BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN010F24

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               270   9e-88   Erythranthe guttata [common monkey flower]
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              270   1e-87   Solanum lycopersicum
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            270   1e-87   
gb|AFR42026.1|  alpha-tubulin                                           268   1e-87   Populus trichocarpa [western balsam poplar]
gb|AFR42020.1|  alpha-tubulin                                           268   1e-87   Populus trichocarpa [western balsam poplar]
emb|CAJ38386.1|  alpha tubulin                                          271   1e-87   Plantago major [cart-track plant]
gb|AFR42049.1|  alpha-tubulin                                           268   1e-87   Populus fremontii
gb|AFR42035.1|  alpha-tubulin                                           268   1e-87   Populus alba [abele]
gb|AFR42054.1|  alpha-tubulin                                           268   2e-87   Populus fremontii
gb|AFR42042.1|  alpha-tubulin                                           268   2e-87   Populus fremontii
gb|AFR42036.1|  alpha-tubulin                                           268   2e-87   Populus alba [abele]
gb|AFR42047.1|  alpha-tubulin                                           268   2e-87   Populus fremontii
gb|KJB58759.1|  hypothetical protein B456_009G224800                    273   2e-87   Gossypium raimondii
gb|AHM93474.1|  alpha-tubulin                                           271   5e-87   Camellia chekiangoleosa
emb|CAB76917.1|  alpha-tubulin 4                                        270   1e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAH19954.1|  AT1G50010                                              268   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|KJB32211.1|  hypothetical protein B456_005G229600                    272   1e-86   Gossypium raimondii
gb|AAW57305.1|  alpha-tubulin                                           270   1e-86   Ceratopteris richardii
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 266   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AHZ58481.1|  alpha-tubulin                                           266   2e-86   Syntrichia caninervis
gb|AAW57309.1|  alpha-tubulin                                           268   2e-86   Ceratopteris richardii
gb|AAW57310.1|  alpha-tubulin                                           268   2e-86   Ceratopteris richardii
gb|ADD84794.1|  tubulin-like protein                                    265   2e-86   Cenchrus ciliaris [African foxtail grass]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   271   3e-86   Citrus sinensis [apfelsine]
gb|KIY91712.1|  Tubulin alpha chain                                     267   3e-86   Monoraphidium neglectum
dbj|BAA99561.1|  alpha-tubulin                                          263   3e-86   Chlorella vulgaris
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              268   4e-86   
emb|CDY46272.1|  BnaC05g50610D                                          268   4e-86   Brassica napus [oilseed rape]
gb|EPS62716.1|  alpha-tubulin                                           271   6e-86   Genlisea aurea
gb|AHJ80819.1|  Tua1                                                    266   6e-86   Eragrostis tef [tef]
emb|CAD20821.1|  alpha tubulin                                          267   6e-86   Zea mays [maize]
gb|AAD11425.1|  alpha tubulin                                           270   6e-86   Mesembryanthemum crystallinum
gb|KJB58756.1|  hypothetical protein B456_009G224800                    271   8e-86   Gossypium raimondii
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       271   9e-86   Cucumis sativus [cucumbers]
gb|AAW57306.1|  alpha-tubulin                                           266   1e-85   Ceratopteris richardii
ref|XP_002677064.1|  alpha-tubulin                                      263   1e-85   Naegleria gruberi strain NEG-M
gb|ABR25510.1|  tubulin alpha-1 chain                                   265   1e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              263   2e-85   Camelina sativa [gold-of-pleasure]
emb|CAD20820.1|  alpha tubulin                                          263   2e-85   Zea mays [maize]
gb|AAB36609.1|  alpha-tubulin                                           269   2e-85   Eucalyptus globulus subsp. bicostata
dbj|BAH20267.1|  AT5G19780                                              266   2e-85   Arabidopsis thaliana [mouse-ear cress]
emb|CAL35827.1|  alpha-2 tubulin                                        265   2e-85   Plantago major [cart-track plant]
emb|CAC84108.1|  alpha-tubulin                                          260   2e-85   Gossypium hirsutum [American cotton]
gb|AAO46127.1|  alpha-tubulin                                           265   3e-85   Streblomastix strix
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                271   3e-85   Solanum tuberosum [potatoes]
emb|CAD13176.1|  alpha-tubulin                                          271   3e-85   Nicotiana tabacum [American tobacco]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     271   3e-85   Nicotiana sylvestris
emb|CAA52158.1|  alpha tubulin                                          265   3e-85   Zea mays [maize]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     271   3e-85   Nicotiana tomentosiformis
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              271   3e-85   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     271   3e-85   
ref|XP_001777110.1|  predicted protein                                  268   3e-85   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              271   3e-85   Solanum lycopersicum
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   271   3e-85   Nicotiana tomentosiformis
gb|AAG28536.1|AF199019_1  alpha tubulin                                 262   4e-85   Leishmania major
gb|ABB02631.1|  unknown                                                 271   4e-85   Solanum tuberosum [potatoes]
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              271   4e-85   Nicotiana tomentosiformis
gb|ADW83724.1|  alpha-tubulin                                           270   4e-85   Musa acuminata AAA Group [Cavendish banana]
gb|EKF29047.1|  epsilon tubulin, putative                               264   4e-85   Trypanosoma cruzi marinkellei
ref|NP_001275271.1|  alpha-tubulin-like protein                         271   4e-85   Solanum tuberosum [potatoes]
emb|CCD11782.1|  unnamed protein product                                264   4e-85   Trypanosoma congolense IL3000
gb|EKF28172.1|  epsilon tubulin, putative                               264   4e-85   Trypanosoma cruzi marinkellei
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   270   4e-85   Citrus sinensis [apfelsine]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                270   4e-85   Erythranthe guttata [common monkey flower]
gb|ABP65320.1|  alpha tubulin                                           271   4e-85   Capsicum annuum
gb|AAO46130.1|  alpha-tubulin                                           264   4e-85   Streblomastix strix
ref|XP_006482574.1|  PREDICTED: tubulin alpha chain-like                260   4e-85   
gb|ACH68563.1|  alpha-tubulin                                           271   4e-85   Solanum tuberosum [potatoes]
gb|ABL61201.1|  alpha-tubulin                                           266   4e-85   Oxymonadida environmental sample
ref|XP_003886491.1|  unnamed protein product                            260   4e-85   Leishmania mexicana MHOM/GT/2001/U1103
gb|KJB58757.1|  hypothetical protein B456_009G224800                    269   5e-85   Gossypium raimondii
emb|CBH08958.1|  alpha tubulin, (fragment)                              266   5e-85   Trypanosoma brucei gambiense DAL972
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             270   5e-85   Anemia phyllitidis
gb|AEQ75493.1|  alpha-tubulin                                           270   5e-85   Rosa multiflora [Japanese rose]
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     261   5e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              270   5e-85   Medicago truncatula
emb|CBH08953.1|  alpha tubulin, (fragment)                              261   5e-85   Trypanosoma brucei gambiense DAL972
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   270   5e-85   Citrus sinensis [apfelsine]
emb|CAD20819.1|  alpha tubulin                                          260   6e-85   Zea mays [maize]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     270   6e-85   Vitis vinifera
emb|CDY35856.1|  BnaC09g37880D                                          260   6e-85   Brassica napus [oilseed rape]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             270   6e-85   Citrus clementina [clementine]
gb|ACN40181.1|  unknown                                                 270   6e-85   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     270   6e-85   Vitis vinifera
ref|XP_008621874.1|  tubulin alpha                                      264   7e-85   Saprolegnia diclina VS20
gb|KHG20487.1|  Tubulin alpha chain                                     270   7e-85   Gossypium arboreum [tree cotton]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                270   7e-85   Phoenix dactylifera
