BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN011E22

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    290   2e-96   Petunia x hybrida [garden petunia]
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    285   5e-94   Petunia x hybrida [garden petunia]
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    283   1e-93   Solanum tuberosum [potatoes]
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    283   2e-93   Solanum lycopersicum
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    283   2e-93   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    282   3e-93   
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    282   5e-93   Nicotiana sylvestris
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    281   6e-93   Solanum tuberosum [potatoes]
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    281   7e-93   Solanum tuberosum [potatoes]
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    281   2e-92   Solanum tuberosum [potatoes]
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    280   2e-92   Eucalyptus grandis [rose gum]
gb|AHI85721.1|  stress-induced protein 16                               280   4e-92   Capsicum annuum
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    279   5e-92   Nicotiana sylvestris
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    278   1e-91   Nicotiana tomentosiformis
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    278   1e-91   Solanum lycopersicum
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    278   1e-91   Nicotiana sylvestris
gb|AFK36660.1|  unknown                                                 278   2e-91   Lotus japonicus
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    278   2e-91   
gb|AAR83879.1|  Cristal-Glass1 protein                                  278   2e-91   Capsicum annuum
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    278   2e-91   Capsicum annuum
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    277   3e-91   Nicotiana attenuata
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    277   3e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    277   3e-91   
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    277   4e-91   Stellaria longipes
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    277   4e-91   Solanum tuberosum [potatoes]
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    277   5e-91   Capsicum annuum
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    276   6e-91   Solanum tuberosum [potatoes]
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    276   8e-91   
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    276   9e-91   Eucalyptus globulus [blue gum]
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    276   9e-91   Solanum tuberosum [potatoes]
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    276   1e-90   Eucalyptus grandis [rose gum]
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    276   1e-90   Solanum tuberosum [potatoes]
gb|AFK48034.1|  unknown                                                 276   1e-90   Lotus japonicus
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    275   2e-90   Solanum tuberosum [potatoes]
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    275   2e-90   Pyrus x bretschneideri [bai li]
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    275   2e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    275   2e-90   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK42721.1|  unknown                                                 275   2e-90   Lotus japonicus
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    275   3e-90   Nicotiana tomentosiformis
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    275   3e-90   Nicotiana sylvestris
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    275   4e-90   Ricinus communis
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    274   5e-90   Solanum lycopersicum
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    274   6e-90   Nelumbo nucifera [Indian lotus]
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    274   6e-90   Solanum tuberosum [potatoes]
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    274   7e-90   Malus domestica [apple tree]
gb|AFK33868.1|  unknown                                                 273   8e-90   Lotus japonicus
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    273   1e-89   Betula pendula [white birch]
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    273   2e-89   Nelumbo nucifera [Indian lotus]
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    273   2e-89   Mesembryanthemum crystallinum
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    273   2e-89   Mesembryanthemum crystallinum
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    272   3e-89   Solanum tuberosum [potatoes]
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    272   4e-89   Fagus crenata
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    272   4e-89   Mesembryanthemum crystallinum
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    271   5e-89   Pyrus x bretschneideri [bai li]
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    271   5e-89   Mesembryanthemum crystallinum
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    271   6e-89   Fragaria vesca subsp. vesca
gb|ABK96567.1|  unknown                                                 271   9e-89   Populus trichocarpa x Populus deltoides
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    271   9e-89   
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    271   9e-89   Pyrus pyrifolia [sha li]
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     271   1e-88   Malus domestica x Pyrus communis
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    271   1e-88   Malus sp.
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    271   1e-88   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    271   1e-88   Panax ginseng [Asiatic ginseng]
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    270   1e-88   Blitum nuttallianum
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    270   2e-88   Populus trichocarpa [western balsam poplar]
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    270   2e-88   Eucalyptus globulus [blue gum]
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    270   2e-88   Fagus sylvatica
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    270   3e-88   Ammopiptanthus mongolicus
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     270   3e-88   Eucalyptus grandis [rose gum]
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    269   5e-88   Nicotiana sylvestris
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   269   6e-88   Mesembryanthemum crystallinum
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    269   7e-88   Nelumbo nucifera [Indian lotus]
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    269   7e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    268   1e-87   Populus euphratica
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    268   1e-87   Corchorus olitorius [Nalta jute]
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    268   1e-87   Amaranthus hypochondriacus [prince's feather]
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    268   2e-87   Ricinus communis
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    268   2e-87   Citrus sinensis [apfelsine]
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    268   2e-87   Nicotiana tomentosiformis
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    267   3e-87   Coffea arabica [arabica coffee]
gb|AFK40375.1|  unknown                                                 267   3e-87   Medicago truncatula
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    266   3e-87   Blitum nuttallianum
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             267   3e-87   Citrus clementina [clementine]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     267   4e-87   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    266   6e-87   Fragaria vesca subsp. vesca
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      266   6e-87   Medicago truncatula
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    266   6e-87   Aralia elata
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    266   9e-87   Cucumis melo [Oriental melon]
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    266   1e-86   Wolffia australiana
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    265   1e-86   Chenopodium album [lamb's-quarters]
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    265   1e-86   Ricinus communis
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    265   2e-86   Spinacia oleracea
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     265   2e-86   Spinacia oleracea
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    265   2e-86   Amaranthus hypochondriacus [prince's feather]
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    265   2e-86   Medicago sativa [alfalfa]
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    265   3e-86   Amaranthus hypochondriacus [prince's feather]
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    264   5e-86   Helianthus annuus
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    264   6e-86   
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    263   2e-85   Prunus mume [ume]
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    262   2e-85   Camellia sinensis [black tea]
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    262   2e-85   Silene latifolia subsp. alba [white campion]
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    263   2e-85   Cucumis sativus [cucumbers]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    263   2e-85   Cucumis sativus [cucumbers]
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    262   2e-85   Arachis hypogaea [goober]
gb|ABK96431.1|  unknown                                                 262   3e-85   Populus trichocarpa x Populus deltoides
gb|ABK95229.1|  unknown                                                 262   3e-85   Populus trichocarpa [western balsam poplar]
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    261   3e-85   Nicotiana sylvestris
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    262   3e-85   Mesembryanthemum crystallinum
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    262   3e-85   Camellia oleifera [abura-tsubaki]
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             261   5e-85   Prunus persica
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    261   6e-85   Populus euphratica
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      261   7e-85   Medicago truncatula
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    261   7e-85   Lemna gibba
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      261   8e-85   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      261   9e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    260   9e-85   Nicotiana tomentosiformis
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    259   9e-85   Nicotiana sylvestris
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    261   1e-84   Mesembryanthemum crystallinum
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    259   1e-84   Nicotiana tomentosiformis
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    260   1e-84   Mesembryanthemum crystallinum
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      260   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    259   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      260   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      260   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    259   2e-84   Nicotiana sylvestris
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    260   2e-84   Coffea canephora [robusta coffee]
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    260   2e-84   Lactuca sativa [cultivated lettuce]
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    259   3e-84   Lemna gibba
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    258   4e-84   Nicotiana tomentosiformis
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    259   4e-84   Elaeis guineensis
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    259   5e-84   Cucumis sativus [cucumbers]
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    258   5e-84   Nicotiana sylvestris
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    258   6e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    259   6e-84   Lactuca sativa [cultivated lettuce]
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    258   7e-84   Nicotiana tomentosiformis
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    257   1e-83   Nicotiana sylvestris
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    258   1e-83   
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    258   1e-83   Camelina sativa [gold-of-pleasure]
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    258   1e-83   Spinacia turkestanica
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    258   1e-83   
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    258   1e-83   Gossypium hirsutum [American cotton]
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    258   1e-83   Gossypium hirsutum [American cotton]
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             258   1e-83   Eutrema salsugineum [saltwater cress]
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    257   1e-83   Nicotiana tomentosiformis
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    258   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    258   2e-83   Camelina sativa [gold-of-pleasure]
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    256   2e-83   Nicotiana tabacum [American tobacco]
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             258   2e-83   Capsella rubella
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    257   2e-83   Arabidopsis suecica
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    257   2e-83   Arabidopsis lyrata subsp. lyrata
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    257   2e-83   Brassica rapa
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    257   2e-83   Pyrus x bretschneideri [bai li]
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    257   2e-83   Gossypium hirsutum [American cotton]
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         257   2e-83   Jatropha curcas
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    257   2e-83   
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    257   2e-83   Flaveria pringlei
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    257   3e-83   Brassica rapa
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    257   3e-83   Gossypium tomentosum
ref|NP_001235314.1|  uncharacterized protein LOC100500504               257   3e-83   Glycine max [soybeans]
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    257   3e-83   Lemna gibba
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    257   3e-83   Camelina sativa [gold-of-pleasure]
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    256   4e-83   Flaveria pringlei
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    257   4e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    257   4e-83   Camelina sativa [gold-of-pleasure]
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    257   4e-83   Gossypium raimondii
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    256   4e-83   Spinacia oleracea
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    256   4e-83   Spinacia oleracea
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             256   5e-83   Capsella rubella
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    256   5e-83   Glycine max [soybeans]
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    256   5e-83   Glycine max [soybeans]
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      256   5e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    256   6e-83   Gossypium hirsutum [American cotton]
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    256   6e-83   Raphanus sativus
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    256   6e-83   Gossypium tomentosum
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    256   6e-83   Phoenix dactylifera
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             256   6e-83   Capsella rubella
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    256   7e-83   Flaveria pringlei
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    256   7e-83   Brassica napus [oilseed rape]
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     256   7e-83   Jatropha curcas
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    256   7e-83   Manihot esculenta [manioc]
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    256   8e-83   Camelina sativa [gold-of-pleasure]
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    255   9e-83   Arabidopsis arenosa
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    256   9e-83   Flaveria pringlei
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    256   9e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    256   9e-83   Gossypium hirsutum [American cotton]
emb|CDY52468.1|  BnaA04g27920D                                          256   9e-83   Brassica napus [oilseed rape]
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    254   9e-83   Nicotiana tabacum [American tobacco]
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    255   9e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    256   1e-82   Theobroma cacao [chocolate]
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    255   1e-82   Gossypium mustelinum
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    255   1e-82   Arabidopsis suecica
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    255   1e-82   Gossypium hirsutum [American cotton]
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           255   1e-82   Medicago truncatula
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    255   1e-82   
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    255   1e-82   Brassica napus [oilseed rape]
ref|XP_010103758.1|  hypothetical protein L484_014647                   255   1e-82   Morus notabilis
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    255   1e-82   Gossypium hirsutum [American cotton]
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    255   1e-82   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    255   2e-82   
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    255   2e-82   Mesembryanthemum crystallinum
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    255   2e-82   Brassica oleracea
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    255   2e-82   Gossypium raimondii
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    255   2e-82   Brassica oleracea
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    254   2e-82   Arabidopsis arenosa
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    255   2e-82   Ageratina adenophora
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    255   2e-82   Gossypium hirsutum [American cotton]
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    254   2e-82   Gossypium mustelinum
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    254   2e-82   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  254   2e-82   Arabidopsis lyrata subsp. lyrata
gb|ACQ90230.1|  virus-resistance protein                                257   3e-82   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    254   3e-82   Elaeis guineensis
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    254   3e-82   Gossypium arboreum [tree cotton]
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    254   3e-82   Trifolium repens [creeping white clover]
emb|CDX99682.1|  BnaC04g34390D                                          255   3e-82   
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    254   3e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             254   3e-82   Eutrema salsugineum [saltwater cress]
emb|CDY67657.1|  BnaCnng55860D                                          254   3e-82   Brassica napus [oilseed rape]
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             254   3e-82   Eutrema salsugineum [saltwater cress]
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    254   4e-82   Gossypium hirsutum [American cotton]
emb|CDX67402.1|  BnaA07g14420D                                          254   5e-82   
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    254   5e-82   Glycine max [soybeans]
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    254   6e-82   Brassica oleracea
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    253   6e-82   Spinacia tetrandra
gb|ACU13285.1|  unknown                                                 254   6e-82   Glycine max [soybeans]
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    254   6e-82   Phoenix dactylifera
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    253   6e-82   
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           253   7e-82   Medicago truncatula
gb|ACJ85905.1|  unknown                                                 253   7e-82   Medicago truncatula
