN    D+AMAG MVGV+SK+  VDELVKLLQD+K 
Sbjct  510  TSIIGAYCKAQEFDKCIKLYNEYRLNKGAIDKAMAGTMVGVYSKVGMVDELVKLLQDMKM  569

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  570  EGTRLDQRLYQSAWNAFTEAGMQLQVKWMKESFIVT  605



>ref|XP_008340510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Malus domestica]
Length=608

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I AY+KA E E C+KYY +F++ G   D+A+AG+MV +FSK  ++DELVKLL+D+K 
Sbjct  513  TTIIGAYNKAGEYEMCMKYYHEFRVQGGVLDKALAGMMVAIFSKTGRIDELVKLLRDMKA  572

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            +  +LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  573  EGAELDGRLYRSALKALTDSGLEMQVKWLQGSFKVT  608



>ref|XP_004498165.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
 ref|XP_004517308.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
Length=632

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+I AY K  E + C++ Y +++LN    D+AMAG MVGV+SK+ +VDELVKLLQD+K+
Sbjct  537  TSIIGAYCKIGEFDKCIELYNEYRLNKGVIDKAMAGTMVGVYSKVGQVDELVKLLQDMKS  596

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            + T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  597  EGTRLDQRLYQSAWNAFAEAGMQVQVKWMKESFHVT  632



>emb|CCI55317.1| PH01B001I13.13 [Phyllostachys edulis]
Length=636

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++ISA++++ EL+ C+  YQ+F+  G K D+A+AG+M GVFSK ++ +EL+ LL+D+K 
Sbjct  505  TAIISAFNRSGELDRCMDLYQEFRETGGKVDKALAGLMAGVFSKCSRFNELIDLLKDMKL  564

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
            +  KLD RLY S LN+LR+AGLE+  KWLQ +F+
Sbjct  565  EGAKLDRRLYMSVLNSLREAGLEVHVKWLQSNFS  598



>ref|XP_003580383.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brachypodium distachyon]
Length=612

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I A++++ EL+ C+ +YQ+F+  G+K D+ MA +MVGVF K ++ +EL++LL+D+K 
Sbjct  513  TAIIGAFNRSGELDRCMNFYQEFRETGMKVDQTMASLMVGVFCKSSRFNELIELLRDMKL  572

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
               KLD RLY   LN+LR+AGLE+  KWLQ  F+
Sbjct  573  QGIKLDRRLYMIVLNSLREAGLEVHVKWLQNYFS  606



>gb|EMT31983.1| hypothetical protein F775_29312 [Aegilops tauschii]
Length=609

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+++ A++++ EL+ C+ YYQ+F+  G   D+ +AG+MVGVF K ++ ++L++LL+D+K 
Sbjct  510  TAIVGAFNRSGELDRCMDYYQEFRETGGTVDKTLAGLMVGVFCKTSRFNDLIQLLRDMKL  569

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
              TKLD RLY   LN+LR+AGLE+  +WLQ+ F
Sbjct  570  QGTKLDRRLYMIVLNSLREAGLEVHVRWLQDYF  602



>ref|NP_001174064.1| Os04g0583150 [Oryza sativa Japonica Group]
 emb|CAE04154.2| OSJNBa0088A01.11 [Oryza sativa Japonica Group]
 gb|EAZ31756.1| hypothetical protein OsJ_15910 [Oryza sativa Japonica Group]
 dbj|BAG89668.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92792.1| Os04g0583150 [Oryza sativa Japonica Group]
Length=606

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I+A++++ EL+ C+  YQ+F+  G K D A+AG+MVGVFSK ++ +EL++LL+D++ 
Sbjct  509  TAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVGVFSKCSRFNELIELLKDMQG  568

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
              T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  569  --TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  600



>gb|EAY95290.1| hypothetical protein OsI_17116 [Oryza sativa Indica Group]
Length=608

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I+A++++ EL+ C+  YQ+F+  G K D A+AG+MVGVFSK ++ +EL++LL+D++ 
Sbjct  511  TAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVGVFSKCSRFNELIELLKDMQG  570

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESFA  282
              T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  571  --TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  602



>ref|XP_002312498.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
 gb|EEE89865.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
Length=603

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAYSK+KE E CV+++ ++++NG   D A+AGIMVGVFSK++++DEL+KLL+D+K+
Sbjct  517  TSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVGVFSKISRIDELLKLLRDMKS  576

Query  181  DETKLDERLYRSALNALRDAGLEIRAK  261
            +   +DERLY SA NA+     E+R K
Sbjct  577  EGAPIDERLYVSATNAM--VAKELRGK  601



>ref|XP_004976594.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Setaria italica]
Length=607