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                270   7e-85   Erythranthe guttata [common monkey flower]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              270   7e-85   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              270   7e-85   Fragaria vesca subsp. vesca
gb|KHG18997.1|  Tubulin alpha chain                                     270   7e-85   Gossypium arboreum [tree cotton]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         270   7e-85   Jatropha curcas
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     270   7e-85   Eucalyptus grandis [rose gum]
gb|ACJ60905.1|  alpha tubulin                                           270   7e-85   Betula pendula [white birch]
gb|ABO47740.1|  alpha-tubulin                                           270   7e-85   Gossypium hirsutum [American cotton]
gb|ABC59068.2|  alpha tubulin 1                                         270   7e-85   Camellia sinensis [black tea]
emb|CDP02221.1|  unnamed protein product                                270   7e-85   Coffea canephora [robusta coffee]
gb|ABL61216.1|  alpha-tubulin                                           266   7e-85   Oxymonadida environmental sample
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             270   7e-85   Prunus persica
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             270   7e-85   Prunus persica
gb|ABX57816.1|  alpha tubulin                                           270   7e-85   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         270   7e-85   Pseudotsuga menziesii var. menziesii
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          270   7e-85   Malus domestica [apple tree]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     270   7e-85   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     270   7e-85   Pyrus x bretschneideri [bai li]
ref|NP_001291325.1|  tubulin alpha chain-like                           270   7e-85   Sesamum indicum [beniseed]
gb|ABO47739.1|  alpha-tubulin                                           270   7e-85   Gossypium hirsutum [American cotton]
gb|AGG37289.1|  alpha-tubulin 7                                         270   7e-85   Salix arbutifolia
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                270   7e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                270   7e-85   Vitis vinifera
ref|NP_001289660.1|  tubulin alpha chain-like                           270   7e-85   Eucalyptus grandis [rose gum]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         270   8e-85   Jatropha curcas
ref|XP_002517492.1|  tubulin alpha chain, putative                      270   8e-85   Ricinus communis
gb|ABO47736.1|  alpha-tubulin                                           270   8e-85   Gossypium hirsutum [American cotton]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Nelumbo nucifera [Indian lotus]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Pyrus x bretschneideri [bai li]
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   270   8e-85   Malus domestica [apple tree]
gb|AIX10966.1|  tubulin                                                 270   8e-85   Ornithogalum longebracteatum [sea-onion]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             270   8e-85   Selaginella moellendorffii
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Elaeis guineensis
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Fragaria vesca subsp. vesca
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Elaeis guineensis
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Phoenix dactylifera
ref|XP_002510010.1|  tubulin alpha chain, putative                      270   8e-85   Ricinus communis
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             270   8e-85   Citrus clementina [clementine]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              270   8e-85   Theobroma cacao [chocolate]
ref|XP_001764722.1|  predicted protein                                  270   8e-85   
ref|XP_002522104.1|  tubulin alpha chain, putative                      270   8e-85   Ricinus communis
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              270   8e-85   Cucumis sativus [cucumbers]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     270   8e-85   Populus euphratica
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   270   8e-85   Nelumbo nucifera [Indian lotus]
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   270   8e-85   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          270   8e-85   Citrus sinensis [apfelsine]
ref|XP_002779346.1|  alpha-tubulin, putative                            261   8e-85   Perkinsus marinus ATCC 50983
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    270   8e-85   Gossypium hirsutum [American cotton]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             270   8e-85   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Nelumbo nucifera [Indian lotus]
ref|XP_010093625.1|  Tubulin alpha chain                                270   8e-85   Morus notabilis
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                270   8e-85   Prunus dulcis [sweet almond]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                270   8e-85   Elaeis guineensis
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        270   8e-85   Cucumis melo [Oriental melon]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         270   8e-85   Jatropha curcas
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     270   8e-85   Sesamum indicum [beniseed]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             270   9e-85   Selaginella moellendorffii
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   270   9e-85   Fragaria vesca subsp. vesca
gb|AAU10519.1|  alpha tubulin                                           263   9e-85   Leishmania donovani
gb|KJB33191.1|  hypothetical protein B456_006G002500                    261   9e-85   Gossypium raimondii
ref|XP_007042689.1|  Tubulin alpha-2 chain                              270   9e-85   Theobroma cacao [chocolate]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     270   9e-85   Nelumbo nucifera [Indian lotus]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     270   9e-85   Phoenix dactylifera
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    270   9e-85   Citrus sinensis [apfelsine]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     270   9e-85   Vitis vinifera
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 270   9e-85   Populus trichocarpa [western balsam poplar]
gb|ABQ59633.1|  alpha-tubulin 3                                         270   9e-85   Populus tremuloides
ref|WP_039310890.1|  hypothetical protein                               270   9e-85   
ref|XP_010104543.1|  Tubulin alpha chain                                270   9e-85   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                270   9e-85   Cucumis sativus [cucumbers]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     270   9e-85   Cucumis melo [Oriental melon]
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             270   9e-85   Populus trichocarpa [western balsam poplar]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          270   9e-85   Tarenaya hassleriana [spider flower]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               270   9e-85   Pisum sativum [garden pea]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             270   9e-85   Eutrema salsugineum [saltwater cress]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                270   9e-85   Cicer arietinum [garbanzo]
gb|AGG37285.1|  alpha-tubulin 3                                         270   9e-85   Salix arbutifolia
gb|ABK92520.1|  unknown                                                 270   9e-85   Populus trichocarpa [western balsam poplar]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              270   9e-85   Medicago truncatula
gb|AID52921.1|  tubulin alpha chain                                     270   9e-85   Carthamus tinctorius
gb|ABO47742.1|  alpha-tubulin                                           270   1e-84   Gossypium hirsutum [American cotton]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                270   1e-84   Tarenaya hassleriana [spider flower]
gb|AGG37283.1|  alpha-tubulin 1                                         270   1e-84   Salix arbutifolia
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             270   1e-84   Prunus persica
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   270   1e-84   Populus euphratica
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             270   1e-84   Phaseolus vulgaris [French bean]
ref|XP_010099392.1|  Tubulin alpha chain                                270   1e-84   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             270   1e-84   Prunus persica
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        270   1e-84   Glycine max [soybeans]
gb|EKG00833.1|  epsilon tubulin, putative                               259   1e-84   Trypanosoma cruzi
gb|ABL61224.1|  alpha-tubulin                                           265   1e-84   Oxymonadida environmental sample
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                270   1e-84   Tarenaya hassleriana [spider flower]
gb|KHN08201.1|  Tubulin alpha chain                                     270   1e-84   Glycine soja [wild soybean]