gb|AAG40356.1|AF325004_1  At1g67090                                     253   8e-82   Arabidopsis thaliana [mouse-ear cress]
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    253   8e-82   Glycine tabacina
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    253   8e-82   Gossypium gossypioides
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    253   9e-82   Brassica rapa
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    253   9e-82   Flaveria pringlei
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    253   9e-82   Camelina sativa [gold-of-pleasure]
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    253   9e-82   Arabidopsis suecica
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           253   1e-81   Medicago truncatula
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           253   1e-81   Medicago truncatula
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    253   1e-81   Brassica rapa
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    253   1e-81   Manihot esculenta [manioc]
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    253   1e-81   Cicer arietinum [garbanzo]
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    253   1e-81   Brassica napus [oilseed rape]
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    253   1e-81   Brassica rapa
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    253   2e-81   Glycine soja [wild soybean]
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    253   2e-81   Pisum sativum [garden pea]
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    253   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    252   2e-81   Arabidopsis suecica
emb|CDY01665.1|  BnaC04g30870D                                          252   2e-81   
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    252   2e-81   Flaveria pringlei
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    252   2e-81   Brassica oleracea
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    252   2e-81   Brassica rapa
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    252   2e-81   Musa acuminata AAA Group [Cavendish banana]
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                     252   3e-81   Eucalyptus grandis [rose gum]
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    252   3e-81   Pisum sativum [garden pea]
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    252   3e-81   Flaveria pringlei
gb|KJB10450.1|  hypothetical protein B456_001G201800                    252   3e-81   Gossypium raimondii
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    252   3e-81   Manihot esculenta [manioc]
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    251   5e-81   Gossypium herbaceum [Arabian cotton]
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             251   5e-81   Prunus persica
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    251   5e-81   Hevea brasiliensis [jebe]
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    251   5e-81   Brassica oleracea
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           251   5e-81   Medicago truncatula
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    251   5e-81   Musa acuminata AAA Group [Cavendish banana]
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    251   5e-81   Glycine max [soybeans]
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    251   6e-81   Brassica napus [oilseed rape]
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...    251   6e-81   Populus euphratica
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    251   6e-81   Brassica napus [oilseed rape]
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    251   7e-81   Tarenaya hassleriana [spider flower]
emb|CDP20139.1|  unnamed protein product                                250   7e-81   Coffea canephora [robusta coffee]
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      251   8e-81   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        251   9e-81   Brassica rapa subsp. chinensis [bok-choy]
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    250   1e-80   Gossypium armourianum
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             250   1e-80   Capsella rubella
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    250   1e-80   Brassica rapa
gb|KJB43046.1|  hypothetical protein B456_007G181300                    250   1e-80   Gossypium raimondii
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    250   2e-80   Rumex obtusifolius
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    250   2e-80   Prunus mume [ume]
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    250   2e-80   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    250   2e-80   Litchi chinensis [litchi]
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    249   3e-80   Gossypium armourianum
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    249   3e-80   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    249   3e-80   
emb|CAA30290.1|  rubisco ssu precursor                                  249   3e-80   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    249   3e-80   
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    248   4e-80   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                249   4e-80   
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         248   4e-80   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    248   4e-80   
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    249   4e-80   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    249   5e-80   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                249   5e-80   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    249   5e-80   
emb|CAH59401.1|  Rubisco SSU                                            248   7e-80   
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    248   7e-80   
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    248   8e-80   
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    248   9e-80   
gb|ABK96590.1|  unknown                                                 247   2e-79   
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    246   3e-79   
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    246   4e-79   
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             246   4e-79   
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       246   5e-79   
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    246   6e-79   
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    245   7e-79   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    246   7e-79   
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    245   1e-78   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    245   1e-78   
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      245   1e-78   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    245   1e-78   
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    244   2e-78   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   2e-78   
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   2e-78   
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   244   2e-78   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       243   4e-78   
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...    243   5e-78   
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    243   7e-78   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   9e-78   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    242   2e-77   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    241   2e-77   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    243   2e-77   
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    241   3e-77   
emb|CDY12616.1|  BnaA02g12840D                                          241   3e-77   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    241   3e-77   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    241   3e-77   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    241   4e-77   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    241   5e-77   
ref|NP_001066606.1|  Os12g0291400                                       241   5e-77   
emb|CDY42338.1|  BnaC02g17150D                                          241   6e-77   
gb|EAY97115.1|  hypothetical protein OsI_19041                          241   6e-77   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   7e-77   
ref|NP_001066604.1|  Os12g0291100                                       241   7e-77   
ref|NP_001066559.1|  Os12g0274700                                       241   7e-77   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    241   7e-77   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   9e-77   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...    240   1e-76   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    240   1e-76   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                240   1e-76   
gb|EMT06085.1|  hypothetical protein F775_43781                         240   1e-76   
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   1e-76   
dbj|BAJ86022.1|  predicted protein                                      240   1e-76   
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   1e-76   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   1e-76   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    240   2e-76   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    240   2e-76   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    239   2e-76   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    239   2e-76   
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           239   2e-76   
dbj|BAJ90202.1|  predicted protein                                      239   2e-76   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    239   2e-76   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    239   3e-76   
gb|AIR75144.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    238   3e-76   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    239   3e-76   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    238   3e-76   
dbj|BAJ89884.1|  predicted protein                                      239   3e-76   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    239   3e-76   
dbj|BAJ90404.1|  predicted protein                                      239   3e-76   
emb|CAA10497.1|  hypothetical protein                                   239   4e-76   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    238   4e-76   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    238   5e-76   
ref|NP_001066607.1|  Os12g0292400                                       238   5e-76   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    238   6e-76   
gb|ABQ42090.1|  ribulose bisphosphate carboxylase small chain (Ru...    238   6e-76   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    238   6e-76   
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    238   6e-76   
gb|AEX60840.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    238   7e-76   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    238   8e-76   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     238   8e-76   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    238   8e-76   
gb|AIF75302.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    237   9e-76   
gb|AIF75300.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    237   9e-76   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    238   1e-75   
gb|AIF75301.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    237   1e-75   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    238   1e-75   
emb|CAA10496.1|  hypothetical protein                                   237   1e-75   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    237   1e-75   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    237   1e-75   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    237   1e-75   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   2e-75   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    237   2e-75   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    236   2e-75   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    236   3e-75   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    236   3e-75   
emb|CAH59404.1|  Rubisco SSU                                            236   3e-75   
gb|AEX60836.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    236   3e-75   
emb|CDY42337.1|  BnaC02g17140D                                          236   3e-75   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    236   3e-75   
gb|AEX60837.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    236   3e-75   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    236   3e-75   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    236   4e-75   
dbj|BAJ90550.1|  predicted protein                                      236   4e-75   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   4e-75   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    236   4e-75   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   4e-75   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     236   4e-75   
gb|ACS68693.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    236   5e-75   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    236   5e-75   
gb|ABQ42089.1|  ribulose bisphosphate carboxylase small chain (Ru...    236   5e-75   
gb|AIR75143.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    234   5e-75   
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    236   5e-75   
gb|EAY82834.1|  hypothetical protein OsI_38046                          236   6e-75   
gb|ABQ42164.1|  ribulose bisphosphate carboxylase small chain (Ru...    236   7e-75   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    235   7e-75   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    235   8e-75   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    235   9e-75   
gb|AEX60838.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    235   9e-75   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     235   1e-74   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    235   1e-74   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    234   1e-74   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    234   1e-74   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    234   1e-74   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    234   1e-74   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    234   2e-74   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     234   2e-74   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    234   2e-74   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    234   3e-74   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     233   3e-74   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    233   3e-74   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    233   4e-74   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          233   6e-74   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    233   7e-74   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          233   8e-74   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    233   8e-74   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    232   1e-73   
emb|CAG25595.1|  putative rubisco small subunit                         232   1e-73   
emb|CBI15452.3|  unnamed protein product                                231   2e-73   
gb|ABA46878.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    231   2e-73   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    231   2e-73   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    231   4e-73   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...    231   5e-73   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    231   5e-73   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    230   5e-73   
gb|EYU38175.1|  hypothetical protein MIMGU_mgv1a014707mg                231   5e-73   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    230   5e-73   
gb|KEH21537.1|  ribulose bisphosphate carboxylase small chain           231   6e-73   
gb|ABA46875.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    230   6e-73   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    230   8e-73   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    230   8e-73   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    230   9e-73   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    229   9e-73   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    229   1e-72   
gb|ABA46877.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    229   1e-72   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     229   2e-72   
gb|ABA46882.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    229   2e-72   
gb|ABA46879.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    229   2e-72   
gb|ABA46889.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    228   2e-72   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    229   3e-72   
gb|ABA46911.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    228   3e-72   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...    229   4e-72   
gb|ABA46898.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    228   4e-72   
gb|ABA46910.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    228   5e-72   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    228   5e-72   
gb|ABA46883.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    228   6e-72   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    227   1e-71   
gb|ABA46888.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    226   1e-71   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         226   2e-71   
gb|ABA46891.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    226   2e-71   
gb|ABA46909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    226   2e-71   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        226   2e-71   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    226   3e-71   
gb|AAF06097.1|  ribulose 1,5-bisphosphate carboxylase small chain...    226   3e-71   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    226   4e-71   
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    225   4e-71   
gb|ABA46887.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    225   5e-71   
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    225   9e-71   
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   223   1e-70   
gb|ABA46892.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    224   1e-70   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   2e-70   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     224   2e-70   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    224   3e-70   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    222   1e-69   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    221   3e-69   
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   4e-69   
gb|ABR45726.1|  RBCS1                                                   221   5e-69   
gb|ABR45725.1|  RBCS1                                                   221   5e-69   
sp|Q38793.1|RBS_AEGTA  RecName: Full=Ribulose bisphosphate carbox...    219   1e-68   
ref|WP_026003795.1|  hypothetical protein                               216   4e-68   
gb|EMS48023.1|  Ribulose bisphosphate carboxylase small chain, ch...    218   5e-68   
gb|AAF03096.1|AF162195_1  ribulose-1,5-bisphosphate carboxylase/o...    218   6e-68   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...    217   1e-67   
ref|XP_006485852.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   1e-67   
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...    215   2e-67   
gb|EMS50269.1|  Ribulose bisphosphate carboxylase small chain PW9...    217   2e-67   
emb|CDY42341.1|  BnaC02g17180D                                          217   2e-67   
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      215   2e-67   
sp|P16031.1|RBS_LARLA  RecName: Full=Ribulose bisphosphate carbox...    217   2e-67   
sp|Q41373.1|RBS_SACHY  RecName: Full=Ribulose bisphosphate carbox...    216   4e-67   
ref|WP_037767734.1|  hypothetical protein                               213   7e-67   
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...    213   1e-66   
gb|EMS50268.1|  Ribulose bisphosphate carboxylase small chain PWS...    215   2e-66   
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...    212   2e-66   
gb|ACN40169.1|  unknown                                                 213   6e-66   
gb|ABK21852.1|  unknown                                                 213   6e-66   
emb|CAA38346.1|  ribulose bisphosphate carboxylase                      213   6e-66   
pdb|4RUB|S  Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate ...    210   1e-65   
gb|ACN40080.1|  unknown                                                 211   2e-65   
gb|ABK21690.1|  unknown                                                 212   2e-65   
gb|ABK21347.1|  unknown                                                 211   3e-65   
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...    209   4e-65   
gb|ABK21447.1|  unknown                                                 211   7e-65   