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T +I A ++A EL  CV+ YQ+F+  G K D++MAG+M GVFSK ++ +EL++LL+D+  
Sbjct  510  TGIILANNRAGELHRCVELYQEFREAGGKVDKSMAGLMAGVFSKCSRFNELIELLKDM--  567

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TKLD RLY S L +LRDAGLE+  KWL+ +F
Sbjct  568  NATKLDRRLYMSVLRSLRDAGLEVHVKWLKSNF  600



>ref|XP_011025175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Populus euphratica]
Length=603

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            TS+ISAYSK+KE E CV+++ ++++NG   D A+AGIMVGVFSK++++DEL+KLL+D+K+
Sbjct  517  TSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVGVFSKISRIDELLKLLRDMKS  576

Query  181  DETKLDERLYRSALNALRDAGLEIRAK  261
            +   +DERLY SA NA+     E+R K
Sbjct  577  EGAPIDERLYISATNAM--VAKELRGK  601



>ref|NP_001142291.1| uncharacterized protein LOC100274460 [Zea mays]
 gb|ACF78649.1| unknown [Zea mays]
 gb|ACF88108.1| unknown [Zea mays]
Length=419

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVGV SK ++ +EL++LL+++  
Sbjct  322  TAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVGVLSKTSRFNELIELLKEM--  379

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  380  NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  412



>gb|ACG27989.1| hypothetical protein [Zea mays]
Length=603

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I A ++A EL+ C++ YQ+F+  G K D+ MAG+MVGV SK ++ +EL++LL+++  
Sbjct  506  TAIILANNRAGELDRCMELYQEFRETGRKVDKVMAGLMVGVLSKTSRFNELIELLKEM--  563

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  564  NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>tpg|DAA36322.1| TPA: hypothetical protein ZEAMMB73_184989 [Zea mays]
Length=603

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVGV SK ++ +EL++LL+++  
Sbjct  506  TAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVGVLSKTSRFNELIELLKEM--  563

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
            + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  564  NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>ref|XP_006652694.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Oryza brachyantha]
Length=608

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I++++++ EL+ C+  YQ+F+  G   D+A+ G+MVGVFSK ++ +EL++L++D++ 
Sbjct  511  TAIINSFNRSGELDRCMDLYQEFRETGGNVDKALGGLMVGVFSKCSRFNELIELMKDMQG  570

Query  181  DETKLDERLYRSALNALRDAGLEIRAKWLQESF  279
              T+LD RLY + L +LRDAGLE+  KWL+ +F
Sbjct  571  --TRLDRRLYLTVLRSLRDAGLEVHEKWLETNF  601



>ref|XP_008350824.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like, partial [Malus domestica]
Length=585

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T+VISAY+KA E E C+KYY +F+++G   D+A+AG+MVG+FSK  ++DELVKLL+D+K+
Sbjct  513  TTVISAYNKAGEFEMCMKYYHEFRVHGGVLDKALAGMMVGIFSKTGRIDELVKLLRDMKS  572

Query  181  DETKLDERLYRSA  219
            +   LD RLYRSA
Sbjct  573  EGMALDGRLYRSA  585



>gb|KDO42183.1| hypothetical protein CISIN_1g044084mg, partial [Citrus sinensis]
Length=343

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDEL  153
            T+VISAY+ A+E + CVK+Y +F++NG   DRAMAGIMVGVFSK+++++EL
Sbjct  293  TTVISAYNMAREFDMCVKFYNEFRMNGGVIDRAMAGIMVGVFSKLSQIEEL  343



>ref|XP_008778815.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=245

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +1

Query  100  MAGIMVGVFSKM---NKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQ  270
            M   +V V+ +M   ++ DELVKLLQD+K   T LD  LY SALNA RD GL++  KW +
Sbjct  173  MYNCIVSVYDQMRMSSRFDELVKLLQDMKLKRTGLDGSLYESALNAFRDVGLQVHMKWFE  232

Query  271  ESFAV  285
            +SF +
Sbjct  233  KSFGL  237



>ref|XP_001783392.1| predicted protein [Physcomitrella patens]
 gb|EDQ51786.1| predicted protein [Physcomitrella patens]
Length=540

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/82 (26%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +1

Query  1    TSVISAYSKAKELESCVKYYQDFKLNGVKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  180
            T++I+AY++    E C++ ++  + +G+K DR +  IM+ V+ K  +  +L +LL+ +  
Sbjct  413  TTLINAYNRLGRFEECIRVFEQHRADGLKLDRILVAIMINVYGKARQYSKLAELLEVMPK  472

Query  181  DETKLDERLYRSALNALRDAGL  246
               + D R+ ++ +    D G+
Sbjct  473  SGIQPDTRILKTVVEIYEDGGM  494



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905