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             270   1e-84   
ref|XP_002959708.1|  alpha tubulin                                      263   1e-84   Volvox carteri f. nagariensis
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              270   1e-84   Populus euphratica
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                270   1e-84   Solanum lycopersicum
dbj|BAB19779.1|  alpha tubulin                                          270   1e-84   Nicotiana tabacum [American tobacco]
gb|ABL61212.1|  alpha-tubulin                                           265   1e-84   Oxymonadida environmental sample
gb|ABL61215.1|  alpha-tubulin                                           265   1e-84   Oxymonadida environmental sample
gb|AIX10773.1|  alpha tubulin                                           269   1e-84   Panax notoginseng [san-qi]
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                269   1e-84   Nicotiana tomentosiformis
gb|ACK76232.1|  alpha-tubulin                                           269   1e-84   Dimocarpus longan [longan]
gb|KDO25258.1|  hypothetical protein SPRG_09506                         260   1e-84   Saprolegnia parasitica CBS 223.65
gb|ABR26150.1|  tubulin alpha-3 chain                                   260   2e-84   Oryza sativa Indica Group [Indian rice]
gb|AFW67749.1|  alpha tubulin4                                          265   2e-84   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     269   2e-84   Sesamum indicum [beniseed]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   269   2e-84   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY29334.1|  BnaA05g16010D                                          268   2e-84   Brassica napus [oilseed rape]
emb|CDY66630.1|  BnaCnng51680D                                          268   2e-84   Brassica napus [oilseed rape]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              270   2e-84   
gb|ABR25378.1|  tubulin alpha 3 chain                                   261   2e-84   Oryza sativa Indica Group [Indian rice]
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                269   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA41189.1|  TPA: alpha tubulin5                                    265   2e-84   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     269   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                269   3e-84   Eucalyptus grandis [rose gum]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    265   3e-84   
gb|KJB29387.1|  hypothetical protein B456_005G097800                    269   3e-84   Gossypium raimondii
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        269   3e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    269   3e-84   
gb|EPY40479.1|  tubulin alpha                                           262   3e-84   Angomonas deanei
gb|AAO46128.1|  alpha-tubulin                                           262   3e-84   Streblomastix strix
gb|EPY33355.1|  tubulin alpha                                           264   3e-84   Strigomonas culicis
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             268   3e-84   Phaseolus vulgaris [French bean]
ref|XP_010096739.1|  Tubulin alpha chain                                268   3e-84   
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            265   3e-84   Oryza sativa Japonica Group [Japonica rice]
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    268   3e-84   Arabis alpina [alpine rockcress]
gb|ADJ00012.1|  tubulin alpha chain                                     261   3e-84   Chromera velia
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    268   3e-84   Gossypium hirsutum [American cotton]
ref|NP_171974.1|  tubulin alpha-4 chain                                 268   3e-84   Arabidopsis thaliana [mouse-ear cress]
gb|EPY39349.1|  tubulin alpha                                           264   3e-84   Angomonas deanei
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          268   3e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              268   3e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   268   3e-84   Brassica rapa
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             268   3e-84   Capsella rubella
gb|KJB83378.1|  hypothetical protein B456_013G244600                    267   3e-84   Gossypium raimondii
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    268   3e-84   Glycine max [soybeans]
gb|ABL61202.1|  alpha-tubulin                                           263   3e-84   Oxymonadida environmental sample
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             268   3e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             268   3e-84   Phaseolus vulgaris [French bean]
dbj|BAJ06364.1|  alpha-tubulin                                          268   3e-84   Alopecurus aequalis
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        268   3e-84   Camelina sativa [gold-of-pleasure]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     268   3e-84   Glycine max [soybeans]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    268   4e-84   Gossypium hirsutum [American cotton]
ref|NP_193232.1|  tubulin alpha-6 chain                                 268   4e-84   Arabidopsis thaliana [mouse-ear cress]
gb|ABL61219.1|  alpha-tubulin                                           264   4e-84   Oxymonadida environmental sample
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              268   4e-84   Brachypodium distachyon [annual false brome]
ref|XP_011398411.1|  Tubulin alpha chain                                266   4e-84   Auxenochlorella protothecoides
gb|ABD92937.1|  alpha tubulin-4A                                        268   4e-84   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                        268   4e-84   Triticum aestivum [Canadian hard winter wheat]
gb|AAO73546.1|  alpha-tubulin                                           268   4e-84   Ceratopteris richardii
gb|AHJ80821.1|  Tua3                                                    266   4e-84   Eragrostis tef [tef]
ref|XP_007515802.1|  alpha-tubulin                                      267   4e-84   Bathycoccus prasinos
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    268   4e-84   Brassica rapa
gb|AEW46684.1|  beta-tubulin                                            268   4e-84   Ulva linza
gb|KEH43997.1|  tubulin beta-1 chain                                    268   4e-84   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                268   4e-84   Cicer arietinum [garbanzo]
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             268   4e-84   Selaginella moellendorffii
gb|KHN42598.1|  Tubulin alpha-2 chain                                   268   5e-84   Glycine soja [wild soybean]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              268   5e-84   Glycine max [soybeans]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    268   5e-84   Glycine max [soybeans]
gb|AFW67748.1|  alpha tubulin4                                          265   5e-84   
gb|EPY32266.1|  alpha tubulin                                           258   5e-84   Strigomonas culicis
gb|ABL61213.1|  alpha-tubulin                                           263   5e-84   Oxymonadida environmental sample
ref|XP_002508010.1|  alpha tubulin 2                                    268   5e-84   Micromonas commoda
ref|XP_002772835.1|  alpha-tubulin, putative                            258   5e-84   Perkinsus marinus ATCC 50983
gb|ABL61217.1|  alpha-tubulin                                           263   6e-84   Oxymonadida environmental sample
gb|ABL61204.1|  alpha-tubulin                                           263   6e-84   Oxymonadida environmental sample
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             268   6e-84   Selaginella moellendorffii
gb|KJB34154.1|  hypothetical protein B456_006G050600                    260   6e-84   Gossypium raimondii
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              268   6e-84   Phoenix dactylifera
ref|XP_005643073.1|  tubulin alpha chain                                268   6e-84   Coccomyxa subellipsoidea C-169
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             268   6e-84   Selaginella moellendorffii
gb|AHJ80820.1|  Tua3                                                    266   6e-84   Eragrostis tef [tef]
ref|XP_003058621.1|  alpha tubulin                                      268   7e-84   Micromonas pusilla CCMP1545
gb|ABL61203.1|  alpha-tubulin                                           263   7e-84   Oxymonadida environmental sample
ref|XP_005651460.1|  tubulin alpha chain                                268   7e-84   Coccomyxa subellipsoidea C-169
gb|ABL61227.1|  alpha-tubulin                                           263   7e-84   Oxymonadida environmental sample
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              268   7e-84   Pyrus x bretschneideri [bai li]
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     265   7e-84   Eucalyptus grandis [rose gum]
gb|ABL61226.1|  alpha-tubulin                                           263   7e-84   Oxymonadida environmental sample
ref|XP_002525416.1|  tubulin alpha chain, putative                      267   7e-84   Ricinus communis
dbj|BAC24800.1|  alpha tubulin                                          267   8e-84   Physcomitrella patens