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYL
Sbjct  16   NAAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+ EQLLK++EYLLNKGWVPCLEFETE GFVYRE+HASP YYDGRYWTMWKLPMFGCT
Sbjct  76   PDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DATQV+ EL+E KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  136  DATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKP  177



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   285 bits (728),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQASMVAPF GLKS  SFPV+ K   D TSI++NG RVQCMQVWPP+G KK+ETLSYL
Sbjct  16   NVAQASMVAPFNGLKSAVSFPVSSKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+ EQLLK++EYLLNKGWVPCLEFETE GFVYRE+HASP YYDGRYWTMWKLPMFGCT
Sbjct  76   PDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DATQV+ EL+E KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  136  DATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   283 bits (725),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 151/187 (81%), Gaps = 13/187 (7%)
 Frame = +1

Query  4    VLSAAQAASNGllspllhrhrlppTAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTN  183
            V+S+A  A+ G               AQASMVAPFTGLKSTASFPV++K   D TSI++N
Sbjct  5    VMSSAAVATRG-------------NGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASN  51

Query  184  GSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYRE  363
            G RV+CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE
Sbjct  52   GGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRE  111

Query  364  WHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIM  543
             + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI 
Sbjct  112  NNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCIS  171

Query  544  FIAYKPD  564
            FIAYKP+
Sbjct  172  FIAYKPE  178



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   283 bits (723),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 149/187 (80%), Gaps = 13/187 (7%)
 Frame = +1

Query  4    VLSAAQAASNGllspllhrhrlppTAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTN  183
            V+S+A  A+ G               AQASMVAPFTGLKSTASFPV++K   D TSI++N
Sbjct  5    VMSSAAVATRG-------------NGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASN  51

Query  184  GSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYRE  363
            G RV CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE
Sbjct  52   GGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRE  111

Query  364  WHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIM  543
             H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI 
Sbjct  112  NHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCIS  171

Query  544  FIAYKPD  564
            FIAYKP+
Sbjct  172  FIAYKPE  178



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   283 bits (723),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  16   NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSQEQLLSEIEYLLKSGWVPCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE+EE KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQASMVAPFTGLKSTASFPV++K   D TSI++NG RV CMQVWPP  +KK+ETLSYL
Sbjct  16   NGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL ++EYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   282 bits (721),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  17   NAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  137  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   281 bits (720),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQASMV PFTGLKSTASFPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYL
Sbjct  16   NGAQASMVGPFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   281 bits (720),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 150/187 (80%), Gaps = 13/187 (7%)
 Frame = +1

Query  4    VLSAAQAASNGllspllhrhrlppTAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTN  183
            V+S+A  A+ G               AQASMVAPFTGLKS ASFPV++K   D TSI++N
Sbjct  5    VMSSAAVATRG-------------NGAQASMVAPFTGLKSAASFPVSRKQNLDITSIASN  51

Query  184  GSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYRE  363
            G RV+CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE
Sbjct  52   GGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRE  111

Query  364  WHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIM  543
             + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI 
Sbjct  112  NNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCIS  171

Query  544  FIAYKPD  564
            FIAYKP+
Sbjct  172  FIAYKPE  178



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSY  252
              AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSY
Sbjct  16   NVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSY  75

Query  253  LPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGC  432
            LP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGC
Sbjct  76   LPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGC  135

Query  433  TDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            TDATQV+AE++E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  TDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   280 bits (717),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS ++FPVT+KS+ D TS+S+NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   TPAQATMVAPFTGLKSASAFPVTRKSSEDITSLSSNGGRVQCMQVWPPIGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+V+YLL  GWVPCLEFE E GFVYRE H+SPGYYDGRYWTMWKLPMFGCT
Sbjct  75   PPLSPESLAKEVDYLLRSGWVPCLEFELEHGFVYREHHSSPGYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  135  DSAQVLKELEEAKKAYPTAFIRIIGFDNKRQVQCISFIAYKP  176



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   280 bits (715),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
               QASMVAPFTGLKS ASFPVT+K+  D TSI++NG RVQCM VWPP   KK+ETLSYL
Sbjct  16   NVTQASMVAPFTGLKSAASFPVTRKNNLDITSIASNGGRVQCMLVWPPINKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   279 bits (714),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASM+APFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  17   NAAQASMIAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  137  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   278 bits (712),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYL
Sbjct  16   NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSEEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE+ E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLAEVGEAKKAYPEAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   278 bits (712),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
               QASMVAPFTGLKS+A+FPVTKK   D TSI++NG RV CMQVWPP  +KK+ETLSYL
Sbjct  16   NVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  16   NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   278 bits (711),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T   A+MVAPFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  13   TVNHANMVAPFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYL  72

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFG T
Sbjct  73   PPLTVEQLAKEVEYLIRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGTT  132

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ ELEE KKAYP A++RI+GFDNKRQVQCI FIA++P+
Sbjct  133  DASQVLKELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAHRPE  175



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   278 bits (711),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
               QASMVAPFTGLKS+A+FPVTKK   D TSI++NG RV CMQVWPP  +KK+ETLSYL
Sbjct  16   NVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL ++EYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   278 bits (710),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASM+A F GLKS ASFPVT+K   D TSI++NG RVQCM VWPP   KK+ETLSYL
Sbjct  16   NAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLVWPPINKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   278 bits (710),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASM+A F GLKS ASFPVT+K   D TSI++NG RVQCM VWPP   KK+ETLSYL
Sbjct  16   NAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLVWPPINKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  16   NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSQEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA QV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DAAQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            +  QA+MVAPF GLKST++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  17   SGVQANMVAPFNGLKSTSAFPVTRKSNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PPLTTEQLLAEVNYLLVKGWIPCLEFEIKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QVV E+EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  137  DPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  178



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  22   AQASMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPP  80

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS+E L K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  81   LSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDS  140

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  141  SQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  180



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQASMVAPFTGLKS ASFPV++K+  D TSI++NG RV+CMQVWPP  +KK+ETLSYL
Sbjct  16   NGAQASMVAPFTGLKSNASFPVSRKTNLDITSIASNGGRVRCMQVWPPINMKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS+EQLL ++EYLL  GWVPCLEFETE GFVYRE  +SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSSEQLLSEIEYLLKNGWVPCLEFETEHGFVYREHTSSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV AE++E KKAYP A +RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVAAEVQEAKKAYPDAHIRIIGFDNVRQVQCISFIAYKPE  178



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +1

Query  88   ASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLS  267
             SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+
Sbjct  21   GSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLT  80

Query  268  TEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  447
             EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQ
Sbjct  81   DEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQ  140

Query  448  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            V+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   277 bits (708),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASM+A F GLKS ASFPVT+K   D TSI++NG RV+CM VWPP   KK+ETLSYL
Sbjct  16   NAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVECMLVWPPINKKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV+ E++E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  DATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   276 bits (707),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  88   ASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLS  267
            +SMVAPFTGLKSTA+FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+
Sbjct  21   SSMVAPFTGLKSTATFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLT  80

Query  268  TEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  447
             EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQ
Sbjct  81   DEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQ  140

Query  448  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            V+AE++ECK AYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  141  VLAEVQECKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   276 bits (706),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSY  252
              AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSY
Sbjct  16   NVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSY  75

Query  253  LPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGC  432
            LP LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGC
Sbjct  76   LPDLSDEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGC  135

Query  433  TDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            TDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  136  TDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  179



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   276 bits (706),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            +  QA+MVAPFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYL
Sbjct  18   SPVQAAMVAPFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+  QL K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PPLTPTQLAKEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKKAYP A+VRI+GFDNKRQVQCI FIA+KP
Sbjct  137  DSAQVLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  178



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   276 bits (706),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSY  252
              AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSY
Sbjct  16   NVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSY  75

Query  253  LPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGC  432
            LP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE ++SPGYYDGRYWTMWKLPMFGC
Sbjct  76   LPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYREHNSSPGYYDGRYWTMWKLPMFGC  135

Query  433  TDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            TD TQV+AE++E K AYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  136  TDGTQVLAEVQEAKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   276 bits (706),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            +  QA+MVAPFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYL
Sbjct  18   SPVQAAMVAPFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+  QL K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PPLTPTQLAKEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKKAYP A+VRI+GFDNKRQVQCI FIA+KP
Sbjct  137  DSAQVLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  178



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +1

Query  88   ASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLS  267
             SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP   KK+ETLSYLP L+
Sbjct  21   GSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINTKKYETLSYLPDLT  80

Query  268  TEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  447
             EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQ
Sbjct  81   DEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQ  140

Query  448  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            V+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS A FPV +K   D TSI+ NG RVQCMQVWPP G KKFETLSYLPP
Sbjct  20   AQANMVAPFTGLKSMAGFPV-RKVNNDITSIANNGGRVQCMQVWPPIGKKKFETLSYLPP  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+TEQLLK+VEYLL KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DA
Sbjct  79   LTTEQLLKEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDA  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            TQV+ EL+E  KAYP A+VRI+GFDN RQVQCI FIA++P
Sbjct  139  TQVLKELDEAVKAYPNAFVRIIGFDNVRQVQCISFIAHRP  178



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +1

Query  88   ASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLS  267
             SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+
Sbjct  21   GSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLT  80

Query  268  TEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  447
             EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQ
Sbjct  81   DEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDTTQ  140

Query  448  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            V+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  22   AQASMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPP  80

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E L K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  81   LSPESLAKEVDYLLRKNWVPCLEFELETGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDS  140

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  141  SQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  180



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  17   TPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPLGLKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QVV E+EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  136  DPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  177



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  17   TPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPLGLKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QVV E+EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  136  DPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  177



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKS A FPV +K+  D TSI++NG RVQCMQVWPP G KKFETLSYLPP
Sbjct  21   AQASMVAPFTGLKSMAGFPV-RKANNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPP  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+TEQLLK+VEYLL KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DA
Sbjct  80   LTTEQLLKEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDA  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ EL+E  +AYP A+VRI+GFDN RQVQCI FIA++P
Sbjct  140  AQVLKELDEAVRAYPNAFVRIIGFDNVRQVQCISFIAHRP  179



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   275 bits (703),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QASMVAPFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP L
Sbjct  20   QASMVAPFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDL  79

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDAT
Sbjct  80   SEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAT  139

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            QV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  140  QVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QASMVAPFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP L
Sbjct  20   QASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDL  79

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S EQLL++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDAT
Sbjct  80   SQEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAT  139

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            QV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  140  QVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   275 bits (702),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS ASFPVT+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AQATMVAPFTGLKSAASFPVTRKANNDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPD  76

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQL K+V+YLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGC+D+
Sbjct  77   LTDEQLAKEVDYLLRKGWIPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDS  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            TQV+ EL+E KKAYP +++RI+GFDN+RQVQCI FIAYKP
Sbjct  137  TQVLKELDEAKKAYPNSFIRIIGFDNRRQVQCISFIAYKP  176