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             267   9e-84   
gb|KIZ03400.1|  Tubulin alpha chain                                     267   9e-84   Monoraphidium neglectum
gb|ACU20294.1|  unknown                                                 264   9e-84   Glycine max [soybeans]
emb|CAB66336.1|  alpha-tubulin                                          267   9e-84   Betula pendula [white birch]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   267   9e-84   Vitis vinifera
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   267   9e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              267   1e-83   Cucumis melo [Oriental melon]
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             266   1e-83   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              267   1e-83   Cucumis sativus [cucumbers]
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   267   1e-83   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              267   1e-83   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              267   1e-83   
gb|ABQ59634.1|  alpha-tubulin 5                                         267   1e-83   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     267   1e-83   
emb|CDP17586.1|  unnamed protein product                                267   1e-83   
gb|ACN40824.1|  unknown                                                 267   1e-83   
gb|ABL61214.1|  alpha-tubulin                                           263   1e-83   
gb|AGG37284.1|  alpha-tubulin 2                                         267   1e-83   
gb|AAO63773.2|  alpha-tubulin 2                                         267   1e-83   
gb|AHJ80823.1|  Tua1                                                    267   1e-83   
gb|AEG74028.1|  alpha-tubulin                                           267   1e-83   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              267   1e-83   
dbj|BAP59012.1|  alpha tubulin                                          267   1e-83   
gb|ABL61228.1|  alpha-tubulin                                           263   1e-83   
dbj|BAJ06362.1|  alpha-tubulin                                          267   1e-83   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   267   1e-83   
gb|ABV55999.1|  alpha-tubulin 7                                         267   1e-83   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    267   1e-83   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          267   1e-83   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             267   1e-83   
ref|XP_007030078.1|  Tubulin alpha-5                                    268   1e-83   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   267   1e-83   
gb|AHJ80817.1|  Tua1                                                    267   1e-83   
emb|CAA06619.1|  alpha-tubulin 1                                        267   1e-83   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             267   1e-83   
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         267   1e-83   
ref|XP_001777081.1|  predicted protein                                  267   1e-83   
gb|ABU93324.1|  tubulin alpha subunit                                   267   1e-83   
ref|NP_001167663.1|  tubulin alpha-3 chain                              267   1e-83   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              267   1e-83   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   267   1e-83   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   267   1e-83   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   267   1e-83   
gb|AHJ80815.1|  Tua1                                                    267   1e-83   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             267   1e-83   
gb|KHG26159.1|  Tubulin alpha-6 chain                                   267   1e-83   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   267   1e-83   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             267   1e-83   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          267   1e-83   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             267   1e-83   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        267   1e-83   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   266   1e-83   
gb|ABU93321.1|  tubulin alpha subunit                                   267   1e-83   
gb|ABU93323.1|  tubulin alpha subunit                                   267   1e-83   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   266   1e-83   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   266   1e-83   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              266   1e-83   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              267   1e-83   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              266   1e-83   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             266   1e-83   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              266   2e-83   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   266   2e-83   
tpg|DAA51109.1|  TPA: alpha tubulin                                     266   2e-83   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              266   2e-83   
gb|AAO46126.1|  alpha-tubulin                                           260   2e-83   
ref|XP_001782790.1|  predicted protein                                  266   2e-83   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                266   2e-83   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     266   2e-83   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   266   2e-83   
gb|AGG37287.1|  alpha-tubulin 5                                         266   2e-83   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          266   2e-83   
emb|CDO97305.1|  unnamed protein product                                266   2e-83   
ref|XP_001566612.1|  alpha tubulin                                      260   2e-83   
gb|ABL61086.1|  alpha-tubulin                                           262   2e-83   
dbj|BAG99724.1|  unnamed protein product                                265   2e-83   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                266   2e-83   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              266   2e-83   
gb|AAZ23863.1|  alpha-tubulin                                           266   2e-83   
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              266   2e-83   
gb|ABO47737.1|  alpha-tubulin                                           266   2e-83   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              266   2e-83   
gb|ABL61218.1|  alpha-tubulin                                           262   2e-83   
gb|ABB16994.1|  unknown                                                 267   2e-83   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                266   2e-83   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             263   2e-83   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 266   2e-83   
gb|EWC76931.1|  tubulin alpha chain                                     262   2e-83   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  266   2e-83   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              265   2e-83   
gb|AAT09063.1|  alpha tubulin 1                                         266   2e-83   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    266   2e-83   
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   266   2e-83   
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    266   2e-83   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   266   3e-83   
emb|CAD26886.1|  alpha-tubulin                                          266   3e-83   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   266   3e-83   
ref|XP_005851144.1|  alpha-tubulin                                      266   3e-83   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              266   3e-83   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              266   3e-83   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             266   3e-83   
gb|ABD92942.1|  alpha tubulin-1D                                        266   3e-83   
emb|CDW82295.1|  alpha tubulin                                          266   3e-83   
dbj|BAJ06363.1|  alpha-tubulin                                          266   3e-83   
gb|EJY81124.1|  Alpha tubulin,putative                                  266   3e-83   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   266   3e-83   
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             266   3e-83   
ref|XP_007014666.1|  Tubulin alpha-5                                    266   3e-83   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                266   3e-83   
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              266   3e-83   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                266   3e-83   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             266   3e-83   
gb|ETM52928.1|  tubulin alpha chain                                     264   3e-83   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    266   3e-83   
ref|NP_001105324.1|  tubulin alpha-5 chain                              266   3e-83   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  266   3e-83   
gb|ACJ04933.1|  alpha tubulin                                           258   3e-83   
ref|NP_001105588.1|  tubulin alpha-6 chain                              266   3e-83   
gb|AGD80034.1|  alpha-tubulin 1                                         266   3e-83   
emb|CAD26887.1|  alpha-tubulin                                          266   3e-83   
gb|ACL53551.1|  unknown                                                 257   3e-83   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                266   3e-83   
gb|ABO47735.1|  alpha-tubulin                                           266   3e-83   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   266   3e-83   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   264   4e-83   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              266   4e-83   
emb|CAD24765.1|  alpha-tubulin                                          266   4e-83   
gb|AAB08791.1|  alpha tubulin                                           266   4e-83   
gb|AGG37286.1|  alpha-tubulin 4                                         266   4e-83   
gb|ETW27380.1|  tubulin alpha chain                                     261   4e-83   
ref|XP_001770881.1|  predicted protein                                  266   4e-83   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              266   4e-83   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     266   4e-83   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              266   4e-83   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                266   4e-83   
gb|ABO47741.1|  alpha-tubulin                                           266   4e-83   
ref|XP_002532068.1|  tubulin alpha chain, putative                      265   4e-83   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           266   4e-83   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   265   4e-83   
ref|XP_001419217.1|  predicted protein                                  266   4e-83   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      261   4e-83   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                265   4e-83   
gb|ABD92930.1|  alpha tubulin-2A                                        265   4e-83   
ref|XP_007512064.1|  alpha-tubulin                                      265   4e-83   
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              265   4e-83   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             265   4e-83   
ref|XP_002675196.1|  alpha-tubulin                                      265   4e-83   
ref|NP_001060075.1|  Os07g0574800                                       265   4e-83   
gb|AGY80453.1|  tubulin                                                 265   4e-83   
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         265   5e-83   
gb|ABR67425.1|  alpha-tubulin 4                                         265   5e-83   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             265   5e-83   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              265   5e-83   
emb|CAD26891.1|  alpha-tubulin                                          265   5e-83   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   265   5e-83   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              265   5e-83   
emb|CDX88875.1|  BnaA03g07740D                                          265   5e-83   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   265   5e-83   
ref|NP_197478.1|  tubulin alpha-3                                       265   5e-83   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    265   5e-83   
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    265   5e-83   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     266   5e-83   
emb|CAD26890.1|  alpha-tubulin                                          265   5e-83   
emb|CDP12358.1|  unnamed protein product                                265   5e-83   
ref|NP_001242878.1|  uncharacterized protein LOC100806907               265   5e-83   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    265   5e-83   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   266   5e-83   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              265   5e-83   
emb|CAD24768.1|  alpha-tubulin                                          265   5e-83   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              265   5e-83   
emb|CDY42294.1|  BnaC02g09000D                                          265   5e-83   
ref|NP_001237301.1|  tubulin A                                          265   5e-83   
gb|ACU19580.1|  unknown                                                 265   5e-83   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             265   5e-83   
gb|KHN47983.1|  Tubulin alpha-3 chain                                   265   5e-83   
emb|CCW60849.1|  unnamed protein product                                263   5e-83   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              265   6e-83   
gb|AGG37290.1|  alpha-tubulin 8                                         265   6e-83   
emb|CDY44941.1|  BnaA02g04460D                                          265   6e-83   
gb|ABL61230.1|  alpha-tubulin                                           265   6e-83   
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               265   6e-83   
gb|EPR58771.1|  alpha tubulin TUBA1                                     265   7e-83   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           265   7e-83   
gb|AFK33477.1|  unknown                                                 262   7e-83   
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   265   7e-83   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              265   7e-83   
gb|ETI53409.1|  tubulin alpha chain                                     255   7e-83   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           265   7e-83   
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              265   7e-83   
gb|ABL61209.1|  alpha-tubulin                                           264   8e-83   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              265   8e-83   
emb|CDJ60085.1|  tubulin alpha chain, putative                          264   8e-83   
gb|ABL61205.1|  alpha-tubulin                                           264   8e-83   
gb|ABL61208.1|  alpha-tubulin                                           264   8e-83   
gb|KHN01709.1|  Tubulin alpha chain                                     265   8e-83   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    265   8e-83   
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   265   9e-83   
gb|ABL61206.1|  alpha-tubulin                                           264   9e-83   
gb|ABL61210.1|  alpha-tubulin                                           264   9e-83   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             265   1e-82   
emb|CAA62916.1|  alpha-tubulin                                          265   1e-82   
gb|AGG37288.1|  alpha-tubulin 6                                         265   1e-82   
gb|ETM53002.1|  tubulin alpha chain                                     256   1e-82   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              265   1e-82   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             264   1e-82   
gb|ABK92552.1|  unknown                                                 264   1e-82   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             264   1e-82   
ref|NP_001051132.1|  Os03g0726100                                       264   1e-82   
gb|AEF79970.1|  alpha-tubulin protein                                   264   1e-82   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              264   1e-82   
ref|XP_008877307.1|  tubulin alpha chain                                261   1e-82   
gb|AHJ80816.1|  Tua1                                                    264   1e-82   
gb|AAB86648.1|  alpha-tubulin                                           264   2e-82   
gb|AAX63396.1|  alpha-tubulin                                           264   2e-82   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        264   2e-82   
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              264   2e-82   
ref|XP_003629736.1|  Alpha-tubulin                                      264   2e-82   
gb|ABC97356.1|  alpha tubulin                                           264   2e-82   
gb|AAB86649.1|  alpha-tubulin                                           264   2e-82   
emb|CAD24766.1|  alpha-tubulin                                          264   2e-82   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           265   2e-82   
ref|XP_001563163.2|  alpha tubulin                                      264   2e-82   
gb|ABO47738.1|  alpha-tubulin                                           264   2e-82   
emb|CAD24767.1|  alpha-tubulin                                          264   2e-82   
emb|CDJ42547.1|  tubulin alpha chain, putative                          264   2e-82   
ref|XP_002951007.1|  alpha tubulin                                      264   2e-82   
emb|CDI81818.1|  tubulin alpha chain, putative                          264   2e-82   
emb|CDJ53173.1|  tubulin alpha chain, putative                          264   2e-82   
emb|CCI45804.1|  unnamed protein product                                263   2e-82   
gb|ETW61813.1|  tubulin alpha chain                                     262   2e-82   
ref|XP_002364807.1|  tubulin alpha chain                                264   2e-82   