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   274 bits (701),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSY  252
              AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSY
Sbjct  16   NVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSY  75

Query  253  LPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGC  432
            LP  S EQLL ++EYLL  GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGC
Sbjct  76   LPDFSDEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGC  135

Query  433  TDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            TDATQV+AE++E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  136  TDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   274 bits (701),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS ++FPVT+K+  D TS+S+NG RVQCMQVWPP   KKFETLSYL
Sbjct  18   SPAQASMVAPFTGLKSVSAFPVTRKTNNDITSLSSNGGRVQCMQVWPPIAKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+AELEE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  138  DSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  179



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   274 bits (700),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +1

Query  88   ASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLS  267
            +SMVAPFTGLKST +FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+
Sbjct  21   SSMVAPFTGLKSTPTFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLT  80

Query  268  TEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  447
             EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQ
Sbjct  81   DEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQ  140

Query  448  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            V+AE++ECK AYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  141  VLAEVQECKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   274 bits (700),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA MVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  18   AQARMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPP  76

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LSTE L K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  77   LSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDS  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  137  SQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   273 bits (699),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T   A+MVAPFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  13   TVNHANMVAPFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYL  72

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWVPCLEFETEKGFVYRE   SPGYYDGRYWTMWKLPMFG T
Sbjct  73   PPLTVEQLAKEVEYLIRKGWVPCLEFETEKGFVYRENLKSPGYYDGRYWTMWKLPMFGTT  132

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ ELEE KKAYP A++RI+GFDNKRQVQCI FIA++P+
Sbjct  133  DASQVLKELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAHRPE  175



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQ+SMVAPFT LKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  18   SPAQSSMVAPFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS+EQL K+V+YLL K  +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC 
Sbjct  78   PPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCN  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ ELEECKKAYP A++RI+GFDNKRQVQ I FIAYKP
Sbjct  138  DSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKP  179



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   273 bits (698),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPF+GLKS  +FPVT+K+  D +S+ +NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   TPAQASMVAPFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+AELEE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  138  DSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  179



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   273 bits (697),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   TPAQASMVAPFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCT
Sbjct  74   PPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D +QVVAELEE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  175



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   273 bits (697),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYL
Sbjct  17   TPAQASMVAPFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D +QVVAELEE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  DPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  177



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   272 bits (696),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +1

Query  88   ASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLS  267
             SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP   KK+ETLSYLP L+
Sbjct  21   GSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINTKKYETLSYLPDLT  80

Query  268  TEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  447
             EQLLK+VEYLL  GWVPCLEFETE G VYRE H SPGYYDGRYW MWKLPMFGCTDATQ
Sbjct  81   DEQLLKEVEYLLKNGWVPCLEFETEHGIVYREKHKSPGYYDGRYWNMWKLPMFGCTDATQ  140

Query  448  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            V+AE++ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   272 bits (695),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYL
Sbjct  18   TPAQATMVAPFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCT
Sbjct  78   PPLSIESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDDK  570
            DATQV+AEL+E  K YP + +RI+GFDNKRQVQCI FIAYKP  K
Sbjct  138  DATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPPAK  182



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   272 bits (695),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   AAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLP  258
             AQASMVAPFTGLKS ++FPVT+KS+ D +++ +NG +VQCMQVWPP G KKFETLSYLP
Sbjct  21   GAQASMVAPFTGLKSVSAFPVTRKSSNDLSTVPSNGGKVQCMQVWPPLGKKKFETLSYLP  80

Query  259  PLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTD  438
            PLS E LLK+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD
Sbjct  81   PLSEESLLKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTD  140

Query  439  ATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             +QVVAELEE KKAYP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  141  PSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  181



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   271 bits (694),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            +QA MVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  22   SQARMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPP  80

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS+E L K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  81   LSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDS  140

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  141  SQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   271 bits (694),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   TPAQASMVAPFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCT
Sbjct  74   PPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D +QVVAELEE KKAYP A+ RI+GFDN RQVQCI FIAYKP
Sbjct  134  DPSQVVAELEEAKKAYPEAFTRIIGFDNVRQVQCISFIAYKP  175



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   271 bits (694),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QASMVAPFTGLKS ++FP+T+K+ +D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL
Sbjct  21   QASMVAPFTGLKSASAFPITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPL  80

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            ++E L K+V++LL   WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+
Sbjct  81   TSESLAKEVDFLLRNKWVPCLEFELEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDAS  140

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  141  QVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   271 bits (693),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+TEQL +++EYLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PDLTTEQLAREIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +A+QV+ ELEE KKAYP ++VRI+GFDN RQVQCI FIA KP
Sbjct  137  EASQVLIELEEAKKAYPNSFVRIIGFDNTRQVQCISFIASKP  178



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   271 bits (693),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQASMVAPFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E+LLK++EYLL   WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PPLSREELLKEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QV+ EL+E  K YP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  137  DPLQVLKELDEAIKTYPNAFVRIIGFDNKRQVQCISFIAYKP  178



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   271 bits (693),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA MVAPF GLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  22   AQARMVAPFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPP  80

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS+E L K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  81   LSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDS  140

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  141  SQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   271 bits (692),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA MVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  18   AQARMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPP  76

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LSTE L K+V+YLL K WVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  77   LSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDS  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  137  SQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  176



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA MVAPFTGLKS+++ PVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  22   AQARMVAPFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPP  80

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LSTE L K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  81   LSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDS  140

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  141  SQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKS A+FPVTK S+ D +S+ +NG RVQCMQVWPP G KKFETLSYL
Sbjct  20   TGAQASMVAPFTGLKSIAAFPVTK-SSNDLSSLPSNGGRVQCMQVWPPLGKKKFETLSYL  78

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+TE LL +V+YLLNKGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  79   PPLTTEALLGEVQYLLNKGWIPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCT  138

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            D  QVV ELEE KKAYP A+VRI+GFD  RQVQCI FIAYKP+
Sbjct  139  DPAQVVNELEEVKKAYPQAFVRIIGFDKNRQVQCISFIAYKPE  181



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKSTA+FPVT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLP 
Sbjct  20   AQASMVAPFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPQ  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQL K+V+YLL  GWVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  79   LTQEQLSKEVDYLLRSGWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDS  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E+EECKK YP A++RI+GFDN RQVQCI FIA+KP
Sbjct  139  SQVLKEVEECKKEYPNAYIRIIGFDNVRQVQCISFIAFKP  178



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G+KK+ETLSYL
Sbjct  9    TPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPIGMKKYETLSYL  67

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+TE LL +V+YLLNKGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGCT
Sbjct  68   PPLTTESLLAEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCT  127

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  549
            D  QVV EL+ECKKAYP A++RI+GFDNKRQVQCI FI
Sbjct  128  DPAQVVNELDECKKAYPNAFIRIIGFDNKRQVQCISFI  165



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   270 bits (691),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+TEQL +++EYLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PDLTTEQLAQEIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +A+QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIA KP
Sbjct  137  EASQVLIELEEAKKAYPNSFIRIIGFDNTRQVQCISFIASKP  178



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   270 bits (691),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQASMVAPFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E+LLK++EYLL   WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PPLSREELLKEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QV  EL+E  K YP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  137  DPLQVFKELDEAIKTYPNAFVRIIGFDNKRQVQCISFIAYKP  178



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYL
Sbjct  18   TPAQATMVAPFTGLKSTAAFPATQKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCT
Sbjct  78   PPLSLESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DATQV+AEL+E  K YP + +RI+GFDNKRQVQCI FIAYKP
Sbjct  138  DATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKP  179



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   270 bits (689),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T  +ASM APFTGLKS ASFPV +K  +D T+I+ NG RVQCM VWPP G KKFETLSYL
Sbjct  8    TTVKASMGAPFTGLKSMASFPVPRKVNSDITTIANNGGRVQCMLVWPPLGRKKFETLSYL  67

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+VEYLL KGWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC+
Sbjct  68   PPLSIESLTKEVEYLLRKGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCS  127

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DA+QV+ ELEECKK YP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  128  DASQVMKELEECKKEYPTAFVRIIGFDNKRQVQCISFIAYKP  169



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   270 bits (689),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            +  QA+MVAPFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYL
Sbjct  18   SPVQAAMVAPFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+  QL K+++YLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PPLTPTQLAKEIDYLLRSGWVPCLEFETE-GFVYREHHHSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKKAYP A+VRI+GFDNKRQVQCI FIA+KP
Sbjct  136  DSAQVLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  177



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   269 bits (688),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QASMVAPFTGLKS  SFPV++K     TSI++NG RVQCMQVWPP   KK+ETLSYLP L
Sbjct  20   QASMVAPFTGLKSATSFPVSRKQNLYITSIASNGGRVQCMQVWPPINKKKYETLSYLPDL  79

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S EQLL++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDAT
Sbjct  80   SEEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAT  139

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            QV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  140  QVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   269 bits (688),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMV PF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYL
Sbjct  17   TPAQASMVVPFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L+K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D +QVVAEL E KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  DPSQVVAELREAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   269 bits (687),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSIS--TNGSRVQCMQVWPPFGLKKFETLS  249
            T AQASMVAPFTGLKS ++FPVT+K+  D TS+   +NG RVQCMQVWPP G KKFETLS
Sbjct  18   TPAQASMVAPFTGLKSASAFPVTRKANNDITSLPLPSNGGRVQCMQVWPPTGKKKFETLS  77

Query  250  YLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFG  429
            YLPPLS E L K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFG
Sbjct  78   YLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFG  137

Query  430  CTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            CTD++QV+AELEE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  138  CTDSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  181



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   269 bits (687),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  91   SMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLST  270
            +MVAPF GLKS ++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPL+T
Sbjct  21   NMVAPFNGLKSASAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLTT  79

Query  271  EQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQV  450
            EQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QV
Sbjct  80   EQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQV  139

Query  451  VAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  567
            V E+EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP D
Sbjct  140  VNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKPKD  178



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+TEQL K+++YLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PDLTTEQLAKEIDYLLRMKWVPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             A+QV+ ELEE KKAYP +++RI+GFDN RQVQCI FIA KP
Sbjct  137  QASQVLIELEEAKKAYPNSFIRIIGFDNVRQVQCISFIASKP  178



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA++VAPFTGLKS ++FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYL
Sbjct  16   SPAQATLVAPFTGLKSASAFPTTRKNNRDITSIASNGGRVQCMQVWPPLGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL  GW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PDLTPVQLAKEVDYLLRSGWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ ELEE KKAYP A++RI+GFDN+RQVQCI FIAYKP
Sbjct  136  DSSQVLKELEEAKKAYPDAFIRIIGFDNRRQVQCISFIAYKP  177



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  79   AAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLP  258
             AQA+MVAPF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLP
Sbjct  21   GAQANMVAPFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLP  79

Query  259  PLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTD  438
            PLS  QLL QV+YLLNKGW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD
Sbjct  80   PLSDAQLLAQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTD  139

Query  439  ATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  567
              QV+ E+EE KKAYP A++RI+GFDNKRQVQC+ FIAYKP D
Sbjct  140  PAQVLNEVEEAKKAYPTAFIRIIGFDNKRQVQCVSFIAYKPAD  182



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKST++FPVT+K+  D T+++ NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  20   AQASMVAPFTGLKSTSAFPVTRKTNTDITTLANNGGRVQCMQVWPPLGKKKFETLSYLPD  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQL K+VEYLL KGWVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGC+DA
Sbjct  80   LTREQLAKEVEYLLRKGWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCSDA  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ EL+E  KAYP ++VRI+GFDN RQVQCI FIAYKP
Sbjct  140  VQVLKELDEAIKAYPNSFVRIIGFDNVRQVQCISFIAYKP  179



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPP
Sbjct  20   AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPP  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E LLK++ YLL  GW+PCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPM+GCTDA
Sbjct  80   LSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDA  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            TQV+ E+ E +K YP ++VRI+GFDNKRQVQCI F+A KP
Sbjct  140  TQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP  179



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QASMVAPFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP L
Sbjct  20   QASMVAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDL  79

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S  QLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDAT
Sbjct  80   S--QLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAT  137

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            QV+AE+EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  138  QVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  177



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPF GLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP GLKK+ETLSYLP 
Sbjct  20   AQASMVAPFNGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPRGLKKYETLSYLPD  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQLLK+++YL+  GWVPCLEFE EKGFVYRE+H SPGYYDGRYWTMWKLPM+GCTDA
Sbjct  79   LTDEQLLKEIDYLIRSGWVPCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDA  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            TQV+ E+ EC K YP  WVRI+GFDN RQVQCI FIA KP
Sbjct  139  TQVLNEVGECLKEYPNCWVRIIGFDNVRQVQCISFIAAKP  178



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ QA++VAPFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  16   SSTQANLVAPFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL+K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  76   PPLTEEQLVKEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ EL E K AYP +++RI+GFDN RQVQCI FIA+ P
Sbjct  136  DSSQVLKELAEAKAAYPESFIRIIGFDNVRQVQCISFIAHTP  177



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQ WPP G+KK+ETLSYL
Sbjct  9    TPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQAWPPIGMKKYETLSYL  67

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+TE LL +V+YLLNKGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGC 
Sbjct  68   PPLTTESLLAEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCI  127

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  549
            D  QVV EL+ECKKAYP A++RI+GFDNKRQVQCI FI
Sbjct  128  DPAQVVNELDECKKAYPNAFIRIIGFDNKRQVQCISFI  165



>ref|XP_006430779.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44019.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=182

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPP
Sbjct  20   AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPP  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E LLK++ YL+  GW+PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPM+GCTDA
Sbjct  80   LSDEALLKEISYLIRSGWIPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMYGCTDA  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            TQV+ E+ E +K YP ++VRI+GFDNKRQVQCI FIA KP
Sbjct  140  TQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKP  179



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   267 bits (682),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T+AQASMVAPFTGLKS  +FPVTKKS  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYL
Sbjct  16   TSAQASMVAPFTGLKSNVAFPVTKKSN-DFSSLPSNGGRVQCMKVWPPLGLKKYETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+  QL K+VEYLL   WVPCLEFE E GF YRE + SPGYYDGRYWTMWKLPMFGC 
Sbjct  75   PPLTETQLAKEVEYLLRNKWVPCLEFELEHGFPYRENNRSPGYYDGRYWTMWKLPMFGCN  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL ECKK YP +WVRI+GFDN RQVQCI FIA+KPD
Sbjct  135  DASQVLKELNECKKEYPQSWVRIIGFDNVRQVQCISFIAHKPD  177



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QASMVAPF GLKS ++FPVT+K A D T++++NG RVQCMQVWPP GLKKFETLSYLPPL
Sbjct  20   QASMVAPFNGLKSASAFPVTRK-ANDITTLASNGGRVQCMQVWPPVGLKKFETLSYLPPL  78

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S E L K+VEYLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTDA+
Sbjct  79   SVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTDAS  138

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            QV+AELEE KK YP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  139  QVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKP  177



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ QA++VAPFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  16   SSTQANLVAPFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  76   PPLTEEQLAKEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ EL E K AYP +++RI+GFDN RQVQCI FIA+ P
Sbjct  136  DSSQVLKELAEAKAAYPESFIRIIGFDNVRQVQCISFIAHTP  177



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   266 bits (681),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKSTA+FPVT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLPP
Sbjct  20   AQASMVAPFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPP  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ E+L K+V+YLL  GWVPCLEFE E G+VYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  79   LTNEELAKEVDYLLRSGWVPCLEFELEHGWVYRENHRSPGYYDGRYWTMWKLPMFGCTDS  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E+EECKK YP A++RI+GFDN RQVQCI FIA+KP
Sbjct  139  SQVLNEVEECKKEYPNAFIRIIGFDNVRQVQCISFIAFKP  178



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   266 bits (680),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS A+FPVT+K+  D T++++NG RVQCM+VWPP GLKKFETLSYL
Sbjct  18   SPAQASMVAPFTGLKSAAAFPVTRKNN-DITTLASNGGRVQCMKVWPPLGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P +S EQL K+V+YLL KGW+PC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PDMSNEQLGKEVDYLLRKGWIPCIEFDIHSGFVYRENHRSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QVV E+EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  137  DSSQVVNEIEEAKKEYPDAYIRVIGFDNVRQVQCISFIAYKP  178



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQ++MVAPF GL+S+A+ P T+K+ AD +++ +NG + +CMQVWPP GLKKFETLSYL
Sbjct  16   TPAQSNMVAPFNGLRSSAALPATRKANADLSTLLSNGGKARCMQVWPPEGLKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLSTE L K+VEYL+  GW+PC+EF  E GFVYRE+HASPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLSTEALAKEVEYLIRNGWIPCIEFSKE-GFVYREYHASPGYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DA+QV+AE+EE KKAYP  +VRI+GFDNKRQVQC+ FIAYKP
Sbjct  135  DASQVIAEVEEAKKAYPDYFVRIIGFDNKRQVQCVSFIAYKP  176



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G KKFETLSYLPP
Sbjct  10   AQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPVGKKKFETLSYLPP  68

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+TE LL +V+YLLNKGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD 
Sbjct  69   LTTESLLSEVQYLLNKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDP  128

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  549
            TQVV ELEE KKAYP A++RI+GFD+ RQVQCI FI
Sbjct  129  TQVVNELEEAKKAYPNAFIRIIGFDSFRQVQCISFI  164



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +1

Query  79   AAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLP  258
            A QASMVAPFTGLKS++ FPVT+K   D T++++NG +V CMQVWPP G KKFETLSYLP
Sbjct  17   APQASMVAPFTGLKSSSVFPVTRKQNNDITTLASNGGKVHCMQVWPPVGKKKFETLSYLP  76

Query  259  PLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTD  438
            PLS E L K+V+YLL  GWVPCLEFE E GFVYRE H SPGYYDGR WTMWKLPMFGCTD
Sbjct  77   PLSEESLAKEVDYLLRMGWVPCLEFELEHGFVYRENHRSPGYYDGRCWTMWKLPMFGCTD  136

Query  439  ATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            ++QV+ ELEE KKAYP +++RI+GFDNKRQVQCI FIAYKP
Sbjct  137  SSQVLKELEEAKKAYPNSFIRIIGFDNKRQVQCISFIAYKP  177



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYL
Sbjct  17   TPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FIAYKP
Sbjct  136  DPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  177



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYL
Sbjct  17   TPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FIAYKP
Sbjct  136  DPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  177



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYL
Sbjct  17   SGAQANMVAPFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS  QLL QV+YLLN GW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCT
Sbjct  76   PPLSDAQLLAQVQYLLNNGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D  QV+ E+EE KKAYP A++RI+GFDNKRQVQC+ FIA+KP
Sbjct  136  DPAQVLNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAFKP  177



>sp|O65194.1|RBS_MEDSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Medicago sativa]
 gb|AAC13293.1| ribulose-1,5-bisphosphate carboxylase small subunit [Medicago 
sativa]
Length=180

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++AQA++VAPFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  16   SSAQANLVAPFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGW+PCLEFE EKGFVYRE H SPGYYDGRYWTMW+LP+FG T
Sbjct  76   PPLTEEQLAKEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGAT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  567
            D++QV+ EL +CK  YP +++RI+GFDN RQVQCI FIA+ P +
Sbjct  136  DSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAHTPKN  179



>sp|Q42516.1|RBS1_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37438.1|AF150665_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
 emb|CAA60636.1| ribulose 1,5-bisphosphate carboxylase-oxygenase [Amaranthus hypochondriacus]
Length=183

 Score =   265 bits (676),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   SMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLST  270
            SMVAPF GLKS A+FP+TKKS+ DF+S+ +NG RVQCMQVWPP G KKFETLSYLPPLS 
Sbjct  23   SMVAPFNGLKSFATFPITKKSSNDFSSLPSNGGRVQCMQVWPPVGKKKFETLSYLPPLSD  82

Query  271  EQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQV  450
             QLL QV+YLLNKGW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV
Sbjct  83   AQLLAQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQV  142

Query  451  VAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            + E+EE KKAYP A++RI+GFDNKRQVQC+ FIAYKP
Sbjct  143  LNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAYKP  179



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   264 bits (675),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS A+FP TKK A DF+++ +NG RVQCM+VWPP GLKK+ETLSYLPP
Sbjct  17   AQANMVAPFTGLKSNAAFPTTKK-ANDFSTLPSNGGRVQCMKVWPPLGLKKYETLSYLPP  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YLL K WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  76   LTETQLAKEVDYLLRKKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
             QV+ EL ECKK YP AW+RI+GFDN RQVQCIMFIA +PD
Sbjct  136  AQVMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPD  176



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   264 bits (674),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  18   TPAQANMVAPFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+ E+L K+++YLL   WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTEEELAKEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +A+QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  138  EASQVLLELEEAKKAYPNAFIRIIGFDNTRQVQCISFIAAKP  179



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQAS+VAPFTGLKS ++FP TKK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPP
Sbjct  21   AQASLVAPFTGLKSASAFPGTKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPP  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E L K+V+YLL K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  80   LSPESLAKEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDS  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKA P +++RI+GFDN RQVQCI FIAYKP
Sbjct  140  SQVLKELEEAKKANPNSFIRIIGFDNVRQVQCISFIAYKP  179



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASM APFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPP
Sbjct  14   AQASMAAPFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPP  73

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YL+  GW+PCLEF  + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  74   LTQAQLGKEVDYLIRLGWIPCLEFSVQGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDS  133

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E+EECKK YP +++RI+GFDNKRQVQCI FI YKP
Sbjct  134  SQVLKEVEECKKEYPQSFIRIIGFDNKRQVQCISFICYKP  173



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QA+MVAPF+GLKST++FPV++KS  D TS++TNG RV CMQVWPP  LKKFETLSYLP L
Sbjct  18   QANMVAPFSGLKSTSAFPVSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFETLSYLPTL  77

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S E LLK++ YLL KGWVPCLEFE     VYRE + SPGYYDGRYWTMWKLPMFGCTDA+
Sbjct  78   SEESLLKEINYLLIKGWVPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDAS  137

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            QV AE+ ECK AYP A VRI+GFDNKRQVQCI FIAYKP+
Sbjct  138  QVAAEVVECKNAYPDAHVRIIGFDNKRQVQCISFIAYKPE  177



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS+A FP+T+K+  D T++++NG +VQCM+VWPP GL+KFETLSYL
Sbjct  18   SPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ E+EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  138  DSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS+A FP+T+K+  D T++++NG +VQCM+VWPP GL+KFETLSYL
Sbjct  18   SPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ E+EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  138  DSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQANMVAPFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+ EQL K+V+YLL KGWVPCLEFE   GF YRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTDEQLRKEVDYLLRKGWVPCLEFEVGYGFPYRENHRSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ EL+E K AYP A+VRI+GFDN RQVQCI FIAYKP
Sbjct  138  DSGQVIKELQEAKAAYPKAFVRIIGFDNVRQVQCISFIAYKP  179