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   270 bits (689),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  73   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  132

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  133  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  192

Query  362  AALEKDY  382
            AALEKDY
Sbjct  193  AALEKDY  199



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  82   DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  141

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQ+AVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  142  GDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  201

Query  362  AALEKDY  382
            AALEKDY
Sbjct  202  AALEKDY  208



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  73   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  132

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  133  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  192

Query  362  AALEKDY  382
            AALEKDY
Sbjct  193  AALEKDY  199



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  67   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  126

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  127  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  186

Query  362  AALEKDY  382
            AALEKDY
Sbjct  187  AALEKDY  193



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  67   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  126

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  127  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  186

Query  362  AALEKDY  382
            AALEKDY
Sbjct  187  AALEKDY  193



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  126  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  185

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  186  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  245

Query  362  AALEKDY  382
            AALEKDY
Sbjct  246  AALEKDY  252



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  67   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  126

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  127  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  186

Query  362  AALEKDY  382
            AALEKDY
Sbjct  187  AALEKDY  193



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  66   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  125

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  126  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  185

Query  362  AALEKDY  382
            AALEKDY
Sbjct  186  AALEKDY  192



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  66   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  125

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  126  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  185

Query  362  AALEKDY  382
            AALEKDY
Sbjct  186  AALEKDY  192



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  64   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  123

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  124  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  183

Query  362  AALEKDY  382
            AALEKDY
Sbjct  184  AALEKDY  190



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  65   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  124

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  125  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  184

Query  362  AALEKDY  382
            AALEKDY
Sbjct  185  AALEKDY  191



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  64   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  123

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  124  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  183

Query  362  AALEKDY  382
            AALEKDY
Sbjct  184  AALEKDY  190



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  196  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  255

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  256  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  315

Query  362  AALEKDY  382
            AALEKDY
Sbjct  316  AALEKDY  322



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   271 bits (694),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  183  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  242

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  243  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  302

Query  362  AALEKDY  382
            AALEKDY
Sbjct  303  AALEKDY  309



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  144  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  203

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  204  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  263

Query  362  AALEKDY  382
            AALEKDY
Sbjct  264  AALEKDY  270



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  104  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  163

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  164  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  223

Query  362  AALEKDY  382
            AALEKDY
Sbjct  224  AALEKDY  230



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  217  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  276

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  277  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  336

Query  362  AALEKDY  382
            AALEKDY
Sbjct  337  AALEKDY  343



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  162  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  221

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  222  GDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  281

Query  362  AALEKDY  382
            AALEKDY
Sbjct  282  AALEKDY  288



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  58   DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  117

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  118  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  177

Query  362  AALEKDY  382
            AALEKDY
Sbjct  178  AALEKDY  184



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  57   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  116

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  117  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  176

Query  362  AALEKDY  382
            AALEKDY
Sbjct  177  AALEKDY  183



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  121  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  180

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  181  GDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  240

Query  362  AALEKDY  382
            AALEKDY
Sbjct  241  AALEKDY  247



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  122  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  182  GDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  241

Query  362  AALEKDY  382
            AALEKDY
Sbjct  242  AALEKDY  248



>gb|ADD84794.1| tubulin-like protein [Cenchrus ciliaris]
Length=184

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  39   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  98

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  99   GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  158

Query  362  AALEKDY  382
            AALEKDY
Sbjct  159  AALEKDY  165



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  210  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  269

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  270  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  329

Query  362  AALEKDY  382
            AALEKDY
Sbjct  330  AALEKDY  336



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  104  DPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  163

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  164  GDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  223

Query  362  AALEKDY  382
            AALEKDY
Sbjct  224  AALEKDY  230



>dbj|BAA99561.1| alpha-tubulin [Chlorella vulgaris]
Length=149

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  4    DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  63

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  64   GDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  123

Query  362  AALEKDY  382
            AALEKDY
Sbjct  124  AALEKDY  130



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  139  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  198

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  199  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  258

Query  362  AALEKDY  382
            AALEKDY
Sbjct  259  AALEKDY  265



>emb|CDY46272.1| BnaC05g50610D [Brassica napus]
Length=289

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  145  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  204

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF HWYVGEGMEEGEFSEAREDL
Sbjct  205  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFFHWYVGEGMEEGEFSEAREDL  264

Query  362  AALEKDY  382
            AALEKDY
Sbjct  265  AALEKDY  271



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   271 bits (694),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  260  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  319

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  320  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  379

Query  362  AALEKDY  382
            AALEKDY
Sbjct  380  AALEKDY  386



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   266 bits (680),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  98   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  157

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  158  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  217

Query  362  AALEKDY  382
            AALEKDY
Sbjct  218  AALEKDY  224



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   267 bits (682),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPG
Sbjct  130  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPG  189

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  190  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  249

Query  362  AALEKDY  382
            AALEKDY
Sbjct  250  AALEKDY  256



>gb|AAD11425.1| alpha tubulin [Mesembryanthemum crystallinum]
Length=366

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  221  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  280

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  281  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  340

Query  362  AALEKDY  382
            AALEKDY
Sbjct  341  AALEKDY  347



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  271  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  330

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  331  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  390

Query  362  AALEKDY  382
            AALEKDY
Sbjct  391  AALEKDY  397



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  271  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  330

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  331  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  390

Query  362  AALEKDY  382
            AALEKDY
Sbjct  391  AALEKDY  397



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  112  DPRHGKYMACCMMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  171

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTS+AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  172  GDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  231

Query  362  AALEKDY  382
            AALEKD+
Sbjct  232  AALEKDF  238



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  48   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  107

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  108  GDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  167

Query  362  AALEKDY  382
            AALEKDY
Sbjct  168  AALEKDY  174



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPG
Sbjct  111  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPG  170

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  171  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  230

Query  362  AALEKDY  382
            AALEKDY
Sbjct  231  AALEKDY  237



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  39   DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  98

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  99   GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  158

Query  362  AALEKDY  382
            AALEKDY
Sbjct  159  AALEKDY  165



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPG
Sbjct  56   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPG  115

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  116  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  175

Query  362  AALEKDY  382
            AALEKDY
Sbjct  176  AALEKDY  182



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  236  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  295

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST +AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  296  GDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  355

Query  362  AALEKDY  382
            AALEKDY
Sbjct  356  AALEKDY  362



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  140  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  199

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  200  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  259

Query  362  AALEKDY  382
            AALEKDY
Sbjct  260  AALEKDY  266



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  105  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  164

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  165  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  224

Query  362  AALEKDY  382
            AALEKDY
Sbjct  225  AALEKDY  231



>emb|CAC84108.1| alpha-tubulin, partial [Gossypium hirsutum]
Length=132

 Score =   260 bits (665),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  6    DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  65

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  66   GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  125

Query  362  AALEK  376
            AALEK
Sbjct  126  AALEK  130



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPG
Sbjct  105  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPG  164