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPF GLKSTA+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  18   TPAQANMVAPFNGLKSTAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+ E+L K+++YLL   WVPCLEFE EKG+V+RE H+SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTEEELAKEIDYLLRSKWVPCLEFELEKGWVHREHHSSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +A+QV+ EL E KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  138  EASQVLVELGEAKKAYPNAFIRIIGFDNTRQVQCISFIAAKP  179



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T  QA+MVAPF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  18   TPVQANMVAPFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+ E+L K+++YLL   WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTEEELAKEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +A+QV+ ELEE KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  138  EASQVLLELEEAKKAYPNAFIRIIGFDNTRQVQCISFIAAKP  179



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   261 bits (667),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +1

Query  91   SMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLST  270
            +MVAPF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G+KKFETLSYLPPLS 
Sbjct  23   NMVAPFNGLKSISAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGMKKFETLSYLPPLSE  81

Query  271  EQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQV  450
            E LLK+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QV
Sbjct  82   ESLLKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQV  141

Query  451  VAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            VAELEE KKAYP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  142  VAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  178



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score =   262 bits (669),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPP
Sbjct  14   AQASMVAPFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPP  73

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YL+  GW+PCLEF    GFVYRE + SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  74   LTQVQLGKEVDYLIRLGWIPCLEFSVVGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDS  133

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E+EECKK YP A++RI+GFDNKRQVQCI FIA KP
Sbjct  134  SQVLKEVEECKKEYPQAFIRIIGFDNKRQVQCISFIACKP  173



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   261 bits (668),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQAS+VAPFTGLKS ++FP  KK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPP
Sbjct  22   AQASLVAPFTGLKSASAFPGAKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPP  80

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E L K+V+YLL K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  81   LSPESLAKEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDS  140

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ ELEE KKA P +++RI+GFDN RQVQCI FIAYKP
Sbjct  141  SQVLKELEEAKKANPNSFIRIIGFDNVRQVQCISFIAYKP  180



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   261 bits (668),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  17   TPAQANMVAPFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+++YLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PDLTEAELAKEIDYLLRSKWVPCLEFELEKGWVYRENHRSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +A+QV+ EL+E KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  137  EASQVLVELQEAKKAYPNAFIRIIGFDNVRQVQCISFIAAKP  178



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   261 bits (667),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   ASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLS  267
            A++VAPFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+
Sbjct  17   ANLVAPFTGLKSSAGFPVTKKTNNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLT  76

Query  268  TEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  447
             +QL K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++Q
Sbjct  77   EDQLAKEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQ  136

Query  448  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            V+ EL E K AYP +++RI+GFDN RQVQCI FIA+ P
Sbjct  137  VLKELAEAKAAYPESFIRIIGFDNVRQVQCISFIAHTP  174



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   261 bits (667),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQ+SMVAPF GL+S+ +FP T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPP
Sbjct  18   AQSSMVAPFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPP  77

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E L K+V+YLL   WVPC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA
Sbjct  78   LSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDA  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAYKP
Sbjct  137  SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   261 bits (667),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   261 bits (666),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   260 bits (664),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75349.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75350.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   259 bits (663),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSQEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +1

Query  91   SMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLST  270
            +MVAPF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS 
Sbjct  23   NMVAPFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSE  81

Query  271  EQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQV  450
            E L+K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QV
Sbjct  82   ESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQV  141

Query  451  VAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            VAELEE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  142  VAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  178



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   259 bits (663),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSVEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +1

Query  91   SMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLST  270
            +MVAPF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS 
Sbjct  23   NMVAPFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSE  81

Query  271  EQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQV  450
            E L+K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QV
Sbjct  82   ESLIKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQV  141

Query  451  VAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            VAELEE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  142  VAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  178



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNKDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   259 bits (661),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASM+APFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMIAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP 
Sbjct  20   AQASMVAPFTGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPD  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQLLK+++YL+  GW+PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  79   LTDEQLLKEIDYLIRNGWIPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDA  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            TQV+ E+ EC K YP  WVRI+GFDN RQVQCI FIA KP
Sbjct  139  TQVLKEVRECLKEYPNCWVRIIGFDNVRQVQCISFIAAKP  178



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T+ QAS+ APFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYL
Sbjct  16   TSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+++YL+   W+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+ ECKK YP A++R++GFDN RQVQCI FI  KP
Sbjct  136  DSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKP  177



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   259 bits (662),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQ +MVAPF GL+S+ +FP T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPP
Sbjct  18   AQTNMVAPFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPP  77

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E L K+V+YLL   WVPC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA
Sbjct  78   LSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDA  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAYKP
Sbjct  137  SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   258 bits (660),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>ref|XP_010926041.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   259 bits (662),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQ+SMVAPFTGLKST++FPVT++++ DF+ + +NG RV+CMQVWP  G KKFETLSYL
Sbjct  17   TPAQSSMVAPFTGLKSTSAFPVTRRASNDFSKLPSNGGRVRCMQVWPIEGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E LLKQ+EYLL  GW+PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC 
Sbjct  77   PPLSIEALLKQIEYLLRSGWIPCLEF-CKVGFVYRENHQSPGYYDGRYWTMWKLPMFGCN  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DA QV  EL+ECKK YP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  DAAQVAKELDECKKEYPDVFIRIIGFDNVRQVQCISFIAYKP  177



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score =   259 bits (662),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKS+A FP+T+K+  D T++++N  +VQCM+VWPP GL+KFETLSYLP 
Sbjct  20   AQASMVAPFTGLKSSAGFPITRKNNVDITTLASNAGKVQCMKVWPPLGLRKFETLSYLPD  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H SPG+YDGRYWTMWKLPMFGCTD+
Sbjct  80   MSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGFYDGRYWTMWKLPMFGCTDS  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E+EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  140  SQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>gb|AIF75355.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75356.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   258 bits (659),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   258 bits (659),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|AAF19793.1|AF162210_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Lactuca sativa]
Length=181

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQAS+ APFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYL
Sbjct  16   TPAQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+++YL+   WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  76   PPLSDEALSKEIDYLIRNKWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+ ECKK YP A++R++GFD+ RQVQCI FI  KP
Sbjct  136  DSAQVMKEVGECKKEYPNAFIRVIGFDSVRQVQCISFIVSKP  177



>gb|AIF75357.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75358.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   258 bits (658),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYL
Sbjct  1    NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+ E KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVGEAKKAYPEAWIRIIGFDNVRQV  152



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
              AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>ref|XP_008352922.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  19   SPAQASMVAPFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCT
Sbjct  78   PPLSPESLAKEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ E EE K AYP +++RI+GFDN RQ QCI FIAY+P
Sbjct  138  DSSQVLKEXEEAKTAYPNSFIRIIGFDNVRQTQCISFIAYQP  179



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVEECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 1/158 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T+AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYL
Sbjct  9    TSAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYL  67

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  68   PPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCT  127

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  549
            D  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  128  DPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>ref|XP_008339672.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPP
Sbjct  21   AQASMVAPFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPP  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E L K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD+
Sbjct  80   LSPESLAKEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDS  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E+EE K AYP +++RI+GFDN RQ QCI FIAY+P
Sbjct  140  SQVLKEVEEAKTAYPNSFIRIIGFDNVRQTQCISFIAYQP  179



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  75   PDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  135  DSAQVLKELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  75   PDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  135  DSAQVLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QA+MVAPFTGLKS+A+FPVT K+  D TS+++NGS+V CMQVWPP G KKFETLSYLP L
Sbjct  21   QANMVAPFTGLKSSAAFPVTHKTNFDITSLASNGSKVHCMQVWPPVGKKKFETLSYLPDL  80

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S   L K+V+YLL   W+PC+EFE E GFVYRE + SPGYYDGRYWTMWKLP+FGCTD++
Sbjct  81   SEVSLAKEVDYLLRNKWIPCVEFELEHGFVYREHNKSPGYYDGRYWTMWKLPLFGCTDSS  140

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  141  QVLKEVEECKKEYPNAFIRIIGFDNSRQVQCISFIAYKP  179



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   257 bits (656),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCT
Sbjct  61   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPRAWIRIIGFDNVRQV  152



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LSDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75288.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA++VAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQATLVAPFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDSELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPEAFIRIIGFDNSRQVQCISFIAYKP  175



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E++ECK  YP A++RI+GFDN RQVQCI+FIAYKP
Sbjct  136  SQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCIIFIAYKP  175



>ref|XP_009356790.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKS ++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYL
Sbjct  19   SPAQASMVAPFTGLKSFSAFPVTRK-ANDITSIASNGGRVQCMQVWPPTGLKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E L K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCT
Sbjct  78   PPLSPESLAKEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D++QV+ ELEE K AYP +++RI+GFDN RQ QCI FIAY+P
Sbjct  138  DSSQVLKELEEAKTAYPNSFIRIIGFDNVRQTQCISFIAYQP  179



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAYKP+
Sbjct  138  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKSTA FP  +K+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPP
Sbjct  20   AQATMVAPFTGLKSTAGFPA-RKTTNDITSIASNGGRVQCMKVWPTQGLKKFETLSYLPP  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQL K+VEYLL  GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  79   LTREQLAKEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDA  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ EL+E  KA+P  +VRI+GFD+ RQVQCI FIAYKP
Sbjct  139  VQVLNELDEAIKAHPNGFVRIIGFDSYRQVQCISFIAYKP  178



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSATFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS A+FPVTKK   DF+++++NG RVQCM+VWPP G K++ETLSYL
Sbjct  10   TVAQANMVAPFTGLKSNAAFPVTKK-VNDFSTLASNGGRVQCMKVWPPLGKKRYETLSYL  68

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCT
Sbjct  69   PNLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCT  128

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            D+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  129  DSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  71

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  72   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  131

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E++ECK  YP A++RI+GFDN RQVQCI+FIAYKP
Sbjct  132  SQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCIIFIAYKP  171



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  138  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A MVAPFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AGAGMVAPFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQ++MVAPF GL+S+ +FP T+K+  + +++ +NG +V CMQVWPP GLKKFETLSYLPP
Sbjct  18   AQSNMVAPFNGLRSSVAFPATRKANKNLSTLPSNGGKVSCMQVWPPEGLKKFETLSYLPP  77

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS E L K+V+YLL   WVPC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA
Sbjct  78   LSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDA  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+AE+EE KKAYP  +VRI+GFDNKRQVQCI FIAYKP
Sbjct  137  SQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   256 bits (655),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS A+FPVTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYL
Sbjct  10   TVAQANMVAPFTGLKSNAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYL  68

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCT
Sbjct  69   PNLTESQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCT  128

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            D+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  129  DSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score =   257 bits (656),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   257 bits (656),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPF GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  14   TPAQATMVAPFNGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVEECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB10449.1| hypothetical protein B456_001G201800 [Gossypium raimondii]
Length=182

 Score =   257 bits (656),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   W+PCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAYKP+
Sbjct  138  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>gb|AIR75136.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
 gb|AIR75137.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   256 bits (654),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYL
Sbjct  9    TPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYL  67

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  68   PPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCT  127

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  549
            D  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  128  DPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>gb|AIL82451.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   256 bits (654),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYL
Sbjct  9    TPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYL  67

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  68   PPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCT  127

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  549
            D  QV+ ELEECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  128  DPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LSDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A MVAPFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AGAGMVAPFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A MVAPFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AGAGMVAPFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YL+   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MV PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AQANMVTPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPD  76