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  165  GDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  224

Query  362  AALEKDY  382
            AALEKDY
Sbjct  225  AALEKDY  231



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  111  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  170

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  171  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  230

Query  362  AALEKDY  382
             ALEKDY
Sbjct  231  RALEKDY  237



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  201  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  260

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  261  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  320

Query  362  AALEKDY  382
            AALEKDY
Sbjct  321  AALEKDY  327



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AAG28536.1|AF199019_1 alpha tubulin [Leishmania major]
Length=200

 Score =   262 bits (670),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM+CCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  55   DPRHGKYMSCCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  114

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  115  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  174

Query  362  AALEKDY  382
            AALEKDY
Sbjct  175  AALEKDY  181



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  278  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  337

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  338  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  397

Query  362  AALEKDY  382
            AALEKDY
Sbjct  398  AALEKDY  404



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  95   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  154

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  155  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  214

Query  362  AALEKDY  382
            AALEKDY
Sbjct  215  AALEKDY  221



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  307  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  366

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  367  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  426

Query  362  AALEKDY  382
            AALEKDY
Sbjct  427  AALEKDY  433



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   264 bits (675),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  112  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  171

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  172  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  231

Query  362  AALEKDY  382
            AALEKDY
Sbjct  232  AALEKDY  238



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   264 bits (675),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  104  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  163

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  164  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  223

Query  362  AALEKDY  382
            AALEKDY
Sbjct  224  AALEKDY  230



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  287  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  346

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  347  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  406

Query  362  AALEKDY  382
            AALEKDY
Sbjct  407  AALEKDY  413



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  272  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  331

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  332  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  391

Query  362  AALEKDY  382
            AALEKDY
Sbjct  392  AALEKDY  398



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPG
Sbjct  105  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPG  164

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  165  GDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  224

Query  362  AALEKDY  382
            AALEKDY
Sbjct  225  AALEKDY  231



>ref|XP_006482574.1| PREDICTED: tubulin alpha chain-like [Citrus sinensis]
Length=150

 Score =   260 bits (665),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  6    DPRHGKYMACCLMYRGDVVPKDVNAAVAAIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  65

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  66   GDLAKVQRAVCMISNSTSVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  125

Query  362  AALEKDY  382
            AALEKDY
Sbjct  126  AALEKDY  132



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/127 (99%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  305  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  364

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  365  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  424

Query  362  AALEKDY  382
            AALEKDY
Sbjct  425  AALEKDY  431



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  154  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  213

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  214  GDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  273

Query  362  AALEKDY  382
            AALEKDY
Sbjct  274  AALEKDY  280



>ref|XP_003886491.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ41034.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
Length=151

 Score =   260 bits (665),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM+CCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  6    DPRHGKYMSCCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  65

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  66   GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  125

Query  362  AALEKDY  382
            AALEKDY
Sbjct  126  AALEKDY  132



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  259  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  318

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  319  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  378

Query  362  AALEKDY  382
            AALEKDY
Sbjct  379  AALEKDY  385



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  158  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  217

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  218  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  277

Query  362  AALEKDY  382
            AALEKDY
Sbjct  278  AALEKDY  284



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  295  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  354

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  355  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  414

Query  362  AALEKDY  382
            AALEKDY
Sbjct  415  AALEKDY  421



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   261 bits (668),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DP+HGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  39   DPKHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  98

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  99   GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  158

Query  362  AALEKDY  382
            AALEKDY
Sbjct  159  AALEKDY  165



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>emb|CBH08953.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=190

 Score =   261 bits (668),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  45   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  104

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  105  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  164

Query  362  AALEKDY  382
            AALEKDY
Sbjct  165  AALEKDY  171



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  302  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  361

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  362  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  421

Query  362  AALEKDY  382
            AALEKDY
Sbjct  422  AALEKDY  428



>emb|CAD20819.1| alpha tubulin [Zea mays]
Length=146

 Score =   260 bits (664),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  1    DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  60

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  61   GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  120

Query  362  AALEKDY  382
             ALEKDY
Sbjct  121  RALEKDY  127



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  291  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  350

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  351  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  410

Query  362  AALEKDY  382
            AALEKDY
Sbjct  411  AALEKDY  417



>emb|CDY35856.1| BnaC09g37880D [Brassica napus]
Length=149

 Score =   260 bits (664),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  5    DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  64

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  65   GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  124

Query  362  AALEKDY  382
            AALEKDY
Sbjct  125  AALEKDY  131



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   264 bits (675),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  126  DPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  185

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  186  GDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  245

Query  362  AALEKDY  382
            AALEKDY
Sbjct  246  AALEKDY  252



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  169  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  228

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  229  GDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  288

Query  362  AALEKDY  382
            AALEKDY
Sbjct  289  AALEKDY  295



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002779346.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER11141.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=186

 Score =   261 bits (667),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  39   DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  98

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKV RAVCMISNST+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  99   GDLAKVMRAVCMISNSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  158

Query  362  AALEKDY  382
            AALEKDY
Sbjct  159  AALEKDY  165



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  308  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  367

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  368  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  427

Query  362  AALEKDY  382
            AALEKDY
Sbjct  428  AALEKDY  434



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AAU10519.1| alpha tubulin, partial [Leishmania donovani]
Length=249

 Score =   263 bits (672),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM+CCLM+RGDVVPKDVNAA+ATI+TKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  104  DPRHGKYMSCCLMYRGDVVPKDVNAAIATIETKRTIQFVDWCPTGFKCGINYQPPTVVPG  163

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  164  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  223

Query  362  AALEKDY  382
            AALEKDY
Sbjct  224  AALEKDY  230



>gb|KJB33191.1| hypothetical protein B456_006G002500 [Gossypium raimondii]
Length=183

 Score =   261 bits (666),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM CCLM+RGDVV KDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  39   DPRHGKYMDCCLMYRGDVVRKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  98

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV EGMEEGEFSEAREDL
Sbjct  99   GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVSEGMEEGEFSEAREDL  158

Query  362  AALEKDY  382
            AALEKDY
Sbjct  159  AALEKDY  165



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  310  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  369

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  370  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  429

Query  362  AALEKDY  382
            AALEKDY
Sbjct  430  AALEKDY  436



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  303  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  362

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  363  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  422

Query  362  AALEKDY  382
            AALEKDY
Sbjct  423  AALEKDY  429



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  322  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  381

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  382  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  441

Query  362  AALEKDY  382
            AALEKDY
Sbjct  442  AALEKDY  448



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|EKG00833.1| epsilon tubulin, putative [Trypanosoma cruzi]
 gb|ESL09113.1| hypothetical protein TRSC58_03174 [Trypanosoma rangeli SC58]
 gb|ESL09781.1| hypothetical protein TRSC58_02494 [Trypanosoma rangeli SC58]
Length=151