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+
Sbjct  77   LTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDS  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  137  AQVLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L
Sbjct  17   QATMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDL  76

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            S  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ 
Sbjct  77   SDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSA  136

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            QV+ E++ECKK YP A +RI+GFDN RQVQCI FIAYKP
Sbjct  137  QVLKEVQECKKEYPNALIRIIGFDNNRQVQCISFIAYKP  175



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   SPAQANMVAPFTGLKSASAFPVIRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  75   PDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  135  DSAQVLKELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>ref|XP_008807113.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=180

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQ+SMVAPFTGLKST++FP T++++ DF+ + +NG RVQCM+VWP  G+KKFETLSYL
Sbjct  17   TPAQSSMVAPFTGLKSTSAFPATRRASNDFSKLPSNGGRVQCMKVWPIEGVKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL  E LLKQ+EYLL   W+PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC 
Sbjct  77   PPLPIEALLKQIEYLLRSRWIPCLEF-CKIGFVYRENHRSPGYYDGRYWTMWKLPMFGCN  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DA QV  ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  DAAQVAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG +V CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGKVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LSDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   256 bits (654),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS A+FP TKK A DF+++ +NG RVQCM+VWPP G KK+ETLSYLP 
Sbjct  17   AQANMVAPFTGLKSNAAFPATKK-ANDFSTLPSNGGRVQCMKVWPPLGKKKYETLSYLPN  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+
Sbjct  76   LTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
             QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  136  AQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  176



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   256 bits (654),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  71

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  72   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  131

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  132  SQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score =   256 bits (654),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKSTA FP  +K+  D TSI+ NG RVQCM+VWP  GLKKFETLSYLPP
Sbjct  20   AQATMVAPFTGLKSTAGFPA-RKTTNDITSIAGNGGRVQCMKVWPTQGLKKFETLSYLPP  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQL K+VEYLL  GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  79   LTREQLAKEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDA  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ EL+E  KA+P  +VRI+GFD+ RQVQCI FIAYKP
Sbjct  139  VQVLNELDEAIKAHPNGFVRIIGFDSYRQVQCISFIAYKP  178



>gb|AAF06098.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
 gb|AAF06101.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score =   256 bits (654),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKST++FP T K++AD TS+++NG RVQCMQVWP  G KKFETLSYLPP
Sbjct  20   AQASMVAPFTGLKSTSAFPATTKTSADITSLASNGGRVQCMQVWPTRGKKKFETLSYLPP  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS EQL  +++YLL  GW+PCLEFE E GFVYR   + PGYYDGRYWTMWKLPMFGCTD+
Sbjct  80   LSREQLASEIDYLLRSGWIPCLEFELEHGFVYRAHGSLPGYYDGRYWTMWKLPMFGCTDS  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E  KA+P  + RI+GFDN RQVQCI FIAYKP
Sbjct  140  SQVLKELDELIKAHPDGFARIIGFDNVRQVQCISFIAYKP  179



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   256 bits (653),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  14   SPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   255 bits (652),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+ASFP T+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQATMVAPFTGLKSSASFPATRKANNDITSITSNGGRVNCMKVWPPVGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLTDSELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVEECKKEYPEAFIRIIGFDNNRQVQCISFIAYKP  163



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   256 bits (653),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLKS A+FPVTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYL
Sbjct  10   TVAQANMVAPFTGLKSNAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYL  68

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCT
Sbjct  69   PNLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCT  128

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            D+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  129  DSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>ref|XP_009403968.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=181

 Score =   256 bits (653),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQ+SMVAPFTGLKST++FPVT+K+ AD + + +NG RVQCM+VWP  G KKFETLSYLP 
Sbjct  20   AQSSMVAPFTGLKSTSAFPVTRKANADLSHLPSNGGRVQCMKVWPIEGKKKFETLSYLPT  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L  E LLKQ+EYLL   W+PCLEF  E GFV+RE H SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  80   LVDEVLLKQIEYLLRSKWIPCLEFSHE-GFVWRENHRSPGYYDGRYWTMWKLPMFGCTDA  138

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            TQV  ELEECKK YP A+VRI+GFDN RQVQCI FIA+KPD
Sbjct  139  TQVAKELEECKKEYPRAFVRIIGFDNNRQVQCISFIAHKPD  179



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   256 bits (653),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  75   PDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  135  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score =   256 bits (653),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75365.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   254 bits (650),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
             AAQASMVAPFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYL
Sbjct  1    NAAQASMVAPFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYL  60

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTM KLPMFGCT
Sbjct  61   PDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMRKLPMFGCT  120

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQV  531
            DATQV+AE+EE KKAYP AW+RI+GFDN RQV
Sbjct  121  DATQVLAEVEEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   255 bits (651),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  2    SPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YL+   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  163



>ref|XP_007033270.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
 gb|EOY04196.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
Length=184

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQASMVAPFTGLKST++ PV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQASMVAPFTGLKSTSALPVARKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+ E+L K+VEYLL   WVPCLEFE E GFVYRE    PGYYDGR W MWKLPMFGCT
Sbjct  78   PDLTRERLFKEVEYLLRNKWVPCLEFELEHGFVYRENLRIPGYYDGRCWIMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DA+QV+ EL+E KK YP A++RI+GFDN+RQVQCI FIAYKP
Sbjct  138  DASQVLKELDEAKKTYPTAFIRIIGFDNRRQVQCISFIAYKP  179



>gb|AFS41754.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  75   PDLTPVQLAKEVDYLLRSKWVPCLEFELEDGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  135  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75295.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQ +MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQPTMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|AFS41727.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41734.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41742.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            D+ QV+ ELE CKK YP A++RI+GFDN RQVQCI FIAYKP+
Sbjct  138  DSAQVLEELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>gb|KEH21538.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>ref|XP_003637843.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  71

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  72   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  131

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  132  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +1

Query  85   QASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPL  264
            QA+MVAPF+GLKSTASFP+ +K+  D T++++NG RVQCMQVWPP G  KFETLSYLP L
Sbjct  22   QANMVAPFSGLKSTASFPINQKTN-DITALASNGGRVQCMQVWPPRGKLKFETLSYLPDL  80

Query  265  STEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDAT  444
            + EQLLK+++YLL   W+PCLEFE  K  +YRE + SPGYYDGRYWTMWKLPMFGCTDAT
Sbjct  81   TDEQLLKEIDYLLRSNWIPCLEFEVGKAHIYRENNRSPGYYDGRYWTMWKLPMFGCTDAT  140

Query  445  QVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDDK  570
            QV+AE++E KKAYP A VRI+GFDN RQVQCI FIAYKP  K
Sbjct  141  QVLAEVQETKKAYPDAHVRIIGFDNNRQVQCISFIAYKPPAK  182



>gb|AFS41729.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41736.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41751.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=182

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELE CKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  138  DSAQVLKELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>ref|XP_003600302.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>ref|XP_003636970.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = +1

Query  91   SMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLST  270
            +MVAPF GLKS ++FPVT+K+  D TS+++NG RVQCM VWPP G+KKFETLSYLPPLS 
Sbjct  23   NMVAPFNGLKSISAFPVTRKNN-DITSVASNGGRVQCM-VWPPLGMKKFETLSYLPPLSE  80

Query  271  EQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQV  450
            E LLK+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QV
Sbjct  81   ESLLKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQV  140

Query  451  VAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            VAELEE KKAYP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  141  VAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  177



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  10   SPAQAAMVAPFTGLKSSAAFPVTRKTDTDITSIASNGGRVNCMKVWPPVGKKKFETLSYL  69

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  70   PDLTDVELSKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  129

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  130  DSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AFS41725.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB43047.1| hypothetical protein B456_007G181300 [Gossypium raimondii]
 gb|KJB43048.1| hypothetical protein B456_007G181400 [Gossypium raimondii]
Length=179

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCT
Sbjct  75   PDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  135  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP 
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPD  71

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  72   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  131

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  132  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  163



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS A+FP TKK A DF+++  NG RVQCM+VWPP GLKK+ETLSYLP 
Sbjct  17   AQANMVAPFTGLKSNAAFPATKK-ANDFSTLPNNGGRVQCMKVWPPLGLKKYETLSYLPT  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGR+WTMWKLPMFGCTD+
Sbjct  76   LTETQLAKEVDYLLRNKWVPCLEFELEHGFVYREHARSPGYYDGRHWTMWKLPMFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
             QV+ E+ ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  136  AQVLKEVGECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  176



>sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Gossypium hirsutum]
 emb|CAA38026.1| ribulose bisphosphate carboxylase [Gossypium hirsutum]
 gb|AEX60834.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41721.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41726.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41741.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41749.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41755.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG14838.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  18   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  78   PDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  137

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELE CKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  138  DSAQVLEELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A+A+MV PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   ARANMVTPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPD  76

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+
Sbjct  77   LTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDS  136

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  137  AQVLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|ABA46901.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
Length=181

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQ+SMVAPFTGLKST++FPVT+K+ AD + + +NG RVQCM+VWP  G KKFETLSYL
Sbjct  18   SPAQSSMVAPFTGLKSTSAFPVTRKANADLSHLPSNGGRVQCMKVWPIEGKKKFETLSYL  77

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L  E LLKQ+EYLL   W+PCLEF  E GFV+RE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  78   PTLVDEVLLKQIEYLLRSKWIPCLEFSHE-GFVWRENHRSPGYYDGRYWTMWKLPMFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DATQV  ELEECKK YP A+V I+GFDN RQVQCI FIA+KPD
Sbjct  137  DATQVAKELEECKKEYPRAFVGIIGFDNNRQVQCISFIAHKPD  179



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|ACQ90230.1| virus-resistance protein [Brassica rapa subsp. chinensis]
Length=249

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  84   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  143

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  144  LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  203

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  204  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  243



>ref|XP_010916368.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQ+SMVAPFTGLKST++FP T++++  F+ + +NG RVQCM+VWP  GLKKFETLSYL
Sbjct  17   TPAQSSMVAPFTGLKSTSAFPATRRASNGFSKLPSNGGRVQCMKVWPIEGLKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPLS E LLKQ+EYLL  GW+PCLEF  + GFV R+ + SPGYYDGRYWTMWKLPMFGC 
Sbjct  77   PPLSIEALLKQIEYLLRSGWIPCLEF-CKVGFVSRDNNRSPGYYDGRYWTMWKLPMFGCN  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DATQV  ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  DATQVAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>gb|KHG18747.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL  
Sbjct  20   AQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLTD  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+
Sbjct  80   LTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDS  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ ELEECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  140  AQVLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>sp|P17673.1|RBS_TRIRP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Trifolium repens]
 emb|CAA36542.1| ribulose bisphosphate carboxylase [Trifolium repens]
Length=178

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
             QA++  PFTGLKS+A FPVTKK+  D TSI++NGSRV CMQVWPP G KKFETLSYLPP
Sbjct  17   VQANLATPFTGLKSSAGFPVTKKNN-DITSITSNGSRVNCMQVWPPVGKKKFETLSYLPP  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+ EQLLK+VEYLL KGWVPC+EFE EKGFV+R++++SPGYYDGRYWTMW+LP+FG TDA
Sbjct  76   LTDEQLLKEVEYLLRKGWVPCVEFELEKGFVHRQYNSSPGYYDGRYWTMWRLPLFGTTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+ ECK  YP A++RI+GFDN RQVQCI FIA  P
Sbjct  136  AQVLKEVAECKAEYPEAFIRIIGFDNVRQVQCISFIASTP  175



>emb|CDX99682.1| BnaC04g34390D [Brassica napus]
Length=189

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|NP_001119331.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 gb|AED94313.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=186

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 5/165 (3%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFE-----TEKGFVYREWHASPGYYDGRYWTMWKLPMF  426
            LS  +L K+V+YLL   W+PC+EFE     T+ GFVYRE   +PGYYDGRYWTMWKLP+F
Sbjct  76   LSDVELAKEVDYLLRNKWIPCVEFELEVINTKHGFVYREHGNTPGYYDGRYWTMWKLPLF  135

Query  427  GCTDATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            GCTD+ QV+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  136  GCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  180



>ref|XP_006391472.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
 gb|ESQ28758.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
Length=181

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E  FV+RE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTEVELAKEVDYLLRNKWIPCVEFELENAFVHREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKKEYPQAFIRIIGFDNTRQVQCISFIAYKP  175



>emb|CDY67657.1| BnaCnng55860D [Brassica napus]
Length=181

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TS+++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQAAMVAPFTGLKSSAAFPVTRKTDTDITSMASNGGRVNCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELSKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFV+RE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTEVELAKEVDYLLRNKWIPCVEFELENGFVHREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKKEYPQAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AEX60843.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41739.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41747.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41760.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  15   SPAQANMVAPFTGLKSASAFPVIRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYL  74

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCT
Sbjct  75   PDLTPVQLAKEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCT  134

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  135  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>emb|CDX67402.1| BnaA07g14420D [Brassica napus]
Length=181

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|P00865.1|RBS1_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Glycine max]
 emb|CAA23736.1| rubpcase [Glycine max]
Length=178

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A MVAPFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AGAGMVAPFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE + SP YYDGRYWTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPXYYDGRYWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AIF75342.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75343.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+A+FPVT+K+  D TS+++NG RV CM+VWPP G KKFETLSYL
Sbjct  10   SPAQAAMVAPFTGLKSSAAFPVTRKTDTDITSMASNGGRVNCMKVWPPVGKKKFETLSYL  69

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  70   PDLTDVELSKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  129

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  130  DSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AIR75138.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia tetrandra]
Length=165

 Score =   253 bits (646),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYL
Sbjct  9    TPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYL  67

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  68   PPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCT  127

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFI  549
            D  QV+ ELEECKK YP A++RI+G D+ RQVQC+ FI
Sbjct  128  DPAQVLNELEECKKEYPNAFIRIIGSDSNRQVQCVSFI  165



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A MVAPFTGLKS A FP T+K+  D TSI++NG RVQCMQVW P G KKFETLSYLP 
Sbjct  17   AGAGMVAPFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWAPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>ref|XP_008797838.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=182

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKST++FP T++++  F+ + +NG +VQCM+VWP  G+KKFETLSYLPP
Sbjct  19   AQASMVAPFTGLKSTSAFPATRRASNGFSKLPSNGGKVQCMKVWPIEGVKKFETLSYLPP  78

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L  E LLKQ+EYLL   WVPCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC DA
Sbjct  79   LPIEALLKQIEYLLRSRWVPCLEF-CKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCNDA  137

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            TQV  ELEECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  138  TQVAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   253 bits (647),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A MVAPFTGLKS A FP T+K+  D  SI++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AGAGMVAPFTGLKSMAGFP-TRKTNNDTISIASNGGRVQCMQVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>gb|KEH21531.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ P+
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPE  179



>gb|ACJ85905.1| unknown [Medicago truncatula]
 gb|AFK33847.1| unknown [Medicago truncatula]
 gb|KEH21532.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ P+
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPE  179



>gb|AAG40356.1|AF325004_1 At1g67090 [Arabidopsis thaliana]
Length=180

 Score =   253 bits (647),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  14   SPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYL  73

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YL+   W+PC+EFE E GFVYRE   SP YYDGRYWTMWKLP+FGCT
Sbjct  74   PDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPRYYDGRYWTMWKLPLFGCT  133

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  134  DSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   253 bits (646),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A  VAPFTGLKS A FP T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP 
Sbjct  17   AGAGTVAPFTGLKSMAGFP-TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNAFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score =   253 bits (645),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL
Sbjct  10   SPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYL  69

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   W+PCLEFE E+GFV+R++ + PGYYDGRYWTMWKLPMFGCT
Sbjct  70   PDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPGYYDGRYWTMWKLPMFGCT  129

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIA  552
            D+ QV+ ELEECKK YP A++RI+GFDN RQVQCI FIA
Sbjct  130  DSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIA  168



>gb|AIF75324.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75325.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   253 bits (646),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  12   AQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPD  71

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  72   LTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  131

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  132  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>sp|Q39743.1|RBS1_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67845.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   253 bits (646),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            T AQA+MVAPFTGLK+ A+FPVTKK   DF+++ +NG RVQCM+VWPP G KK+ETLSYL
Sbjct  10   TVAQANMVAPFTGLKANAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKKYETLSYL  68

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  QL K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCT
Sbjct  69   PDLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCT  128

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA KP
Sbjct  129  DSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP  170



>ref|XP_010511625.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010415258.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010470602.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic isoform X1 [Camelina sativa]
Length=181

 Score =   253 bits (646),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FP T+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPATRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YL+   W+PC+EFE E GFV+RE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTESELAKEVDYLIRNKWIPCVEFELENGFVHREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVEECKKEYPEAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75292.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   253 bits (645),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+A+FPVT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQATMVAPFTGLKSSAAFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+ FDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVQECKKEYPNAFIRIIRFDNNRQVQCISFIAYKP  163



>gb|KEH21530.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ P
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTP  178



>gb|KEH21536.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++ Q+  VAPF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVQSGAVAPFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQL K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG T
Sbjct  77   PPLTREQLAKEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGAT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ P+
Sbjct  137  DASQVLKELDEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPE  179



>ref|XP_009139778.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic isoform X1 [Brassica rapa]
 sp|P27985.1|RBS2_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain F1, 
chloroplastic; Short=RuBisCO small subunit F1; Flags: Precursor 
[Brassica napus]
 emb|CAA39402.1| ribulose bisphosphate carboxylase /oxygenase small subunit [Brassica 
napus]
 emb|CDY71122.1| BnaAnng36210D [Brassica napus]
Length=181

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTEVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AAF06100.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQASMVAPFTGLKST++F  T K++AD TS+++NG RVQCMQVWP  G KKFETLSYLPP
Sbjct  20   AQASMVAPFTGLKSTSAFTATTKTSADITSLASNGGRVQCMQVWPTRGKKKFETLSYLPP  79

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            LS EQL  +++YLL  GW+PCLEFE E GFVYR   + PGYYDGRYWTMWKLPMFGCTD+
Sbjct  80   LSREQLASEIDYLLRSGWIPCLEFELEHGFVYRAHGSLPGYYDGRYWTMWKLPMFGCTDS  139

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E  KA+P  + RI+GFDN RQVQCI FIAYKP
Sbjct  140  SQVLKELDELIKAHPDGFARIIGFDNVRQVQCISFIAYKP  179



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            ++  +  VAPF GLKS A FPV +K   D TSI++NG RV CMQVWPP G KKFETLSYL
Sbjct  18   SSVPSGAVAPFVGLKSMAGFPV-RKVNNDITSIASNGGRVHCMQVWPPIGKKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ EQLLK+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLP+FGCT
Sbjct  77   PPLTEEQLLKEVEYLLRKGWVPCLEFELEKGFVYREHNNSPGYYDGRYWTMWKLPLFGCT  136

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  567
            +A QV+ EL+E  KAYP A+VRI+GFDN RQVQCI FIA+ P +
Sbjct  137  EAVQVLKELQEVVKAYPNAFVRIIGFDNVRQVQCISFIAHTPKE  180



>gb|ABB51649.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit precursor [Brassica napus]
Length=181

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTEVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_009125072.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  16   AQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            ++  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   VTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AAA82069.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Glycine soja]
Length=178

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            A A MVAPFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP 
Sbjct  17   AGAGMVAPFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L   QL K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGR WTMWKLPMFGCTDA
Sbjct  76   LDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRCWTMWKLPMFGCTDA  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            +QV+ EL+E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  136  SQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>sp|P07689.1|RBS3_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3A, 
chloroplastic; Short=RuBisCO small subunit 3A; Flags: Precursor 
[Pisum sativum]
 emb|CAA27864.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236A carboxylase,ribulose bisphosphate
Length=180

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            +  Q++ VAPF GLKS   FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYL
Sbjct  17   STVQSAAVAPFGGLKSMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYL  75

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            PPL+ +QLLK+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLPMFG T
Sbjct  76   PPLTRDQLLKEVEYLLRKGWVPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            DA+QV+ EL+E   AYP A+VRI+GFDN RQVQCI FIA+ P+
Sbjct  136  DASQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAHTPE  178



>ref|XP_009390221.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=180

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQ+SMVAPFTGLKS ++FPVT+K  AD + + +NG RVQCM+VWP  G+KKFETLSYL
Sbjct  17   SPAQSSMVAPFTGLKSASAFPVTRKPNADLSHLPSNGGRVQCMKVWPIEGMKKFETLSYL  76

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L  E+LLKQ+EYLL   W+PCLEF   KGFV+RE H SPGYYDGRYWTMWKLPMFGCT
Sbjct  77   PTLKDEELLKQIEYLLRSKWIPCLEF-CPKGFVWRENHRSPGYYDGRYWTMWKLPMFGCT  135

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            DA QV  E+EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  DAVQVAKEVEECKKEYPHAFIRIIGFDNNRQVQCISFIAYKP  177



>gb|AIF75294.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQ +MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYL
Sbjct  2    SPAQPTMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYL  61

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCT
Sbjct  62   PDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCT  121

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  122  DSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  163



>emb|CDY01665.1| BnaC04g30870D [Brassica napus]
Length=181

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+++FPVT+K+  D TSI +NG RV CMQVWPP G KKFETLSYLP 
Sbjct  16   AQATMVAPFTGLKSSSAFPVTRKANNDITSIVSNGGRVSCMQVWPPIGKKKFETLSYLPD  75

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  76   LTEVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  135

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  136  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|Q39748.1|RBS6_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67850.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +1

Query  79   AAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLP  258
             AQA+MVAPFTGLK+ A+FPVTKK   DF+++ +NG RVQCM+VWPP G KK+ TLSYLP
Sbjct  11   VAQANMVAPFTGLKANAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKKYXTLSYLP  69

Query  259  PLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTD  438
             L+  QL K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD
Sbjct  70   NLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTD  129

Query  439  ATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  564
            + QV+ EL+ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  130  SVQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>gb|AIF75337.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75338.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   TAAQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYL  255
            + AQA+MVAPFTGLKS+++FPVT+K+  D TSI +NG RV CMQVWPP G KKFETLSYL
Sbjct  10   SPAQATMVAPFTGLKSSSAFPVTRKANNDITSIVSNGGRVSCMQVWPPIGKKKFETLSYL  69

Query  256  PPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCT  435
            P L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCT
Sbjct  70   PDLTEVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCT  129

Query  436  DATQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
            D+ QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  130  DSAQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AIF75317.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75318.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75319.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75320.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75334.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75335.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75336.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   AQASMVAPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPP  261
            AQA+MVAPFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP 
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPD  71

Query  262  LSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDA  441
            L+  +L K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+
Sbjct  72   LTEVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDS  131

Query  442  TQVVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  561
             QV+ E++ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  132  AQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750