 Score =   259 bits (663),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  6    DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPG  65

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  66   GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  125

Query  362  AALEKDY  382
            AALEKDY
Sbjct  126  AALEKDY  132



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  169  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  228

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  229  GDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  288

Query  362  AALEKDY  382
            AALEKDY
Sbjct  289  AALEKDY  295



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  311  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  370

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  371  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  430

Query  362  AALEKDY  382
            AALEKDY
Sbjct  431  AALEKDY  437



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  309  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  368

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  369  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  428

Query  362  AALEKDY  382
            AALEKDY
Sbjct  429  AALEKDY  435



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  110  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  169

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++ E+FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  170  GDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  229

Query  362  AALEKDY  382
            AALEKD+
Sbjct  230  AALEKDF  236



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRA VHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRALVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  169  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  228

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  229  GDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  288

Query  362  AALEKDY  382
            AALEKDY
Sbjct  289  AALEKDY  295



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  169  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  228

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  229  GDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  288

Query  362  AALEKDY  382
            AALEKDY
Sbjct  289  AALEKDY  295



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KDO25258.1| hypothetical protein SPRG_09506 [Saprolegnia parasitica CBS 223.65]
Length=186

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  39   DPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  98

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAF HWYVGEGMEEGEFSEAREDL
Sbjct  99   GDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDL  158

Query  362  AALEKDY  382
            AALEKDY
Sbjct  159  AALEKDY  165



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  41   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  100

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  101  GDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  160

Query  362  AALEKDY  382
            AALEKDY
Sbjct  161  AALEKDY  167



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  176  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  235

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  236  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  295

Query  362  AALEKDY  382
            AALEKDY
Sbjct  296  AALEKDY  302



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  287  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  346

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  347  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  406

Query  362  AALEKDY  382
            AALEKDY
Sbjct  407  AALEKDY  413



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  356  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  415

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  416  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  475

Query  362  AALEKDY  382
            AALEKDY
Sbjct  476  AALEKDY  482



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  62   DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  121

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  122  GDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  181

Query  362  AALEKDY  382
            AALEKDY
Sbjct  182  AALEKDY  188



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVA+VFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVADVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPG
Sbjct  176  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPG  235

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  236  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  295

Query  362  AALEKDY  382
            AALEKDY
Sbjct  296  AALEKDY  302



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPG
Sbjct  176  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPG  235

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  236  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  295

Query  362  AALEKDY  382
            AALEKDY
Sbjct  296  AALEKDY  302



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|EPY40479.1| tubulin alpha [Angomonas deanei]
 gb|EPY41044.1| tubulin alpha [Angomonas deanei]
 gb|EPY41215.1| tubulin alpha [Angomonas deanei]
Length=248

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM+CCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  104  DPRHGKYMSCCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPG  163

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  164  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  223

Query  362  AALEKDY  382
            AALEKDY
Sbjct  224  AALEKDY  230



>gb|AAO46128.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPG
Sbjct  105  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPG  164

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRIDHKFD MY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  165  GDLAKVQRAVCMISNSTAIAEVFSRIDHKFDSMYAKRAFVHWYVGEGMEEGEFSEAREDL  224

Query  362  AALEKDY  382
            AALEKDY
Sbjct  225  AALEKDY  231



>gb|EPY33355.1| tubulin alpha [Strigomonas culicis]
 gb|EPY33584.1| tubulin alpha [Strigomonas culicis]
Length=315

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM+CCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  171  DPRHGKYMSCCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPG  230

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  231  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  290

Query  362  AALEKDY  382
            AALEKDY
Sbjct  291  AALEKDY  297



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFV+WCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVEWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  303  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  362

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  363  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  422

Query  362  AALEKDY  382
            AALEKDY
Sbjct  423  AALEKDY  429



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  201  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  260

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  261  GDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  320

Query  362  AALEKDY  382
            AALEKDY
Sbjct  321  AALEKDY  327



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ADJ00012.1| tubulin alpha chain [Chromera velia]
Length=234

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  108  DPRHGKYMACCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  167

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKV RA CMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  168  GDLAKVMRACCMISNSTAIAEVFSRMDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  227

Query  362  AALEKDY  382
            AALEKDY
Sbjct  228  AALEKDY  234



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|EPY39349.1| tubulin alpha, partial [Angomonas deanei]
Length=306

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM+CCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  171  DPRHGKYMSCCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPG  230

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  231  GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  290

Query  362  AALEKDY  382
            AALEKDY
Sbjct  291  AALEKDY  297



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPG
Sbjct  261  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPG  320

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  321  GDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  380

Query  362  AALEKDY  382
            AALEKDY
Sbjct  381  AALEKDY  387



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABL61202.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  154  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  213

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSRID KF+LMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  214  GDLAKVQRAVCMISNSTAIAEVFSRIDRKFELMYAKRAFVHWYVGEGMEEGEFSEAREDL  273

Query  362  AALEKDY  382
            AALEKDY
Sbjct  274  AALEKDY  280



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF+HWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABL61219.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  169  DPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  228

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST+VAEVFSRID KFDLMY KRAF HWYVGEGMEEGEFSEAREDL
Sbjct  229  GDLAKVQRAVCMISNSTAVAEVFSRIDRKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDL  288

Query  362  AALEKDY  382
            AALEKDY
Sbjct  289  AALEKDY  295



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  250  DPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  309

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  310  GDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  369

Query  362  AALEKDY  382
            AALEKDY
Sbjct  370  AALEKDY  376



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPG
Sbjct  257  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPG  316

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  317  GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  376

Query  362  AALEKDY  382
            AALEKDY
Sbjct  377  AALEKDY  383



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  271  DPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  330

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  331  GDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  390

Query  362  AALEKDY  382
            AALEKDY
Sbjct  391  AALEKDY  397



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPG
Sbjct  306  DPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  365

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  366  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  425

Query  362  AALEKDY  382
            AALEKDY
Sbjct  426  AALEKDY  432



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPG
Sbjct  219  DPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPG  278

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  279  GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL  338

Query  362  AALEKDY  382
            AALEKDY
Sbjct  339  AALEKDY  345



>gb|EPY32266.1| alpha tubulin [Strigomonas culicis]
 gb|EPY32660.1| alpha tubulin [Strigomonas culicis]
Length=150

 Score =   258 bits (658),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPG  181
            DPRHGKYM+CCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPG
Sbjct  6    DPRHGKYMSCCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPG  65

Query  182  GDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDL  361
            GDLAKVQRAVCMI+NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL
Sbjct  66   GDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDL  125

Query  362  AALEKDY  382
            AALEKDY
Sbjct  126  AALEKDY  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875